GenomeNet

Database: Pfam
Entry: Herpes_LP
LinkDB: Herpes_LP
Original site: Herpes_LP 
#=GF ID   Herpes_LP
#=GF AC   PF03363.11
#=GF DE   Herpesvirus leader protein
#=GF AU   Mifsud W
#=GF SE   Pfam-B_1664 (release 6.6)
#=GF GA   25.00 25.00;
#=GF TC   1575.20 257.50;
#=GF NC   21.00 19.80;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   10590127
#=GF RT   Sequence and functional analysis of EBNA-LP and EBNA2 proteins
#=GF RT   from nonhuman primate lymphocryptoviruses. 
#=GF RA   Peng R, Gordadze AV, Fuentes Panana EM, Wang F, Zong J, Hayward
#=GF RA   GS, Tan J, Ling PD; 
#=GF RL   J Virol 2000;74:379-389.
#=GF RN   [2]
#=GF RM   11024123
#=GF RT   Conserved regions in the Epstein-Barr virus leader protein
#=GF RT   define distinct domains required for nuclear localization and
#=GF RT   transcriptional cooperation with EBNA2. 
#=GF RA   Peng R, Tan J, Ling PD; 
#=GF RL   J Virol 2000;74:9953-9963.
#=GF DR   INTERPRO; IPR005030;
#=GF SQ   12
#=GS EBNA5_EBVB9/331-504  AC Q8AZK7.1
#=GS EBNA5_EBVA8/1-133    AC Q1HVI8.1
#=GS EBNA5_EBVB9/199-331  AC Q8AZK7.1
#=GS EBNA5_EBVA8/265-394  AC Q1HVI8.1
#=GS EBNA5_EBVB9/67-199   AC Q8AZK7.1
#=GS EBNA5_EBVA8/67-199   AC Q1HVI8.1
#=GS EBNA5_EBVA8/331-504  AC Q1HVI8.1
#=GS EBNA5_EBVB9/133-265  AC Q8AZK7.1
#=GS EBNA5_EBVA8/199-331  AC Q1HVI8.1
#=GS EBNA5_EBVA8/133-265  AC Q1HVI8.1
#=GS EBNA5_EBVB9/265-394  AC Q8AZK7.1
#=GS EBNA5_EBVB9/1-133    AC Q8AZK7.1
EBNA5_EBVB9/331-504             .RGDRSEGPGPTRPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGPRGDRSEGPGPTRPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGPLRPRPRPPARSLREWLLRIRDHFEPPTVTTQRQSVYIEEEED.
EBNA5_EBVA8/1-133               m-GDRSEVPGPARPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGPRGDRSEVPGPARPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGP------------------------------------------r
EBNA5_EBVB9/199-331             .RGDRSEGPGPTRPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGPRGDRSEGPGPTRPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGP------------------------------------------r
EBNA5_EBVA8/265-394             .RGDRSEVPGPARPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGPRGDRSEVPGPARPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPS--------------------------------------------.
EBNA5_EBVB9/67-199              .RGDRSEGPGPTRPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGPRGDRSEGPGPTRPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGP------------------------------------------r
EBNA5_EBVA8/67-199              .RGDRSEVPGPARPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGPRGDRSEVPGPARPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGP------------------------------------------r
EBNA5_EBVA8/331-504             .RGDRSEVPGPARPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGPRGDRSEVPGPARPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGPLRPRPQPPAQSLREWLLRISERFDPHPVATRRQSVYIEEEED.
EBNA5_EBVB9/133-265             .RGDRSEGPGPTRPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGPRGDRSEGPGPTRPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGP------------------------------------------r
EBNA5_EBVA8/199-331             .RGDRSEVPGPARPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGPRGDRSEVPGPARPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGP------------------------------------------r
EBNA5_EBVA8/133-265             .RGDRSEVPGPARPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGPRGDRSEVPGPARPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGP------------------------------------------r
EBNA5_EBVB9/265-394             .RGDRSEGPGPTRPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGPRGDRSEGPGPTRPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPS--------------------------------------------.
EBNA5_EBVB9/1-133               m-GDRSEGPGPTRPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGPRGDRSEGPGPTRPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGP------------------------------------------r
#=GC seq_cons                   .RGDRSEsPGPsRPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGPRGDRSEsPGPsRPGPPGIGPEGPLGQLLRRHRSPSPTRGGQEPRRVRRRVLVQQEEEVVSGSPSGP..........................................R
//
DBGET integrated database retrieval system