GenomeNet

Database: Pfam
Entry: INSIG
LinkDB: INSIG
Original site: INSIG 
#=GF ID   INSIG
#=GF AC   PF07281.10
#=GF DE   Insulin-induced protein (INSIG)
#=GF AU   Vella Briffa B
#=GF SE   Pfam-B_17905 (release 10.0)
#=GF GA   25.20 25.20;
#=GF TC   25.20 25.70;
#=GF NC   24.90 24.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   12202038
#=GF RT   Crucial step in cholesterol homeostasis: sterols promote binding
#=GF RT   of SCAP to INSIG-1, a membrane protein that facilitates
#=GF RT   retention of SREBPs in ER. 
#=GF RA   Yang T, Espenshade PJ, Wright ME, Yabe D, Gong Y, Aebersold R,
#=GF RA   Goldstein JL, Brown MS; 
#=GF RL   Cell 2002;110:489-500.
#=GF RN   [2]
#=GF RM   12242332
#=GF RT   Insig-2, a second endoplasmic reticulum protein that binds SCAP
#=GF RT   and blocks export of sterol regulatory element-binding proteins. 
#=GF RA   Yabe D, Brown MS, Goldstein JL; 
#=GF RL   Proc Natl Acad Sci U S A 2002;99:12753-12758.
#=GF DR   INTERPRO; IPR025929;
#=GF CC   This family contains a number of eukaryotic Insulin-induced
#=GF CC   proteins (INSIG-1 and INSIG-2) approximately 200 residues long.
#=GF CC   INSIG-1 and INSIG-2 are found in the endoplasmic reticulum and
#=GF CC   bind the sterol-sensing domain of SREBP cleavage-activating
#=GF CC   protein (SCAP), preventing it from escorting SREBPs to the
#=GF CC   Golgi. Their combined action permits feedback regulation of
#=GF CC   cholesterol synthesis over a wide range of sterol concentrations
#=GF CC   [1,2].
#=GF SQ   412
#=GS INSI2_CALJA/30-211          AC B0CMA4.1
#=GS A0A094HD51_9PEZI/139-362    AC A0A094HD51.1
#=GS INSI2_MOUSE/30-211          AC Q91WG1.1
#=GS U7PQ59_SPOS1/218-464        AC U7PQ59.1
#=GS A0A0E9NCD8_9ASCO/104-307    AC A0A0E9NCD8.1
#=GS T1EG13_HELRO/8-189          AC T1EG13.1
#=GS M0TSN1_MUSAM/49-205         AC M0TSN1.1
#=GS A0A074VKW4_9PEZI/144-376    AC A0A074VKW4.1
#=GS G1M1N9_AILME/37-218         AC G1M1N9.1
#=GS H0VRQ7_CAVPO/63-244         AC H0VRQ7.1
#=GS C9SPY0_VERA1/1-209          AC C9SPY0.1
#=GS A0A0J8CCX4_BETVU/50-211     AC A0A0J8CCX4.1
#=GS W6MRF2_9ASCO/96-305         AC W6MRF2.1
#=GS E9D1T2_COCPS/134-362        AC E9D1T2.1
#=GS F9XFP1_ZYMTI/1-176          AC F9XFP1.1
#=GS W7M5V9_GIBM7/153-370        AC W7M5V9.1
#=GS A0A0M9F0K8_9HYPO/154-372    AC A0A0M9F0K8.1
#=GS J3NIF0_GAGT3/205-433        AC J3NIF0.1
#=GS A7THJ0_VANPO/127-283        AC A7THJ0.1
#=GS A0A0D2PZ49_GOSRA/48-192     AC A0A0D2PZ49.1
#=GS S9Y788_9CETA/371-552        AC S9Y788.1
#=GS F7FRI2_CALJA/1-103          AC F7FRI2.1
#=GS A0A093XIP0_9PEZI/138-357    AC A0A093XIP0.1
#=GS Q6FP81_CANGA/141-296        AC Q6FP81.1
#=GS Q754M9_ASHGO/91-269         AC Q754M9.1
#=GS A0A0G2FXU4_9PEZI/164-281    AC A0A0G2FXU4.1
#=GS Q6BJN8_DEBHA/95-321         AC Q6BJN8.2
#=GS G0WCX0_NAUDC/89-255         AC G0WCX0.1
#=GS I3JF34_ORENI/85-266         AC I3JF34.1
#=GS B8N9S0_ASPFN/130-349        AC B8N9S0.1
#=GS G8BVA6_TETPH/118-296        AC G8BVA6.1
#=GS E0CXF1_MOUSE/30-146         AC E0CXF1.1
#=GS F7HBW4_MACMU/30-211         AC F7HBW4.1
#=GS Q0CLJ8_ASPTN/128-344        AC Q0CLJ8.1
#=GS G3SRK7_LOXAF/30-211         AC G3SRK7.1
#=GS Q8AV60_DANRE/26-207         AC Q8AV60.1
#=GS A0A086SXH7_ACRCH/153-392    AC A0A086SXH7.1
#=GS B9I9F8_POPTR/49-210         AC B9I9F8.1
#=GS B6JWJ4_SCHJY/118-301        AC B6JWJ4.1
#=GS F2PW23_TRIEC/175-387        AC F2PW23.1
#=GS H2M3Q1_ORYLA/60-241         AC H2M3Q1.1
#=GS H2P7D4_PONAB/30-204         AC H2P7D4.2
#=GS H2PP51_PONAB/86-267         AC H2PP51.1
#=GS I3MG28_ICTTR/30-211         AC I3MG28.1
#=GS S7ZEQ1_PENO1/139-351        AC S7ZEQ1.1
#=GS K2RQH4_MACPH/253-497        AC K2RQH4.1
#=GS H2QIL8_PANTR/30-211         AC H2QIL8.1
#=GS E7KTG1_YEASL/114-274        AC E7KTG1.1
#=GS W3WSL5_9PEZI/171-346        AC W3WSL5.1
#=GS W6VD28_ECHGR/5-177          AC W6VD28.1
#=GS A0A0B4HAW1_9HYPO/164-380    AC A0A0B4HAW1.1
#=GS G1N049_MELGA/1-131          AC G1N049.1
#=GS A0A096NRW2_PAPAN/86-267     AC A0A096NRW2.1
#=GS G3WIX0_SARHA/86-267         AC G3WIX0.1
#=GS A0A094GF57_9PEZI/139-362    AC A0A094GF57.1
#=GS K1S6Q0_CRAGI/5-191          AC K1S6Q0.1
#=GS A0A0D9MNU9_9EURO/138-352    AC A0A0D9MNU9.1
#=GS INSI1_DANRE/60-241          AC Q8AV61.1
#=GS E3RCG2_PYRTT/189-420        AC E3RCG2.1
#=GS F6Y9H0_CALJA/86-267         AC F6Y9H0.1
#=GS H0ZMV3_TAEGU/1-131          AC H0ZMV3.1
#=GS U4L8L6_PYROM/242-271        AC U4L8L6.1
#=GS A0A074WRP6_9PEZI/148-383    AC A0A074WRP6.1
#=GS INSI2_CHICK/51-153          AC Q5F3W2.1
#=GS V3ZPY9_LOTGI/9-190          AC V3ZPY9.1
#=GS G3RIH5_GORGO/30-211         AC G3RIH5.1
#=GS M2XIY7_DOTSN/162-387        AC M2XIY7.1
#=GS INSI1_BOVIN/85-266          AC A0JNC3.1
#=GS A7EKY6_SCLS1/112-339        AC A7EKY6.1
#=GS A0A0G4EKP3_9ALVE/1-186      AC A0A0G4EKP3.1
#=GS I1GEV3_AMPQE/3-153          AC I1GEV3.1
#=GS E7NIN1_YEASO/102-272        AC E7NIN1.1
#=GS G1X7W0_ARTOA/158-375        AC G1X7W0.1
#=GS G1Q6D1_MYOLU/1-103          AC G1Q6D1.1
#=GS G1K3H0_XENTR/25-206         AC G1K3H0.1
#=GS A0A0N1P4K9_9EURO/136-255    AC A0A0N1P4K9.1
#=GS W5P9G9_SHEEP/85-266         AC W5P9G9.1
#=GS Q4WP15_ASPFU/121-340        AC Q4WP15.1
#=GS I2JZM2_DEKBR/88-382         AC I2JZM2.2
#=GS V8PFD5_OPHHA/30-214         AC V8PFD5.1
#=GS A0A094JI00_9PEZI/139-362    AC A0A094JI00.1
#=GS A0A0G2I241_9EURO/152-388    AC A0A0G2I241.1
#=GS J7RPV3_KAZNA/65-217         AC J7RPV3.1
#=GS C5GFU1_AJEDR/171-427        AC C5GFU1.1
#=GS A0A087YBH4_POEFO/84-265     AC A0A087YBH4.2
#=GS A5DMZ1_PICGU/85-306         AC A5DMZ1.2
#=GS N1JAD4_BLUG1/99-330         AC N1JAD4.1
#=GS F7CFM3_ORNAN/82-263         AC F7CFM3.2
#=GS A0A093ZF88_9PEZI/51-274     AC A0A093ZF88.1
#=GS I2GXU3_TETBL/90-273         AC I2GXU3.1
#=GS C5FWQ9_ARTOC/151-355        AC C5FWQ9.1
#=GS S3CIG7_OPHP1/204-448        AC S3CIG7.1
#=GS A0A0L9SQF0_9HYPO/146-374    AC A0A0L9SQF0.1
#=GS Q5AEY0_CANAL/115-333        AC Q5AEY0.1
#=GS G3H5D0_CRIGR/30-211         AC G3H5D0.1
#=GS A7S1I3_NEMVE/14-195         AC A7S1I3.1
#=GS G4N7B0_MAGO7/200-434        AC G4N7B0.1
#=GS Q2H703_CHAGB/197-477        AC Q2H703.1
#=GS Q5AEJ5_CANAL/116-334        AC Q5AEJ5.1
#=GS G3N9F8_GASAC/55-157         AC G3N9F8.1
#=GS H6BNY0_EXODN/133-351        AC H6BNY0.1
#=GS G2X925_VERDV/158-376        AC G2X925.1
#=GS M7TP36_EUTLA/248-544        AC M7TP36.1
#=GS A0A094FK17_9PEZI/752-971    AC A0A094FK17.1
#=GS A0A094BTU5_9PEZI/135-358    AC A0A094BTU5.1
#=GS F1SHU4_PIG/85-266           AC F1SHU4.2
#=GS H1VBS5_COLHI/155-370        AC H1VBS5.1
#=GS X0JUK2_FUSOX/153-370        AC X0JUK2.1
#=GS R0JTC6_SETT2/185-410        AC R0JTC6.1
#=GS U4L8L6_PYROM/105-250        AC U4L8L6.1
#=GS A0A0F4GWW2_9PEZI/156-379    AC A0A0F4GWW2.1
#=GS U9U586_RHIID/153-235        AC U9U586.1
#=GS S3DDR7_GLAL2/116-353        AC S3DDR7.1
#=GS G3N9F3_GASAC/34-215         AC G3N9F3.1
#=GS Q6CH05_YARLI/99-282         AC Q6CH05.1
#=GS F6Y9K5_CALJA/20-115         AC F6Y9K5.1
#=GS A0A0L0NDC3_9HYPO/300-533    AC A0A0L0NDC3.1
#=GS A0A0D2XZ81_FUSO4/153-370    AC A0A0D2XZ81.1
#=GS B6QHG7_TALMQ/129-335        AC B6QHG7.1
#=GS A0A059A8Z1_EUCGR/59-253     AC A0A059A8Z1.1
#=GS A0A0F7TVA5_9EURO/140-352    AC A0A0F7TVA5.1
#=GS A0A0D9R2G0_CHLSB/86-267     AC A0A0D9R2G0.1
#=GS I1JBD8_SOYBN/56-215         AC I1JBD8.1
#=GS D5GBX7_TUBMM/267-460        AC D5GBX7.1
#=GS A0A0G4LU39_9PEZI/1126-1344  AC A0A0G4LU39.1
#=GS M7UWF2_BOTF1/111-338        AC M7UWF2.1
#=GS A0A090N2W3_OSTTA/63-328     AC A0A090N2W3.1
#=GS A0A0K8L739_9EURO/131-350    AC A0A0K8L739.1
#=GS K0KJ43_WICCF/67-260         AC K0KJ43.1
#=GS H3CKD4_TETNG/28-209         AC H3CKD4.1
#=GS E7KH17_YEASA/114-275        AC E7KH17.1
#=GS E7KPH9_YEASL/102-290        AC E7KPH9.1
#=GS M3AT74_PSEFD/33-265         AC M3AT74.1
#=GS F6US22_MONDO/86-267         AC F6US22.2
#=GS INSI1_MOUSE/68-249          AC Q8BGI3.1
#=GS G3AY76_CANTC/103-323        AC G3AY76.1
#=GS W6PUC4_PENRO/137-350        AC W6PUC4.1
#=GS INSI1_XENTR/60-241          AC Q0V9G6.1
#=GS A0A094G8H0_9PEZI/139-362    AC A0A094G8H0.1
#=GS G3N9G6_GASAC/29-210         AC G3N9G6.1
#=GS A0A093Y4I8_9PEZI/138-357    AC A0A093Y4I8.1
#=GS H2N2V0_ORYLA/100-179        AC H2N2V0.1
#=GS A0A0P7V927_9TELE/2-146      AC A0A0P7V927.1
#=GS E1BP19_BOVIN/30-211         AC E1BP19.1
#=GS J8Q304_SACAR/114-276        AC J8Q304.1
#=GS A0A015J8X1_9GLOM/153-318    AC A0A015J8X1.1
#=GS G0W6S5_NAUDC/139-324        AC G0W6S5.1
#=GS J7S777_KAZNA/79-275         AC J7S777.1
#=GS G1PVG6_MYOLU/88-269         AC G1PVG6.1
#=GS C1GA12_PARBD/174-384        AC C1GA12.2
#=GS G3JQS6_CORMM/181-412        AC G3JQS6.1
#=GS R8BTY1_TOGMI/159-380        AC R8BTY1.1
#=GS L8FM11_PSED2/139-362        AC L8FM11.1
#=GS M1W7U7_CLAP2/164-379        AC M1W7U7.1
#=GS H3B8S7_LATCH/32-213         AC H3B8S7.1
#=GS F8W4P3_DANRE/1-103          AC F8W4P3.1
#=GS A1CXK5_NEOFI/121-340        AC A1CXK5.1
#=GS A3LUC1_PICST/90-312         AC A3LUC1.1
#=GS E9E550_METAQ/164-401        AC E9E550.1
#=GS A0A074Z2F4_9PEZI/144-376    AC A0A074Z2F4.1
#=GS K7XAX2_SHEEP/30-211         AC K7XAX2.1
#=GS INSI2_PONAB/30-211          AC Q5R687.2
#=GS G1L328_AILME/1-130          AC G1L328.1
#=GS F2T2W4_AJEDA/171-427        AC F2T2W4.1
#=GS A0A068XVQ8_HYMMI/6-182      AC A0A068XVQ8.1
#=GS G3RT31_GORGO/86-267         AC G3RT31.1
#=GS A0A0A1SZH1_9HYPO/153-372    AC A0A0A1SZH1.1
#=GS B6HVF3_PENRW/138-352        AC B6HVF3.1
#=GS U9TGE2_RHIID/1-100          AC U9TGE2.1
#=GS H0YQZ7_TAEGU/81-263         AC H0YQZ7.1
#=GS A0A0C4DGZ4_HUMAN/30-211     AC A0A0C4DGZ4.1
#=GS G3UQT2_MELGA/30-211         AC G3UQT2.1
#=GS E7QFP9_YEASZ/13-175         AC E7QFP9.1
#=GS G3NID4_GASAC/7-188          AC G3NID4.1
#=GS H2V9D0_TAKRU/22-203         AC H2V9D0.1
#=GS NSG2_YEAST/114-274          AC P53898.1
#=GS B2GRG1_DANRE/60-241         AC B2GRG1.1
#=GS M3YDU4_MUSPF/1-103          AC M3YDU4.1
#=GS A0A061DTD6_THECC/48-206     AC A0A061DTD6.1
#=GS A0A0D9MNR2_ASPFL/130-349    AC A0A0D9MNR2.1
#=GS INS1_SCHPO/95-281           AC Q9Y7R5.1
#=GS M3WVQ4_FELCA/1-135          AC M3WVQ4.1
#=GS F9G507_FUSOF/153-370        AC F9G507.1
#=GS G1K9U7_ANOCA/38-219         AC G1K9U7.2
#=GS A0A0B1PDX9_UNCNE/110-343    AC A0A0B1PDX9.1
#=GS M3ZJW1_XIPMA/84-265         AC M3ZJW1.1
#=GS A0A0F4ZAG7_9PEZI/204-434    AC A0A0F4ZAG7.1
#=GS G0VA72_NAUCC/110-294        AC G0VA72.1
#=GS C5DZL8_ZYGRC/86-242         AC C5DZL8.1
#=GS T5AFN7_OPHSC/157-279        AC T5AFN7.1
#=GS G5AVC9_HETGA/63-244         AC G5AVC9.1
#=GS V5G359_BYSSN/130-342        AC V5G359.1
#=GS A0A0F2LXZ0_SPOSC/218-464    AC A0A0F2LXZ0.1
#=GS G8JUI6_ERECY/93-247         AC G8JUI6.1
#=GS L5JZP7_PTEAL/30-211         AC L5JZP7.1
#=GS A0A016PKP1_GIBZA/154-371    AC A0A016PKP1.1
#=GS F7W133_SORMK/225-506        AC F7W133.1
#=GS G5BIB8_HETGA/30-211         AC G5BIB8.1
#=GS A0A015K756_9GLOM/153-334    AC A0A015K756.1
#=GS M3XP89_MUSPF/30-211         AC M3XP89.1
#=GS M2LBR2_BAUCO/157-378        AC M2LBR2.1
#=GS Q6CIB9_KLULA/75-235         AC Q6CIB9.1
#=GS T1ED94_HELRO/6-185          AC T1ED94.1
#=GS A0A0A8LDT1_9SACH/75-253     AC A0A0A8LDT1.1
#=GS INSI2_XENTR/23-204          AC Q5U4Q2.1
#=GS G1RMF4_NOMLE/30-211         AC G1RMF4.1
#=GS A5DXC0_LODEL/116-354        AC A5DXC0.1
#=GS A0A017SDM9_9EURO/126-341    AC A0A017SDM9.1
#=GS F6V608_HORSE/30-211         AC F6V608.1
#=GS INSI1_CHICK/61-242          AC Q5ZMT9.1
#=GS E7LZH0_YEASV/114-244        AC E7LZH0.1
#=GS B2AXP1_PODAN/181-429        AC B2AXP1.1
#=GS U3KGT8_FICAL/30-211         AC U3KGT8.1
#=GS W2RSC6_9EURO/134-340        AC W2RSC6.1
#=GS H2V9C8_TAKRU/60-241         AC H2V9C8.1
#=GS A0A0F8WSP6_9EURO/126-345    AC A0A0F8WSP6.1
#=GS G8ZPQ7_TORDC/109-265        AC G8ZPQ7.1
#=GS W9X4N9_9EURO/127-335        AC W9X4N9.1
#=GS G3Y8M7_ASPNA/123-339        AC G3Y8M7.1
#=GS E3QR22_COLGM/151-366        AC E3QR22.1
#=GS D4AY09_ARTBC/174-386        AC D4AY09.1
#=GS A0A068YE24_ECHMU/5-181      AC A0A068YE24.1
#=GS A0A0A2LA49_PENIT/138-350    AC A0A0A2LA49.1
#=GS A0A0G4LTK5_9PEZI/158-275    AC A0A0G4LTK5.1
#=GS M3BTQ2_SPHMS/169-399        AC M3BTQ2.1
#=GS G3X2R0_SARHA/30-211         AC G3X2R0.1
#=GS F6XME3_CALJA/86-267         AC F6XME3.1
#=GS M7NP36_PNEMU/109-303        AC M7NP36.1
#=GS C1GQD7_PARBA/168-384        AC C1GQD7.1
#=GS F2SGT0_TRIRC/174-386        AC F2SGT0.1
#=GS F7HBW1_MACMU/30-211         AC F7HBW1.1
#=GS I3MYH4_ICTTR/33-214         AC I3MYH4.1
#=GS F6US40_MONDO/30-211         AC F6US40.2
#=GS S6EEK1_ZYGB2/82-239         AC S6EEK1.1
#=GS T5AFN7_OPHSC/293-412        AC T5AFN7.1
#=GS INSI2_HUMAN/30-211          AC Q9Y5U4.2
#=GS X0DLJ0_FUSOX/153-370        AC X0DLJ0.1
#=GS X0JUS6_FUSOX/153-387        AC X0JUS6.1
#=GS F0UIK0_AJEC8/174-435        AC F0UIK0.1
#=GS Q2UGK5_ASPOR/130-349        AC Q2UGK5.1
#=GS NSG1_YEAST/102-290          AC P38837.1
#=GS C4QV83_PICPG/77-292         AC C4QV83.1
#=GS M3ZL26_XIPMA/35-216         AC M3ZL26.1
#=GS A0A0D2WK22_CAPO3/143-366    AC A0A0D2WK22.1
#=GS B8MK92_TALSN/135-340        AC B8MK92.1
#=GS W9XLJ6_9EURO/133-349        AC W9XLJ6.1
#=GS A0A063C484_9HYPO/162-378    AC A0A063C484.1
#=GS G4VHB2_SCHMA/46-224         AC G4VHB2.1
#=GS N1S6D3_FUSC4/153-370        AC N1S6D3.1
#=GS H0ZMV6_TAEGU/2-103          AC H0ZMV6.1
#=GS C4Y5U1_CLAL4/96-302         AC C4Y5U1.1
#=GS A0A067H4W0_CITSI/61-249     AC A0A067H4W0.1
#=GS A0A0D2LYV2_GOSRA/48-205     AC A0A0D2LYV2.1
#=GS F4NY11_BATDJ/58-266         AC F4NY11.1
#=GS H0XST0_OTOGA/78-262         AC H0XST0.1
#=GS A0A059A7Q1_EUCGR/59-218     AC A0A059A7Q1.1
#=GS F2U6C6_SALR5/4-178          AC F2U6C6.1
#=GS G2YX13_BOTF4/111-338        AC G2YX13.1
#=GS G1KKP8_ANOCA/71-252         AC G1KKP8.2
#=GS A0A0L0NY62_9ASCO/99-306     AC A0A0L0NY62.1
#=GS S0E992_GIBF5/153-370        AC S0E992.1
#=GS H2QVN6_PANTR/86-267         AC H2QVN6.1
#=GS A0A074XHQ6_AURPU/143-375    AC A0A074XHQ6.1
#=GS C4JUE9_UNCRE/81-309         AC C4JUE9.1
#=GS G2R9T8_THITE/190-458        AC G2R9T8.1
#=GS R1GGX4_BOTPV/251-330        AC R1GGX4.1
#=GS Q7SBU0_NEUCR/220-500        AC Q7SBU0.1
#=GS G3QHP4_GORGO/86-267         AC G3QHP4.1
#=GS F5H6P3_HUMAN/21-115         AC F5H6P3.1
#=GS X0CM28_FUSOX/153-387        AC X0CM28.1
#=GS L5L606_PTEAL/80-261         AC L5L606.1
#=GS A0A061DRL3_THECC/48-206     AC A0A061DRL3.1
#=GS B7QLN0_IXOSC/10-191         AC B7QLN0.1
#=GS W5LQT0_ASTMX/31-212         AC W5LQT0.1
#=GS W9Y8B8_9EURO/134-351        AC W9Y8B8.1
#=GS F7H2Z8_MACMU/1-130          AC F7H2Z8.1
#=GS INSI1_RAT/68-249            AC Q08755.1
#=GS G3U9S8_LOXAF/8-189          AC G3U9S8.1
#=GS H3D5G0_TETNG/60-241         AC H3D5G0.1
#=GS W5N440_LEPOC/60-241         AC W5N440.1
#=GS INSI2_RAT/30-211            AC Q80UA9.1
#=GS A0A0D9RVF8_CHLSB/30-211     AC A0A0D9RVF8.1
#=GS E4ZG61_LEPMJ/204-433        AC E4ZG61.1
#=GS Q0UXK1_PHANO/188-411        AC Q0UXK1.1
#=GS G2QCW9_MYCTT/184-468        AC G2QCW9.1
#=GS A0A0J9WP47_FUSO4/153-387    AC A0A0J9WP47.1
#=GS M3XID4_LATCH/60-241         AC M3XID4.1
#=GS V7BHX8_PHAVU/55-216         AC V7BHX8.1
#=GS G1T648_RABIT/87-271         AC G1T648.1
#=GS G3NIC8_GASAC/60-241         AC G3NIC8.1
#=GS C0NAF6_AJECG/174-435        AC C0NAF6.1
#=GS B2WFT2_PYRTR/189-396        AC B2WFT2.1
#=GS L5LQ78_MYODS/86-267         AC L5LQ78.1
#=GS G9NND2_HYPAI/172-401        AC G9NND2.1
#=GS B3RT72_TRIAD/16-202         AC B3RT72.1
#=GS N4VFS0_COLOR/156-377        AC N4VFS0.1
#=GS A6R3L5_AJECN/8-163          AC A6R3L5.1
#=GS A0A0G4LTK5_9PEZI/273-489    AC A0A0G4LTK5.1
#=GS INSI2_PIG/30-211            AC Q6PQZ3.2
#=GS U3J911_ANAPL/1-90           AC U3J911.1
#=GS L0PAN2_PNEJ8/106-270        AC L0PAN2.1
#=GS C1N570_MICPC/177-400        AC C1N570.1
#=GS U3ITA8_ANAPL/30-123         AC U3ITA8.1
#=GS W1P6T2_AMBTC/54-254         AC W1P6T2.1
#=GS S9WZ57_SCHCR/102-288        AC S9WZ57.1
#=GS A0A022RFC5_ERYGU/72-230     AC A0A022RFC5.1
#=GS A0A091EDK5_FUKDA/30-211     AC A0A091EDK5.1
#=GS F1NHV3_CHICK/1-131          AC F1NHV3.1
#=GS A0A0F8CP01_CERFI/92-215     AC A0A0F8CP01.1
#=GS J9P0Z4_CANLF/30-211         AC J9P0Z4.1
#=GS A0A0B0MY15_GOSAR/48-206     AC A0A0B0MY15.1
#=GS W9CGH4_9HELO/111-338        AC W9CGH4.1
#=GS G8B781_CANPC/108-326        AC G8B781.1
#=GS G1NIA2_MELGA/48-152         AC G1NIA2.2
#=GS G3N9G9_GASAC/16-197         AC G3N9G9.1
#=GS G0SFN6_CHATD/205-510        AC G0SFN6.1
#=GS T0JUU4_COLGC/148-368        AC T0JUU4.1
#=GS M3WAK3_FELCA/30-211         AC M3WAK3.1
#=GS A0A0B2X667_9HYPO/164-380    AC A0A0B2X667.1
#=GS A0A0P7UU87_9TELE/54-146     AC A0A0P7UU87.1
#=GS W1QBN7_OGAPD/97-291         AC W1QBN7.1
#=GS E4UVZ6_ARTGP/177-390        AC E4UVZ6.1
#=GS C6H4X0_AJECH/174-435        AC C6H4X0.1
#=GS G1M1N7_AILME/30-211         AC G1M1N7.1
#=GS G1RI47_NOMLE/86-267         AC G1RI47.1
#=GS J8Q1F0_SACAR/101-289        AC J8Q1F0.1
#=GS H2V9C9_TAKRU/25-206         AC H2V9C9.1
#=GS G3UB33_LOXAF/72-253         AC G3UB33.1
#=GS R7YYL4_CONA1/155-390        AC R7YYL4.1
#=GS B3S4T4_TRIAD/5-189          AC B3S4T4.1
#=GS K9H3N0_PEND2/138-351        AC K9H3N0.1
#=GS W5M5U3_LEPOC/33-214         AC W5M5U3.1
#=GS L2GHS1_COLGN/148-368        AC L2GHS1.1
#=GS K1XKZ2_MARBU/136-376        AC K1XKZ2.1
#=GS W9X135_9EURO/134-342        AC W9X135.1
#=GS A0A010RP60_9PEZI/147-368    AC A0A010RP60.1
#=GS A0A094GNI1_9PEZI/139-255    AC A0A094GNI1.1
#=GS A0A0L1JG75_ASPNO/130-349    AC A0A0L1JG75.1
#=GS M2SYS3_COCSN/166-416        AC M2SYS3.1
#=GS A0A0P7WCY1_9TELE/95-276     AC A0A0P7WCY1.1
#=GS A0A0F9XZD5_TRIHA/181-412    AC A0A0F9XZD5.1
#=GS A0A087WQP7_MOUSE/1-103      AC A0A087WQP7.1
#=GS J3K2N1_COCIM/134-362        AC J3K2N1.2
#=GS J4U3W6_SACK1/114-297        AC J4U3W6.1
#=GS H7C5L3_HUMAN/1-176          AC H7C5L3.1
#=GS G3ID14_CRIGR/4-194          AC G3ID14.1
#=GS T1JCX2_STRMM/17-207         AC T1JCX2.1
#=GS A0A093Z558_9PEZI/139-362    AC A0A093Z558.1
#=GS S8A8P3_DACHA/171-391        AC S8A8P3.1
#=GS F0XH28_GROCL/205-478        AC F0XH28.1
#=GS G3MWS1_BOVIN/30-211         AC G3MWS1.1
#=GS A0A093DEU4_CHAPE/1-131      AC A0A093DEU4.1
#=GS L1JGI9_GUITH/101-209        AC L1JGI9.1
#=GS H0WWY3_OTOGA/30-211         AC H0WWY3.1
#=GS C5DCV5_LACTC/80-258         AC C5DCV5.1
#=GS F6HZC0_VITVI/68-227         AC F6HZC0.1
#=GS E7QJV4_YEASZ/114-280        AC E7QJV4.1
#=GS A4RSA0_OSTLU/74-338         AC A4RSA0.1
#=GS I3KLI5_ORENI/39-220         AC I3KLI5.1
#=GS W4XF92_STRPU/55-236         AC W4XF92.1
#=GS A0A0A2VEH2_BEABA/165-408    AC A0A0A2VEH2.1
#=GS U3IIK9_ANAPL/66-247         AC U3IIK9.1
#=GS W4YYL3_STRPU/55-236         AC W4YYL3.1
#=GS R4GK90_CHICK/30-211         AC R4GK90.1
#=GS M2UB55_COCH5/182-416        AC M2UB55.1
#=GS W5KPN8_ASTMX/56-161         AC W5KPN8.1
#=GS G3X2R1_SARHA/30-211         AC G3X2R1.1
#=GS J4KLX3_BEAB2/174-392        AC J4KLX3.1
#=GS A1CH80_ASPCL/130-349        AC A1CH80.1
#=GS J6EM76_SACK1/101-289        AC J6EM76.1
#=GS L9L496_TUPCH/128-309        AC L9L496.1
#=GS G7YNV0_CLOSI/2-133          AC G7YNV0.1
#=GS G3AQH1_SPAPN/97-318         AC G3AQH1.1
#=GS Q5B4R5_EMENI/131-343        AC Q5B4R5.1
#=GS A0A0M0UGN9_9PEZI/173-435    AC A0A0M0UGN9.1
#=GS H2AWA1_KAZAF/63-243         AC H2AWA1.1
#=GS V8PEC7_OPHHA/83-264         AC V8PEC7.1
#=GS A0A084QEF8_9HYPO/155-385    AC A0A084QEF8.1
#=GS M5XUG4_PRUPE/56-247         AC M5XUG4.1
#=GS A2QI27_ASPNC/123-339        AC A2QI27.1
#=GS U3JWN1_FICAL/81-262         AC U3JWN1.1
#=GS K3W054_FUSPC/154-372        AC K3W054.1
#=GS G7X6S6_ASPKW/125-325        AC G7X6S6.1
#=GS F7BYS4_HORSE/86-267         AC F7BYS4.1
#=GS INSI1_HUMAN/86-267          AC O15503.3
#=GS A0A072NWI1_9EURO/134-352    AC A0A072NWI1.1
#=GS G8Y6E7_PICSO/93-321         AC G8Y6E7.1
#=GS H2AP64_KAZAF/66-205         AC H2AP64.1
#=GS U3CHF3_CALJA/30-211         AC U3CHF3.1
#=GS A0A087YHQ8_POEFO/40-221     AC A0A087YHQ8.1
#=GS E7Q8D3_YEASB/114-248        AC E7Q8D3.1
#=GS A0A066XL13_COLSU/151-384    AC A0A066XL13.1
#=GS F7H2V2_MACMU/1-130          AC F7H2V2.1
#=GS A0A0P7UU87_9TELE/144-214    AC A0A0P7UU87.1
#=GS G9N7T2_HYPVG/173-404        AC G9N7T2.1
#=GS E1ZIZ3_CHLVA/4-194          AC E1ZIZ3.1
#=GS A0A0F0II76_ASPPA/130-349    AC A0A0F0II76.1
#=GS E7Q4S8_YEASB/102-290        AC E7Q4S8.1
#=GS INSI2_PAPAN/30-211          AC A9RA88.1
#=GS G1SNI6_RABIT/30-211         AC G1SNI6.2
#=GS M7CC78_CHEMY/30-211         AC M7CC78.1
#=GS G4UNT1_NEUT9/220-499        AC G4UNT1.1
#=GS G0RQC4_HYPJQ/188-419        AC G0RQC4.1
#=GS H2UHY6_TAKRU/34-215         AC H2UHY6.1
#=GS A0A0B2X9B1_METRA/164-380    AC A0A0B2X9B1.1
#=GS V4U6K1_9ROSI/61-249         AC V4U6K1.1
#=GS G0VI67_NAUCC/79-242         AC G0VI67.1
#=GS E7KDH3_YEASA/102-238        AC E7KDH3.1
#=GS D4A242_RAT/68-249           AC D4A242.1
#=GS N4UPA1_FUSC1/109-326        AC N4UPA1.1
#=GS E2RJ47_CANLF/82-263         AC E2RJ47.2
#=GS C7YYL3_NECH7/153-376        AC C7YYL3.1
INSI2_CALJA/30-211                     ............................................................................................................................................................................................i-RGVVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-IAS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFNREWSNVMRCVAV...FV......GINHAS....A.........................KLDF...DN....N.........IQL........SLTLAALSVGLWWTFDRSRSG.FGLGVGI.AFLATVVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
A0A094HD51_9PEZI/139-362               .............................................................................................................................................................................................LRSALLFLLGTAYGLL.VTHL.HNEQRL..............................................aPFGTQg....fiQPSYDKKYL........LFWG.V...............AGVAMGSALPWFDGMWEE.YFGEE.V.TSSvi........................................ggkVIDGANEEEGVAAQWTPVVRSIGA...FF......GIAFAI....R.........................KLAW...TS....T.........LQA........SLTLALVNPFLWYLLDRSKPG.FVLSVTV.GLIGTTG...LLM.....F..DSSMV.QS...PLAAPs.........................................syNSTSGSA..HT..GFHAQG...GN............................NEL...FESAVWIMSVLFCSVLCFGHIGRRLA.....................................................
INSI2_MOUSE/30-211                     ............................................................................................................................................................................................i-RGVVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-ITS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...DN....N.........FQF........SLTLAALSVGLWWTFDRSRSG.FGLGVGI.AFLATVVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
U7PQ59_SPOS1/218-464                   ............................................................................................................................................................................................a-RAVLLFTLGMGYGVL.VSRL.RSETHIpfddlges...............................tsssadtsPATEY.......VASYDWRYL........VSWG.L...............SGIALGTLLPWFDGVWDR.SFGRN.G.RV-.............................................---LGKTRTAPDTDWALVVRGIGA...FA......GVAFAM....R.........................KLPW...TS....T.........MQA........SLTLALANPFLWYLLDRSKSG.LLLAAAF.GVVGSGA...LMI.....L..NLDWM.PN...PGMHSspyyvgygagv......................ggaygtssfhqNGSSASS..ND..GSGLDA..sAS............................AVT...AETAIWMLSVLFCSSVCFGNIGRRLF.....................................................
A0A0E9NCD8_9ASCO/104-307               ............................................................................................................................................................................................t-RITLIFGLGYGFSAL.FASL.HSHTHD..............................................lPAYLS.......DFATSPYRS........LACG.L...............AAVNFGCLFAAMDYYRSM.DGESR.S.SSEastpgr.................................rgsltlDRFRPKAIAGGKVHWTSIMRCIGA...LM......GMGYAA....S.........................KIQG...-S....V.........VQI........SSLLALFCSIVWFVFDRTQDG.LLLSSVV.AVAGAVY...VNT.....V..APDAF.--...-YA--............................................-------..--..------...TG............................TGL...FASPGWVPASLFSFACTFGIVGRSL-l....................................................
T1EG13_HELRO/8-189                     ............................................................................................................................................................................................t-RAVYLFSAGIIFSLV.LNLL.QLQRQAnf..........................................fpaFFRDR.......DVQSSWWLP........VLCG.V...............TAAVVGLLYPYLDE----.-----.-.---.............................................---QLGERRAEKQEWSSVMRCVAI...FV......GINHAS....A.........................KIDF...SS....N.........LQL........TLTLTALSVGLWWLFDGSRGG.LMLGIIM.AAIASVVc.hLLI.....-..YHGIY.--...-----............................................-------..--..-----R..yTS............................PDF...TYLQSWLPCIFFSGGVTIGNIGRQLA.....................................................
M0TSN1_MUSAM/49-205                    ...........................................................................................................................................................................................is---LTLFGAGFFLGPL.LDGL.HSRVNLm............................................iyQ---Ngav.dvgPLHTNIWVP........PMLG.A...............FYCTVGLLQLLLDE----.-----.-.KTP.............................................SKSKLGVGSVEKTAISLI--TLAA...FI......ELSAEL....Y.........................KAGV...AD....N.........VEA........-YTLFALAEFIWVFLDGTWLG.FALACFV.GVAC---...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------plaeipmiklfhlwnypg...................................
A0A074VKW4_9PEZI/144-376               ...........................................................................................................................................................................................gk--NVVLGLAGIAYGQL.IAHL.HDRKTL..............................................vPVQVE......gMPSESWAYI........AYWC.F...............SGVALGQALPWVDSIWMS.DGSGE.T.EADreyrt..................................sgnlrsAQDTHTRSQNWTPGWNEVVRFIGA...AV......GIVFAI....R.........................RLPW...QS....P.........LQL........SLTLALANPAIWYLLDRTGPC.FILATTV.ALTGTGL...LLS.....I..NPDLI.PS...PHTSNihsf....................................snvaNATANAI..RG..QDLVLG..tFT............................LES...VGVATWIASVLFVSAVAFGNIGRRL-.....................................................
G1M1N9_AILME/37-218                    ............................................................................................................................................................................................i-RGVVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-IAS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...DN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATVVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
H0VRQ7_CAVPO/63-244                    ............................................................................................................................................................................................q-RSLVLFSVGVVLALV.LNLL.QIQRNVtl..........................................fpdE---Vi....atIFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
C9SPY0_VERA1/1-209                     .............................................................................................................................................................................................----------MGYGAL.VTRL.HGKHQLt............................................alP---Adg...tsGPGFNWKYL........TLWG.I...............CGVLLGALLPWFDGVWEE.AFGGD.M.AVVd..........................................geRDETSDNANRSSTDWALGVRSIGA...FV......GIVFAI....R.........................RLPW...AS....T.........LQL........SLTLALVNPFLWYLIDRSKPG.FLLSAAV.GLIGSAV...LTG.....V..DPEMV.PT...PSASS............................................-FRNETV..SD..SLTFGG..lAS............................QKT...METGIWMLSVLFCSCVCFGNIGRRLA.....................................................
A0A0J8CCX4_BETVU/50-211                ..........................................................................................................................................................................................lit---LSLFGSGFFLGPL.IDGL.HSRVNLvny.........................................qsgS---Vh....igPLHTNIWVP........FLLG.L...............FYATIGILQLYLDERA--.-----.-.---.............................................SPNAVPEGSFKKTAISL--ISLVL...FI......ELSAEM....Y.........................KGGV...PA....N.........IEA........Y-ALFAAAEFVWFLADRTWFG.FALACIV.GLACPLA...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------eiplmkffhlwyypqanvhi.................................
W6MRF2_9ASCO/96-305                    ............................................................................................................................................................................................g-KVLVLGVLGILFKEL.TRAL.HANNPLlpdiswfnl.............................vniielslkR---Vgl..aplLHLTDTKLE........YVSGaL...............EGIILGLIQPLFDRLT--.-----.-.---.............................................---GTSAKSGSTIVTTTMIRSATA...LV......GISYGL....K.........................KTEW...TS....P.........LQA........SLAWSCLNPCLWMLLDGTLFG.FLSASTI.SLCSMVC...VGL....sF..GTGYE.--...-----............................................-KLEWEK..LS..MFEFD-...-G............................LDE...TARVFWVGSFFFFGVIFFGKVGRWLF.....................................................
E9D1T2_COCPS/134-362                   ............................................................................................................................................................................................r-RSVLLFLFGMAYGGI.ITHL.HGHPNVag...........................................rvPVNMEh....idLDQRSLGYL........ALWG.V...............AGVALGSLQPWFDLLWGD.DLIVG.R.SQ-.............................................-NAARTAKGNGLLEWSPMVRSIGA...FV......GIAFAI....R.........................KLPW...QS....T.........LQV........SLTLALANPVLWYLIDRSKPG.FVLSTLV.GITGMLA...LLG.....I..NPTIV.PS...PATASlsspla................................atspdtTMNGAPI..PS..TTNIMG...MT............................QES...VAVGTWIASVLFCSCVCFGNIGRRLA.....................................................
F9XFP1_ZYMTI/1-176                     ............................................................................................................................................................................................m----------------.----.------...............................................-----.......---------........----.-...............---VFGEALPLADVFWAP.DEDSI.V.D--.............................................DSEKEQRKARGTGGWQDIVRSIGA...FV......GLAFAI....R.........................KLPW...QS....T.........LQL........SLTLALVNPALWYLIDRSPPG.LILSGLV.SVGGTAI...ILG.....I..NPALV.PS...PSPIEllqghv................................gkrglvNGTVNAL..QD..EGHVLG..iFS............................HET...VGVATWIASVLFVSAVCFGNIGRQLA.....................................................
W7M5V9_GIBM7/153-370                   .............................................................................................................................................................................................LRGLLLFVLGVGYGVL.VTSRfHESDSL...............................................P---S.......RATYNWGHL........TFWG.L...............AGVALGALFPWFDRVWEN.SFSDN.G.DEAv...........................................lENSASAKDDDPSTDWALAVRAIGA...FV......GIVFAI....R.........................KVAW...AS....T.........LQV........SLTLALVNPLLWWLIDRSKPG.FLLSAAV.GLAGSVV...LLG.....V..NPDMM.PA...PTQVPfr.......................................hlvNATMAGD..GD..MPILGG..lAQ............................QKT...LETGMWMLSVLFCSCVCFGNIGRRL-t....................................................
A0A0M9F0K8_9HYPO/154-372               .............................................................................................................................................................................................MRGLLLFVLGVGYGML.VTSR.FNSDSD...............................................-SHAS.......GGTYNWAHL........SFWG.L...............AGVALGALFPWFDRVWED.SFGEK.G.DEA............................................vIENTPAKDDDSGTDWAIAIRAIGA...FV......GIVFAI....R.........................KVAW...AS....T.........LQV........SLTLAMVNPLLWWLIDRSKPG.FFLSTAV.GLAGSMI...LLG.....I..NPDMM.PA...PAHAPfrq......................................lvnATTPSQD..EV..VPILGG..fAH............................QDT...LETGMWMLSVLFCSCVCFGNVGRRL-t....................................................
J3NIF0_GAGT3/205-433                   ............................................................................................................................................................................................a-KVVLLFALGVGYGML.VCRL.QDEHGSgmhhe....................................grqsggS---Ff....paKGSQDSRYV........AFWG.F...............SGVLLGSLLPWFDHFWDR.TFGSD.R.QPApg.........................................haPEGAESDSTRPDTDWALVIRGVGA...FA......GIVFAI....R.........................KLPW...AS....T.........MQV........SLTLALVNPFLWYLIDRSKSG.FTLASAV.GVVGTAV...IAG.....V..DPGMM.PT...PTGYS............................................SGLAHDD..GS..GPSWAEp.lGS............................HAA...VETGIWMLSVLFCSCVCFGNIGRRLA.....................................................
A7THJ0_VANPO/127-283                   ...........................................................................................................................................................................................si--VLVLSLSGIGYHQL.SKNL.HDNHQLhpd.........................................lasK---P......lLVVSKLSKV........LTFG.Lipdw......agyslEGVIFGLLIPLFDYIF--.-----.-.---.............................................------DIKPKPISTSSIIRSVNA...ML......GVTYGI....R.........................KVEW...AS....S.........LQA........SGAWALLNIILWLFFDGTLSM.FWCCAGL.GFATCAA...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------gysnithtsql..........................................
A0A0D2PZ49_GOSRA/48-192                ...........................................................................................................................................................................................is---LSLFGCGFILGPL.IDGL.HSRVDL...............................................VVYQNgai.nigPLHTNKWVP........PLLG.L...............FYTTVGLLQIYLDE----.-----.-.---.............................................----KNSSNVPQGSLEKAVRSLIAlvlFI......ELSSEM....Y.........................KNGV...PD....N.........IEA........YI-LFAAAEVLWYSLDRTRLG.FTLASVI.GIC----...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------cplaeiplm............................................
S9Y788_9CETA/371-552                   ............................................................................................................................................................................................q-RSLVLFSVGVVLALV.LNLL.QVQRNVtl..........................................fpeE---Vi....atIFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---RLGEPHKFKREWASVMRCVAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
F7FRI2_CALJA/1-103                     .............................................................................................................................................................................................----------------.----.------...............................................-----.......---------........----.-...............------------------.-----.-.---.............................................------------------MRCVAV...FV......GINHAS....A.........................KLDF...DN....N.........IQL........SLTLAALSVGLWWTFDRSRSG.FGLGVGI.AFLATVVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
A0A093XIP0_9PEZI/138-357               .............................................................................................................................................................................................LRSTLLFLLGTAYGLL.VTHL.HNEQRL..............................................aPFGAQg....fiQPSYDKKYL........IFWG.V...............AGVAMGSALPWFDGLWEE.YFGEE.V.TSSa...........................................vGGKGANEEDGVAAQWTPVVRSIGA...FF......GIAFAI....R.........................KLAW...TS....T.........LQA........SLTLALVNPFLWYLLDRSKPG.FVLSVTV.GLIGTTG...LLM.....F..DSTMV.QS...PLASQ............................................SSYNSTS..SAhtGTHAQG...GN............................NEL...FESAVWIMSVLFCSVLCFGHIGRRLA.....................................................
Q6FP81_CANGA/141-296                   ...........................................................................................................................................................................................fa--IVVLSISGVAYHQL.SRNL.HDNHLLhedfa....................................srpllwG----.......---VTIQQK........LSCG.Ilpdw......fgyalEGIIFGSIIPLMDHIT--.-----.-.---.............................................----KVKLRPTSYSLSSVIRSINA...ML......GVTFGI....R.........................KIQW...AS....S.........GQA........AGAWGLLNVILWLFFDGTLSM.FSNCSVL.GLLCCA-...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------scfheitdv............................................
Q754M9_ASHGO/91-269                    ...........................................................................................................................................................................................ss--LVILGISGIAYHQL.SRNL.HDNDLLhedf......................................tsrplVLGVK......lCQQLSFGML........PTWA.Gy............avEGILFGSLLPAVDY-W--.-----.-.---.............................................-----RRISVGKVNLSGVLRSINA...ML......GVSFGI....R.........................RVEW...SS....S.........LQA........SGAWFLLDGILWLFFDGSFSV.FLLGFAV.GLVTAVT...CYE.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------eitdfsqllyfidfyflgllffgrlgryly.......................
A0A0G2FXU4_9PEZI/164-281               .............................................................................................................................................................................................LRTAFLFVLGLGYGAI.LSRL.STEQQWa............................................sfP--VEg....iiRHRYNSAYL........ACWG.V...............FGVALGSLLPWFDGKWEQ.TFEKD.K.DEG.............................................EEDFNGEEEEPGTDWALVVRGVGA...FV......GIVFAI....V.........................----...--....-.........---........---------------------.-------.-------...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------srpcdvgtm............................................
Q6BJN8_DEBHA/95-321                    ...........................................................................................................................................................................................kv---VILAGAAYLYNET.TKHI.HNNHIQvskltyeplfitn....................mfltnfvhklkpfsS---Fg.....kTNTYSISWId.....nfLALS.I...............QGLVMGLIHPMMDCVLPT.SMTKR.L.LS-.............................................-SDPNASGSKDAHLFNDLVRALVT...FL......GISYAV....R.........................KIEW...SS....S.........LQV........SMIWSLLNPGLWLLLDGTISG.FLSSLLI.ATLACLS...VYL.....Q..NYDLV.--...-----............................................----LQY..AN..QFLQLG...KD............................DDF...IAIWLYVGSFFFCGLIIFGKLGRGLF.....................................................
G0WCX0_NAUDC/89-255                    ............................................................................................................................................................................................f-KFLILSTCGIIINEI.FNYL.NESTLY...............................................-----.......---EGFNYLq......wIPYS.L...............QGISFGIIIPILDSLLFE.D----.-.---.............................................-------IDENGCSFKSIIGTFNI...IL......GIAYGI....R.........................TISW...ES....K.........MQM........SIAWCLLNFILWLFLDNGTLStILLWISS.SLFGITI...RYV.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------tgiyvypnggdrlyfmnslcanilifgklgrylf...................
I3JF34_ORENI/85-266                    ............................................................................................................................................................................................r-RGVVLFTVGVFLALV.LNLL.QIQRNVtl..........................................fpeEV--Mt.....tLFSSAWWIP........PCCG.T...............GAAVIGLLYPCLDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....V.........................KLDF...DN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.FGLGITT.AFLATVIt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFSGGVTVGNIGRQLA.....................................................
B8N9S0_ASPFN/130-349                   .............................................................................................................................................................................................LKAALLFSFGIVYGII.TIHL.HENHWI..............................................tPVKLEn.....tHYYGSWEYL........GFWG.V...............AGVVLGNVLPGLDLFSED.VTVDY.A.KQP............................................sRSSNDEENEERTLSWVAAVRSVGA...FV......GVAFAM....R.........................RTPW...QS....T.........TQA........SATLALANPVLWYLIDRTRTG.FFMSTIV.GVGGMGI...VLA.....L..RPDLV.P-...PSTGAsa........................................saIPALNST..LR..DLGFGT..gIT............................QES...LAVRTWVASVLFSACVCFGNIGRQLA.....................................................
G8BVA6_TETPH/118-296                   .........................................................................................................................................................................................fvls----MLSLSGICYHDL.SRNL.HDKHLLhpdl......................................aarplLVLTE......fTKYISLGLVp.....dwACFS.L...............EGIIFGLLIPFLYTIL--.-----.-.---.............................................------NVSPRAPSNSSVIRSINA...ML......GVIFGI....R.........................RVEW...SS....S.........LQA........SGAWALLNVIMWLFFDGTLSM.LLPCSGL.GIISCII...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------gyqniedvsqalffmdfyflgfmlfgkigiyll....................
E0CXF1_MOUSE/30-146                    ............................................................................................................................................................................................i-RGVVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-ITS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...DN....N.........FQF........SLTLAALSVGLWW--------.-------.-------...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------.....................................................
F7HBW4_MACMU/30-211                    ............................................................................................................................................................................................i-RGVVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-IAS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...DN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATLVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
Q0CLJ8_ASPTN/128-344                   .............................................................................................................................................................................................LKSALLFGFGVVYGII.TIHL.HENHWI..............................................tPVKLEn.....tHFYGSLEYL........GLWG.I...............AGVALGNVLPWLDTFSED.GGVDD.S.K--.............................................ASRNEEETEERTRSWVAAVRSVGA...FV......GVAFAM....R.........................RTPW...AS....T.........TQA........SATLALTNPVLWYLIDRTITG.FVMSTVV.GVAGMGI...LLK.....L..WPELV.--...PASANgt.......................................pavPPLLNGT..LW..DYGLAT..gFT............................QES...IAVRTFVASVLFSACVCFGNIGRQLA.....................................................
G3SRK7_LOXAF/30-211                    ............................................................................................................................................................................................i-RGVVLFLIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-ITS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...DN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATMVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
Q8AV60_DANRE/26-207                    ............................................................................................................................................................................................i-RAAMLFTVGVFLALV.LNLL.QVQRNVtlf.........................................ppdV-ISS.......IFSSAWWVP........PCCG.T...............AAALIGLLYPCMDR----.-----.-.---.............................................---RLGEPHKLKREWSNVMRCVAV...FV......GINHAS....A.........................KVDF...AN....N.........VQL........SLTLAALSVGLWWTFDRSRSG.FGLGVII.AILATLAt.qLLV.....Y..NGVFQ.--...-----............................................-------..--..-----Y...TS............................PDF...LYIRSWLPCIFFAGVITVGNIGRQLA.....................................................
A0A086SXH7_ACRCH/153-392               ............................................................................................................................................................................................a-RGGVLFGLGVGYGIIlLTRF.RDSSQWp............................................tvPFREGl.....vQTGYGWGTL........ILYG.V...............AGVILGTAMPWADGVWGD.ALGDE.E.EEDvdv.......................................tivSDPNAVESPGHTTDGVLVMRAIGA...FV......GIVFAI....R.........................KLAW...AS....T.........LQI........SITLALVNPLLWWLIDRSKVG.FILSAAA.SLVGSIF...LLG.....I..KPDMM.PA...PPVHLtllgsgs.............................svdfsesvGGNFTEE..AA..RFPLAA..iAS............................QET...VEMGVWTLSVLFCTCLCFGNIGRRLA.....................................................
B9I9F8_POPTR/49-210                    ...........................................................................................................................................................................................is---LSLFGSGFFLGPL.IDGL.HSRVNL...............................................VVYQNgsi.digPLHTNIWVP........PLLG.L...............FYCSVGLLQLFLDQR---.-----.-.---.............................................APSKVPEGSPEKTAIA--LVALLL...FI......ELSAEM....Y.........................RAGI...AD....N.........IEA........YILFALAE-LIWFYLDRTWIG.FTLASII.GLCCP--...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------laeipimklfhlwyypqanieilg.............................
B6JWJ4_SCHJY/118-301                   ...........................................................................................................................................................................................lg--VIIVMFLGWSFTYL.AEKL.LLEARLp............................................glRFTVH.......SQQYKPHWS........LLFG.F...............AAILVGFSFPYADR----.-----.-.---.............................................LSHNGHRLVARPFEWNLIVRSIMA...LS......FVLIGL....K.........................RCLG...TD....V.........KQT........AIGFAVNALSVWFIFDHTKTG.FVMSSFF.SSLGTFL...YTA.....F.vEVNLS.--...-----............................................-------..--..----QG..eSI............................HIS...KSLRYWLPSIIFFACTVIGNVGRL--vf...................................................
F2PW23_TRIEC/175-387                   ..........................................................................................................................................................................................qqs---GLLFLFGVTFGVI.IMHL.HDSPQMaall.......................................plhiPVRVEi....inFGLEWWHYL........VFWG.V...............AGVALGNLLPWFDLMWED.FMGEN.-.---.............................................-----PVKGSSEAGWNPMVRSIGA...FV......GVAFAI....R.........................KLPW...QS....S.........TQV........CLTLALVNPFLWYLIDRSKSG.FVLSTAI.GLTGMMA...LLE.....M..NPDII.FS...PSNAA............................................DA-VDET..VF..GIAGLT...LS............................QSQ...LAVGTWIASVLFCSCVCFGNIGRKLA.....................................................
H2M3Q1_ORYLA/60-241                    ............................................................................................................................................................................................r-RGLVLFTVGVFLALV.LNLL.QIQRNVtl..........................................fpeEV--Mt.....tLFSSAWWIP........PCCG.T...............GAAVIGLLYPCLDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....V.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.FGLGITT.AFLATVIt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFSGGVTVGNIGRQLA.....................................................
H2P7D4_PONAB/30-204                    ............................................................................................................................................................................................i-RGVVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-IAS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...DN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATVVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGP-----------lttq.................................................
H2PP51_PONAB/86-267                    ............................................................................................................................................................................................q-RSLVLFSVGVVLALV.LNLL.QIQRNVtl..........................................fpeE---Vi....atIFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
I3MG28_ICTTR/30-211                    ............................................................................................................................................................................................i-RGIVLFLIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-IAS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...DN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATVVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
S7ZEQ1_PENO1/139-351                   ...........................................................................................................................................................................................ls--SALLFGFGLVYGVI.TVHL.HDNHWI..............................................tPVKLEn.....tHYYDSWQYL........GFWG.L...............AGIVLGNTLPWLDRWRES.DVAED.-.---.............................................-DAKEEDDVNRTPSWVAVARSVGA...FV......GIAFAM....R.........................RLPW...ES....T.........TQA........SLTLALANPVLWYLIDRTTTG.FVLSTTV.GVAGMSL...VLG.....M..KPEMI.PA...STGSTf..........................................gTTLLNGT..GL..ENTLGA..eVS............................QES...IAVRTWVASVLFCACVCFGNIGRQLA.....................................................
K2RQH4_MACPH/253-497                   ............................................................................................................................................................................................a-RVLALFGFGVVYGVM.ISHL.HDNRHI..............................................aPVRVE......gIDRGHWGYL........VFWG.L...............AGVAVGSALPWVDLFWER.ESATA.A.GAKskngrr.................................vkgqvpGTVGSRSRDSVGQDWNDVVRSVGA...FV......GIAFAI....R.........................KLPW...QS....T.........LQV........SLTLALVNPALWYLLDRSKPG.FTLSMLV.GLTGTAI...MLLlg.qhA.dSVAFI.PS...PPIVGgsgpsss..............................vrlgggpGRFGAGN..GT..GGGA--...-Ng.........................dyEST...VGVATWFASVLFCSCVCFGNIGRKLA.....................................................
H2QIL8_PANTR/30-211                    ............................................................................................................................................................................................i-RGVVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-IAS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...DN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATVVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
E7KTG1_YEASL/114-274                   ...........................................................................................................................................................................................qa--VLILSLSGFAYHEL.SRNL.HDNHLLhpd........................................fasrP---Ll....lgVKLCNWLSNgvl..pnwLGYG.V...............EGLLFGSVVPILDNIFQT.E----.-.---.............................................----VVKSSVHHDSLTSVIRSINA...ML......GVTFGI....R.........................KIQW...NS....S.........LQA........AGAWGLLNIILWLFFDGSISM.LMSCICI.GVGC---...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------ciscykdiidgsq........................................
W3WSL5_9PEZI/171-346                   .............................................................................................................................................................................................LRSLLLFGLGILYGLM.IVSF.QDRHRLg............................................rlQ--MDdi...gkSTASHVQFI........AFWG.V...............AGIALGALLPWFDGVWES.VFGQE.D.DFEsa........................................tehAISSEEEEASQATDWGLAIRGIGA...FV......GIVYAI....R.........................KTQW...AS....T.........LQV........SLSLALVNPFLWYLIDRSKPG.FLLSSTV.GLVGSAI...L--.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------pselliewggpahya......................................
W6VD28_ECHGR/5-177                     .............................................................................................................................................................................................FRGFILFVIGVLFYYI.FGLI.QGFRSG...............................................IFNDKfs...qcLLSTSFGIP........LCCG.L...............LSVACGLTSPRLYH----.-----.-.---.............................................---NLKIPNAYEPEWSSIMRCVIF...FM......GISHAS....A.........................KLDI...IS....I.........SQL........LLTSFCFAIGIWWIFDRSVSG.ILTGFLM.SLLGTGI...CLV.....L..GDQTI.--...-----............................................-------..--..------...-R............................SID...PLLTSWLPCIFFSGGITTS-------lva..................................................
A0A0B4HAW1_9HYPO/164-380               .............................................................................................................................................................................................LRGTLLFVLGLGYGAL.VTRL.HNEQNQl............................................ppM-PDDs....ilKPGNNWKYL........TFWG.V...............AGIGLGSLLPWFDKLWED.TFGNE.G.DD-.............................................--NVVDKGANPGTDWALVMRAIGA...FV......GIIFAI....R.........................KLAW...VS....T.........LQV........SATLALVNPLLWWLIDRSKPG.FVLSAAV.GLTGSIL...LLG.....V..DPEIM.PA...PSGLPt..........................................rNSSNPFN..SD..PLALGG..lAT............................QET...VETGVWMLSVLFCSCLCFGNIGRRL-t....................................................
G1N049_MELGA/1-131                     ............................................................................................................................................................................................a----------------.----.------...............................................-----.......---------........----.-...............--AVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFVATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
A0A096NRW2_PAPAN/86-267                ............................................................................................................................................................................................q-RSLVLFSVGVVLALV.LNLL.QIQRNVtl..........................................fpeE---Vi....atIFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
G3WIX0_SARHA/86-267                    ............................................................................................................................................................................................q-RSVVLFAVGVFLALV.LNLL.QIQRNVtl..........................................fpeE---Vi....atIFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
A0A094GF57_9PEZI/139-362               .............................................................................................................................................................................................LRSTLLFLLGTAYGLL.VTHL.HNEQRL..............................................aPFGAQg....liQPSYDKKYL........LFWG.V...............AGVAMGSALPWFDGMWEE.YFGEE.V.KSSai........................................ggkVVDGANEEEGVAAQWTPVVRSIGA...FF......GIAFAI....R.........................KLAW...TS....T.........LQA........SLTLALVNPFLWYLLDRSKPG.FVLSVTV.GLIGTTG...LLM.....F..DSSMV.QS...PLAAHs.........................................syNSTTGST..HT..GFYAQG...EN............................NEL...FESAVWVMSVLFCSVLCFGHIGRRLA.....................................................
K1S6Q0_CRAGI/5-191                     .............................................................................................................................................................................................LRGTVLFMIGNFFAVF.MNLL.QINRQGnvsl.......................................kmppE---Ll....enLFLKEWWVP........PMCG.A...............AAVLIGLLYPCLDR----.-----.-.---.............................................-HLSISNPDSHKGEWSKVMRCIAV...FV......GINHAS....A.........................KLDF...VN....N.........MQL........SMTLAAMSIGLWWLFDRSPCG.FGLGVGI.AVLATLVt.qLLV.....-..YNGVY.--...-----............................................-------..--..-----N..ySK............................AEF...LFVRSWLPCIFFSGGVTMGNIGRQLA.....................................................
A0A0D9MNU9_9EURO/138-352               ............................................................................................................................................................................................l-SSVLLFGFGLAYGVI.TVHL.HDNYWI..............................................tPVKLEs.....iHYYDSWQYL........GFWG.L...............AGIALGNLLPWLDS-WRE.G--ES.D.SKL.............................................AGANEEDSEDRTPSWVTVARSVGA...FV......GIAFAM....R.........................RLPW...ES....T.........TQA........SLTLALANPVLWYLIDRTTTG.FVLSTTV.GLAGMGV...VLG.....L..KPELV.PA...--STGps........................................lgASLLNGT..GL..ENVLGA..gIT............................QES...IAVRTWVASVIFCASVCFGNVGRQLA.....................................................
INSI1_DANRE/60-241                     ............................................................................................................................................................................................r-RGLVLFIVGVVLALV.LNLL.QIQRNVtl..........................................fpeEVLDT.......LFSSAWWIP........LCCG.T...............AAAVVGLLYPCLDH----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.FGLGLTT.ALLATLIa.qLLV.....Y..N-GIY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFSGGVTVGNIGRQLA.....................................................
E3RCG2_PYRTT/189-420                   ............................................................................................................................................................................................g-KLAALYAFGVIYGII.VSHL.HETRQL..............................................aPVHVD......gVGRESRAYL........ASWG.L...............FGVALGSLLPYVDLVWDA.QKRTS.Q.TD-.............................................EKEAETHDSPISEQINDIVRSVAA...FL......GIAFAI....R.........................RLPW...QS....T.........LQL........TLTLALVNPALWYILDRSKPG.LSVSLTVtSILTSFI...FLS.....-..NPNVL.PS...PSLPPttnatqvps..........................isdstqtqgKPSTAAP..VG..QEFFAG..mIS............................YES...LAVVTWVGSVLFCSCVCFGSIGRRLA.....................................................
F6Y9H0_CALJA/86-267                    ............................................................................................................................................................................................q-RSLVLFSVGVVLALV.LNLL.QIQRNVtl..........................................fpeE---Vi....atIFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
H0ZMV3_TAEGU/1-131                     ............................................................................................................................................................................................t----------------.----.------...............................................-----.......---------........----.-...............--AVIGLLYPCMDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...AN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATLVs.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
U4L8L6_PYROM/242-271                   ......................................................................................................................................................................................aaghqme----------------.----.------...............................................-----.......---------........----.-...............------------------.-----.-.---.............................................------------------------...--......------....-.........................----...--....-.........---........---------------------.-------.-------...---.....-..-----.--...-----............................................-------..--..------...--............................---...---TVYVASVLFCSCVTFGNVGRRLA.....................................................
A0A074WRP6_9PEZI/148-383               ............................................................................................................................................................................................g-KTFVLGAAGVAYGQL.IARL.HDQQSI..............................................vPVQVE......gMPADSWAYI........AYWC.F...............SGVALGLALPWVDSIWMS.DGSGE.S.EAEreyrtsg...............................sgssrrsGTDTHSRSQSWTPGWNEVVRFIGA...AV......GIVFAI....R.........................RLPW...QS....P.........LQL........SLTLALANPAIWYLLDRTGPC.FILATTV.ALTGTGL...LLS.....I..NPDLI.PS...PHPANiqsf....................................snvaNATVNAG..RG..HDLVLG..aFT............................LES...VGVATWIASVLFVSAVAFGNIGRRL-.....................................................
INSI2_CHICK/51-153                     ..........................................................................................................................................................................................avc----------------.----.------...............................................-----.......---------........----.-...............------------------.-----.-.---.............................................---------------------SGL...CQ......GINHAS....A.........................KVDF...AN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATLVs.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...IYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
V3ZPY9_LOTGI/9-190                     .............................................................................................................................................................................................LRGTVLFTVGVFFALV.LNLL.QVQRHVtv..........................................fppEVLAS.......IFSSAWWIP........PSCG.T...............AAAVIGLLYPCLDT----.-----.-.---.............................................---KLGETQYYKREWSSVMRCVAV...FV......GINHAS....A.........................KIDF...AN....N.........MQL........SVTLAAMSIGLWWLFDRSRSG.FGLGVGI.AVLATFVt.qLLV.....-..YHGVY.--...-----............................................-------..--..-----R..yTE............................PDF...LFVRSWLPCIFFSGGVTMGNIGRQLA.....................................................
G3RIH5_GORGO/30-211                    ............................................................................................................................................................................................i-RGVVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-IAS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...DN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATVVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
M2XIY7_DOTSN/162-387                   ............................................................................................................................................................................................g-RVLALFGVGLLYGLL.ISHL.HDQQKI..............................................aPVAVN.......LDRSRWSYL........ATWG.C...............IGVLLGEALPWIDSLWAE.DDKHA.V.DDA.............................................DNERTEKHARGMDAWMDVVRLVGA...FV......GIAFAI....R.........................KLPW...QS....T.........LQL........SLTLALANPAVWYLIDRSPPG.FIMSSLV.AISGTAL...LLG.....I..SPTLV.PS...PSPWQvlkggv................................atqgifNDTFDAL..KS..EELVLG..iFS............................QES...VSVATWIASVLFVSSVCFGNIGRRLA.....................................................
INSI1_BOVIN/85-266                     ............................................................................................................................................................................................q-RSLVLFSVGVVLALV.LNLL.QVQRNVtl..........................................fpdE---Vi....atIFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCVAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
A7EKY6_SCLS1/112-339                   .............................................................................................................................................................................................FRSILLFGLGVLYGLL.VKHL.HDDRHL..............................................aPLQVEs....iiKPSHDWRYL........VFWG.I...............AGVGLGSLLPLVDKLWEE.KIRSP.Q.GTStst......................................sseeAIDVSDSQSILGEDWILAVRSVGA...FV......GIAFAI....R.........................KLPW...AS....D.........MQA........SLTLALVNPVLWYIIDRSKPG.LVFSAAI.GATGSAI...LLA.....S..NSDLM.PS...PAAAVkn.......................................stvSHHPIDY..SE..AGSENS...MA............................RGN...LEAGIWISSVLFCSCVCFGNIGRRLA.....................................................
A0A0G4EKP3_9ALVE/1-186                 ...........................................................................................................................................................masagallgslsdalchgryevlhytpadlsffg----------------.----.------...............................................-----.......-LSSARWVP........PLFA.L...............AGVIIGTGLPLLDRWLFK.-----.-.---.............................................---TPAAQRTRSAVVGNVLLGIVW...FA......AVYLVS....G.........................VLSYygvDS....A.........VEA........ALLTPLA-ALSWAVFEATPAG.LVMSFAT.AAGGPLI...EVG.....LvnWTDLY.--...-----............................................-------..--..-----A..ySR............................PDV...LGVPVWLPLVYFCGGPAVGNLGRAV-a....................................................
I1GEV3_AMPQE/3-153                     ......................................................................................................................................................................................ldllqve----------------.----.------...............................................-----.......AKFSTLWLV........PVSG.L...............AAACIGLLYPYVTS----.-----.-.---.............................................----NSMDDSDPPDGAMIIRCIAV...FV......GVYQAS....T.........................KIYF...SS....Y.........FEL........FMTLIALAVGMWWLFDRSKSG.LTFCLLL.AFILASV..tQFL.....Y..KYKYT.--...-----............................................-------..--..-RHL--...VG............................SEF...LYPRAW--AIYFTVCVLFGTIGRW--vq...................................................
E7NIN1_YEASO/102-272                   ..........................................................................................................................................................................................aaf---FILFIAGILFPMI.SECL.FDNDQLakgdiv..................................sflkhgiEIKNK.......IVAEPDMVPd......wAVFG.T...............EGVIFGSIVPFIESFVRY.-----.-.---.............................................QHQPKTRSSVYKNTLGSFIRCANT...LL......GLIFGI....R.........................KLEW...SS....S.........LQA........AGAWSLLNIVLWLFFDGTLTV.FFPGLVI.GALSAFT...C--.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------sqcfsqlslalyfi.......................................
G1X7W0_ARTOA/158-375                   ...........................................................................................................................................................................................il---IVLFSAGASYGFI.ISQL.HDQSHI..............................................aPVKVQ.......VERDTVGYL........VSWG.I...............AAVVLGSLLPWVDGIWED.YVWES.G.SDEd...........................................dGKSGGEERGEVTPGWNPAVRSIGA...FV......GVAYAI....R.........................KLPW...QS....T.........SQA........TLTLASANPVLWYILDRTRTG.FWLSTIV.AVFGSMF...LIG.....F..NPDFV.AI...PSDDGv.........................................giIEKLRNL..AV..TGHGGA..eLQ............................MKF...WGATTWIASVLYVSCLCFGNLGRR--vw...................................................
G1Q6D1_MYOLU/1-103                     .............................................................................................................................................................................................----------------.----.------...............................................-----.......---------........----.-...............------------------.-----.-.---.............................................------------------MRCVAV...FV......GINHAS....A.........................KVDF...DN....N.........VQL........SLTLAALSIGLWWTFDRSRTG.FGLGVGI.AFLATLVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
G1K3H0_XENTR/25-206                    .............................................................................................................................................................................................LRGLLLFLIGVFLALV.LNLL.QVQRNVtl..........................................fppDVLSS.......LFSSAWWVP........LCCG.T...............AAAAIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...AN....N.........TQL........SLTLAALSIGLWWTFDRSRSG.LGLGIGI.SFFATVVs.qLLV.....Y..-NGVY.--...-----............................................-------..--..-----E..yTA............................PDF...LYVRSWLPCIFFAGGITMGNIGRQL-e....................................................
A0A0N1P4K9_9EURO/136-255               ............................................................................................................................................................................................l-QTVLLFAFGAGFGAI.VTHL.HQTQQI..............................................tPVPVP......gTEKITGYYH........FSWG.L...............FGILVGNGLPLVDKWLSE.EILES.E.HKPsgh......................................krtvSSSSDDDRETLGPMWYSAVRSVGA...FV......GIAFAV....E.........................----...--....-.........---........---------------------.-------.-------...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------talvid...............................................
W5P9G9_SHEEP/85-266                    ............................................................................................................................................................................................q-RSLVLFSVGVVLALV.LNLL.QVQRNVtl..........................................fpdE---Vi....atIFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCVAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
Q4WP15_ASPFU/121-340                   .............................................................................................................................................................................................FRSVLLFGFGVAYGVI.TVHL.HENHWI..............................................tPVKLEn.....iRYYDSWQYL........GLWG.L...............AGVALGNVLPWLDSFAGE.WNTDRsQ.TVK.............................................GQENNRLREDRTPAWVIVARSVGA...FV......GIAFAL....R.........................RLPW...ES....T.........TQA........SATLALVNPVLWYLIDRTKAG.FLLSTVV.GLAGTGV...VLG.....L..KPELV.PA...SADTPat........................................tiP-LLNGT..VL..EYGLPT..gLT............................QEG...VSVRIWLASVLFCACVCFGNVGRQLA.....................................................
I2JZM2_DEKBR/88-382                    niynnlseglhrstshhieerkskhhkkqnssftlslslviakvitcslllsixgnlmfyfgeqlykanpilpdisxyrflyifqdllrknekfsdleitllgngaesvivgfasfilgkaidlfvsgqnadlhskhgklnklkehdsksssgqgistnnedyeenssdesesfslgfqiqhyltlvfd----------------.----.------...............................................-----.......---------........----.-...............------------------.-----.-.---.............................................---------------SXLVRSMVA...AV......GLAYCF....K.........................KYQW...SS....K.........IQV........VSLWSAANIIIWRGTDANITG.LISSTII.AFSVMAF...NAY.....Y..DDGIT.--...-----............................................-------..--..----FS..lED............................TDS...IADILWVGSFVFIGQIIFSKIIR---lvf..................................................
V8PFD5_OPHHA/30-214                    .............................................................................................................................................................................................LRGIVLFLIGVFLALI.LNLL.QIQRNVtlf.........................................ppdV-ISS.......IFSSAWWVP........LGCG.T...............ASAVIGLLYPCMDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....As......................kqKVDF...AN....N.........FQL........SLTLAALSVGLWWTFDRSRNG.FGLGIGI.AFLATLVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
A0A094JI00_9PEZI/139-362               .............................................................................................................................................................................................LRSALLFLLGTAYGLL.VTHL.HNEQRL..............................................aPFGTQg....fiQPSYDKKYL........LFWG.V...............AGVAMGSALPWFDGMWEE.YFGEE.V.TNSvi........................................ggkVIDGANEEEGVAAQWTPVVRSIGA...FF......GIAFAI....R.........................KLAW...TS....T.........LQA........SLTLALVNPFLWYLLDRSKPG.FVLSVTV.GLIGTTG...LLM.....F..DSSMV.QS...PLAAPs.........................................syNSTSGSA..HT..GFHAQG...GN............................NEL...FESAVWIMSVLFCSVLCFGHIGRRLA.....................................................
A0A0G2I241_9EURO/152-388               .............................................................................................................................................................................................LRSALLFIFGVAYGTI.ITHL.HDNPRV..............................................tPIKIEni...dvIRRGSWVYM........LFWG.V...............AGVALGGLLPWFDVVWEE.LVGDG.N.GKEdrdgsgsgdvev.....................nrgrngklnghgDLQSNGTTGTLAADWNQVVRSIGA...FV......GIAFAI....R.........................KLPW...QS....T.........LQV........SLTLALVNPFLWYLIDRSKPG.FMLSTAV.GLLGMVT...LLG.....I..NPDVV.PA...PNVES............................................I--NSGN..--..GEGMLF...AS............................QES...IAVGTWIASVLFCSCVCFGNIGRRLA.....................................................
J7RPV3_KAZNA/65-217                    ...........................................................................................................................................................................................ia--VTLLFWTGVLFAKL.SAEL.YDNRSLkkwml.....................................sytldH---Is....kwVNTYVVSVPa......fAVYG.V...............LGVLCGVSVPLLDEYV--.-----.-.---.............................................----FQHRLDDGVDFKSVLKCLNA...LL......GVCFGI....R.........................TIQW...SS....S.........MQG........AGAWCLLNVLLWVFFDGTWSI.LTMGTAV.VLVSVV-...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------mgrgass..............................................
C5GFU1_AJEDR/171-427                   .............................................................................................................................................................................................LRSALLFIFGVAYGII.ITHL.HDNPRV..............................................tPIKIEni...dlIRRGSWVYM........VFWG.G...............AGVALGGLLPWFDVVWEE.FVGGD.G.EGEedgagvgekmdggggnvevs....nrdltgsgsgsgdgkvnvkvnGGQQLKSSQSIAADWNQVVRSIGA...FV......GIAFAI....R.........................KLPW...QS....T.........LQV........SLTLALVNPFLWYLIDRSKPG.FMLSTAV.GLLGMVT...WLG.....V..NPDVV.PA...PTANV............................................GEANAIA..GS..G-GMLL...AS............................QES...IAVGTWIASVLFCSCVCFGNIGRRLA.....................................................
A0A087YBH4_POEFO/84-265                ............................................................................................................................................................................................r-RGLVLFTVGAFLALV.LNLL.QIQRNVtl..........................................fpeEV--Mt.....tLLSSAWWIP........PCCG.T...............GAAVIGLLYPCLDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....V.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.FGLGITT.AFLATVIt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFSGGVTVGNIGRQLA.....................................................
A5DMZ1_PICGU/85-306                    ............................................................................................................................................................................................a-KIATLAVAAFFYNSL.TTHI.HNQHIEtlsgfkpllvt........................nkvlsnlvsslkP---Ssl..lscSVPKSVDAV........VSLT.A...............EGMVMGLMHPVMDRVLPA.YLTKR.L.L--.............................................TSNPDGRRTAPAALFHDLMRSVVT...FL......GISYAV....R.........................NVEW...SS....S.........LQV........SIIWSLLNPGLWLLLDGTISG.FISSVAV.AALACLG...VYV.....Q..SYDAI.--...-----............................................-------..--..HSFLNSv.lLN............................QED..fYAIWLWTGSFFFCGLILFGKLGRALF.....................................................
N1JAD4_BLUG1/99-330                    .............................................................................................................................................................................................LRILFLFGIGVGYGLI.IQHI.HNETHS..............................................kPLQ-Agc...liQSGTNWKYL........TFWG.I...............SSLGLGSLLPLVDRVFFE.NGSAP.L.KTIhgqd.....................................fkqnEYTKNETKSVLDQGWTPIVRSIGT...FF......GIAFAI....R.........................KSPW...SS....T.........LQA........SIALFLADPILWYLIDRSRPG.LLLSLAV.GAIGTAL...YII.....S..NSVIMlPS..vPSNIA............................................RADDMIQ..NY..TTIIPG..kLTig.......................wdmKDS...LDTAIWVLSVLFCSCICFGNIGRRLA.....................................................
F7CFM3_ORNAN/82-263                    ............................................................................................................................................................................................q-RSVVLFAVGVFLALV.LNLL.QIQRNVtl..........................................fpeE---Vi....atIFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
A0A093ZF88_9PEZI/51-274                .............................................................................................................................................................................................LRSTLLFLFGTAYGLL.VTHL.HNEQRL..............................................aPFGSQg....fiQPSYDKKYL........IFWG.V...............AGVAMGSALPWFDGMWEE.YFGEE.I.TSSai........................................sgkVIDGANEEEGVAAQWTPVVRSIGA...FV......GIAFAI....R.........................KLAW...TS....T.........LQA........SLTLALVNPFLWYLLDRSKPG.FVLSVTV.GLIGTTG...LLM.....F..DSSMV.QS...PLSAQ............................................SSYNDTS..GS.vPAGLHAq.sDN............................TEL...FESAVWIMSVLFCSVLCFGHIGRRLA.....................................................
I2GXU3_TETBL/90-273                    .............................................................................................................................................................................................LKLLILSIFGILYHEL.SIQL.YDNHDLksglts..................................kplnlgvTL---.......AQSLTLGIIp.....kwVSYG.F...............EGIFFGLLIPCIDTLFHI.K----.-.---.............................................-------IKKHTYSNTSILKSCNV...LL......GVTYGI....R.........................KLEW...SS....S.........LQA........SGAWALLNIILWLFFDGTISM.FLSCGVI.GICCSTV...CWIl..mdW..KS---.--...-----............................................-------..--..------...--............................--E...FGQLLYFVDFYFLGLLLFGQLGRY--lf...................................................
C5FWQ9_ARTOC/151-355                   ..........................................................................................................................................................................................ses---GLLFLFGVTYGVI.IMHL.HDSPQMaall.......................................plhiPVRVEv....inFGLVWWHYL........VFWG.V...............AGVALGNLLPWFDVMWED.FMGEK.P.---.............................................------VKKTSEAGWNPMVRSIGA...FV......GVAFAI....-.........................----...--....-.........--V........SLTLALVNPFLWYLVDRSKSG.FVLSTVI.GLTGMMA...LLE.....M..NPGIV.FS...PDNTS............................................GTMDDTV..FK..SSIAGL..nVS............................QGE...LAVGTWIASVLFCSCVCFGNIGRKLA.....................................................
S3CIG7_OPHP1/204-448                   .............................................................................................................................................................................................VRAALLFTLGMGYGVL.MARL.RSETHAnfedfamh..............................tppsstaapTTR-Ae.....yDASYDWRYL........VSWG.L...............SGVVLGTLLPWFDGVWDR.AFAGS.D.NI-.............................................--LGLKARTAPEVDWALVVRGIGA...FA......GVVFAM....R.........................KLPW...AS....T.........MQA........SVTLALVNPFLWYLLDRSRSG.LLLAAAV.GFIGSTV...LMT.....L..DLDLM.PN...PGVRTasdqvgys...........................mgssrhqngSSRAPAG..AT..STDGPD..pAS............................GVT...AETAVWMLSVLFCSCICFGNIGRRLA.....................................................
A0A0L9SQF0_9HYPO/146-374               ............................................................................................................................................................................................a-RVVLLFLLGSGYGVL.VTRL.HGDERYr.............................................tH--LTeg...fvKPGLSCNYL........ACWG.A...............FGAILGSLLPWFDKLWDD.TLAAE.T.DA-.............................................-DEIPAESLGPGTDWALVMRAIGA...FA......GIVFAIqwiqR.........................KLSW...VS....T.........LQI........SATLALANPLLWWLIDRSKVG.LLLSAGV.GVAGSVV...LLS.....V..NPSMM.PA...PSRALphala..................................grnmsASSMVHG..MP..SAVLGG..lAS............................RET...VETGIWMLSVLFNSCVCFGNIGRRLA.....................................................
Q5AEY0_CANAL/115-333                   ............................................................................................................................................................................................l-KIVVLTLASFIYNEV.TSQI.NFNHTQsnyp......................................ltikhLFKIS.......SYIHLDEYL........AFVG.QskyghlvdetfalmiQGLVMASFHPILDYYLPK.SLTKR.L.LS-.............................................SNPNPSSSTSYSTLINDLIRSSVA...FL......GVSYAI....R.........................NIEW...SS....F.........LQV........AIIYSLVSPGLWLLLDGTISG.LIGSLVV.SIAACSV...VYY.....Q..NYQYL.--...-----............................................-------..--..-NGVGD..aSP............................VEL...VAIWLWIGSFVFGGLIVFGKLGRFL-f....................................................
G3H5D0_CRIGR/30-211                    ............................................................................................................................................................................................i-RGVVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdMV-TS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...DN....N.........FQF........SLTLAALSVGLWWTFDRSRSG.FGLGVGI.AFLATVVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
A7S1I3_NEMVE/14-195                    .............................................................................................................................................................................................VRGVVLFLIGGFLAMM.LFVL.SVLPEAqkrrw.....................................gsfpmEILAK.......VYSTFWWIP........PSCG.T...............LAAFVGLICPCLDT----.-----.-.---.............................................---KLGKPHNFQREWSSVARCVTM...FV......GISHAI....A.........................KLNF...HS....S.........HQL........FLFVACTSFLLWWLFDRSQNG.FSVAVLS.ALAAAIV...VYM.....L.aYLGVY.--...-----............................................-------..--..------...--............................-RY...RRIIAVVPGLFFAGAVTFSNIGRQLA.....................................................
G4N7B0_MAGO7/200-434                   ............................................................................................................................................................................................a-KAVLLFVLGACYGMV.VYRL.RDEHMSaslq.......................................qhqqR---HansffpaKGSYDKIYI........AFWG.A...............SGVLLGSLLPWFDQFCDR.TLGAK.T.NSGc..........................................smSTEEVKDVPTLDTDWALVIRGVGC...FA......GIAFAI....R.........................KLPW...DS....T.........MQV........SLTLALVNPFLWYLIDRSKSG.FMLASAV.GVIGATV...IAG.....L..DPDMM.PT...PMLYDtag.....................................mplpRGSDQGR..AA..QLALGG..lAR............................RAT...LEAAIWMLSVLFCSCVCFGNIGRRLA.....................................................
Q2H703_CHAGB/197-477                   .............................................................................................................................................................................................LRAILLFVLGVGYGVL.VTRL.PQNSHNqhh........................................pthrL---Aa....ayESHYEWRYL........VFWG.A...............VGVALGSLLPWFDRFWEE.TVARS.S.RHNnntintnhppekq...................tpaptddetetnpNPDATTADTPPPADWALVVRGIGA...FV......GIVFAI....R.........................KLPW...AS....T.........MQV........SLTLALANPFLWYLIDRSKPG.FLLSTAV.GLAGSAV...LMR.....L.gGPGVM.PA...PISASsvellrglgtavlgggn..........gsaaaaaggldaaageaGGYAAAA..AA..AGAFGG..lAS............................QET...IETSLWMLSVLFCSCVCFGNIGRRLA.....................................................
Q5AEJ5_CANAL/116-334                   ............................................................................................................................................................................................l-KIVVLTLASFIYNEV.TSQI.NFNHTQsnyp......................................ltikhLFKIS.......SYIHLDEYL........AFVG.QskyghlidetfalmiQGLVMASFHPILDYYLPK.SLTKR.L.LS-.............................................SNPNPSSSTSYSTLINDLIRSSVA...FL......GVSYAI....R.........................NIEW...SS....F.........LQV........AIIYSLVSPGLWLLLDGTISG.LIGSLVV.SIAACSV...VYY.....Q..NYQYL.--...-----............................................-------..--..-NGVGD..aSP............................VEL...VAIWLWIGSFVFGGLIVFGKLGRFL-f....................................................
G3N9F8_GASAC/55-157                    ......................................................................................................................................................................................adclyrc----------------.----.------...............................................-----.......---------........----.-...............------------------.-----.-.---.............................................------------------------...-Q......SINHAS....A.........................KVDF...AN....N.........VQL........SLTLAALSVGLWWTFDRSRSG.FGLGVSI.ALLATLAt.qLLV.....Y..NGVFQ.--...-----............................................-------..--..-----Y...TS............................PDF...LYIRSWLPCIFFAGVITMGNIGRQLA.....................................................
H6BNY0_EXODN/133-351                   ............................................................................................................................................................................................l-QTFLLFAFGIGYGSI.VTHL.HRQQLI..............................................tPVPVP......nTERHSLYYQ........LSWG.V...............FGVLLGNALPLVDSFWEK.TVSPA.I.ASRdqvgqddks..........................qdekssatagEASGPSYDSGLGPIWYSAVRSIGV...FV......GIAFAV....R.........................RLPW...QS....T.........LQV........AGTLALANPALWYMIDRSLPG.FALSAAV.GTIGTVV...LLL.....L..DPNFV.PL...PAIHQ............................................P------..--..------...TA............................SEQ...FGVYTWLASILFCTSLCFGAVGRRL-q....................................................
G2X925_VERDV/158-376                   ............................................................................................................................................................................................a-RVAVLFLLGMGYGAL.VTRL.HGKHHLa............................................alPADET......sGPGFNWKYL........TLWG.I...............CGVLLGALLPWFDGVWEE.AFGGD.M.AVVd..........................................ggRDETSDNASRSSTDWALGVRSIGA...FV......GIVFAI....R.........................RLPW...AS....T.........LQL........SLTLALVNPFLWYLIDRSKPG.FLLSAAV.GLIGSAV...LMG.....V..DPEMV.PT...PSASS............................................-FRNETV..SD..SLTFGG..lAS............................QKT...METGIWMLSVLFCSCVCFGNIGRRLA.....................................................
M7TP36_EUTLA/248-544                   ............................................................................................................................................................................................p-RALLLSALGVLYGVL.VARV.LDRFRP...............................................IMGAP......tTSTYDWRYM........AFWG.V...............SGVALGGLLPWFDGVWEG.AFGAS.G.GDGrlhdesavvveqpqqrrqrr....rpgrrsvggglsgkgqqqqqqQEGVGEGAAVPGPDWSLAVRGIGA...FA......GIAFAI....R.........................KLAW...DS....T.........TQV........SVTLALVNPVLWYLIDRSVPG.LLMAGAV.GIAGSAI...FMA.....-..-PLAS.PS..vPFATTlspwayllnnggedw.............nrqqqqqsfnesssssY------..--..------...-HddnsplrlfngggglggasaggggsgsgRHH...LESAVWMLSVLFCCCVCFGNIGRWLA.....................................................
A0A094FK17_9PEZI/752-971               .............................................................................................................................................................................................LRSTLLFVLGTAYGLL.VTHL.HNEQRL..............................................aPFGAQg....fiQPSYDKKYL........IFWG.V...............AGVAMGSALPWFDGLWEE.YFGEE.V.TSSa...........................................vSGKGANDEDGVAAQWTPVVRSIGA...FF......GIAFAI....R.........................KLAW...TS....T.........LQA........SLTLALVNPFLWYLLDRSKPG.FVLSVTV.GLIGTTG...LLM.....F..DSTMV.QS...PLASQ............................................SSYNSTG..TAhtGTHAQG...GN............................NEL...FESAVWIMSVLFCSVLCFGHIGRRLA.....................................................
A0A094BTU5_9PEZI/135-358               .............................................................................................................................................................................................LRSALLFLLGTAYGLL.VTHL.HNEQRL..............................................aPFGSQg....fiQPSYDKKYL........LFWG.V...............AGVAMGSALPWFDGMWED.YFGEE.I.TNSav........................................ggkVIDGKNEEEGVAAQWTPVVRSIGA...FF......GIAFAI....R.........................KLAW...TS....T.........LQA........SLTLALVNPFLWYLLDRSKPG.FVLSVTV.GLIGTTG...LLM.....F..DSTMV.QS...PLATH............................................SSYNSTS..GS.gHPSIYAq.gDN............................TEL...FGSAVWIMSVLFCSVLCFGHIGRRLA.....................................................
F1SHU4_PIG/85-266                      ............................................................................................................................................................................................q-RSLVLFSVGVVLALV.LNLL.QVQRNVtl..........................................fpeE---Vi....atIFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCVAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGLTI.AVLATLIt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
H1VBS5_COLHI/155-370                   ............................................................................................................................................................................................s-RVGLLFVIGMGYGMM.VTRL.QDEHRFs............................................sfQ--VEt....miKPGYDWQYL........TLWG.L...............SGVVLGGLLPWFDGVWED.TFGKE.E.EI-.............................................--GTLQEDISPVKDWALVVRSIGA...FV......GIVFAI....R.........................KLPW...AS....T.........LQV........SLTLALVNPFLWYLIDRSKPG.FLLSAAV.GLAGSAM...LMG.....I..NPDVM.PT...PSSLTy..........................................rNESERAY..SE..PVALGG..lAS............................QKT...IETGIWMLSVLFCSCVCFGNIGRRLA.....................................................
X0JUK2_FUSOX/153-370                   .............................................................................................................................................................................................LRGLLLFVLGVGYGVL.VTSRfHESDSL...............................................P---P.......RATYNWGHL........TFWG.L...............AGVALGALFPWFDRVWEN.SFGDK.G.DEAv...........................................lETSASAKDDDPSTDWALAVRAIGA...FV......GIVFAI....R.........................KVAW...AS....T.........LQV........SLTLALVNPLLWWLIDRSKPG.FLLSAAV.GLAGSVV...LLG.....V..NPDMM.PA...PTQVPfr.......................................hlvNATMAAD..GD..MPILGG..lAQ............................QKT...LETGMWMLSVLFCSCVCFGNIGRRL-t....................................................
R0JTC6_SETT2/185-410                   ............................................................................................................................................................................................g-KLVSLFVFGVIYGVI.VSHL.HETRQFp............................................rvHVVES.......MHRNGHVYF........AIWG.L...............FGVALGSLLPYVDLLWDS.QRGAS.E.AGD.............................................NKEAETPDSPLSEQINEVVRSVAA...FV......GIAFAI....R.........................RLPW...QS....T.........LQL........TLTLALVNPALWYILDRSKPG.LSVSLTVtSVLTSFI...FLS.....-..NTTVL.PS...PSLPLttnat..................................qlpsvPSTTAHA..AQ..QQLFVG..mVT............................YDS...LAVVTWVGSVLFCSCVCFGSIGRRLA.....................................................
U4L8L6_PYROM/105-250                   .............................................................................................................................................................................................LRIVSLFIFGLAYGGL.VTHL.HTRSLP...............................................G---Eg....iwRAAGGYGYL........GLWG.A...............GGVVMGSLLPWIDG----.-----.-.---.............................................--GSGLAVGNKKGDWTPVIRSVGA...FV......GVAYAI....R.........................KLPW...QS....T.........AQV........TLALALVNPFLWFLVDRTLSG.LLFAATV.GAAGTAA...VWA.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------aghqmetv.............................................
A0A0F4GWW2_9PEZI/156-379               ............................................................................................................................................................................................g-RLVALFSVGVLYGLL.ISHL.HDRQRI..............................................aPVPVN.......LDRGSWLYL........AFWG.T...............AAMVFGEALPLADVFWAP.DEDSI.V.D--.............................................DSEEEQRKARGTGGWQDIVRSIGA...FV......GLAFAI....R.........................KLPW...QS....T.........LQL........SLTLALVNPALWYLIDRSPPG.LILSGLV.SVGGTAI...ILG.....I..NPVLV.PS...PSPIEllqghv................................gkrglvNGTVNAL..QD..EGHVLG..iFS............................HET...VGVATWIASVLFVSAVCFGNIGRQLA.....................................................
U9U586_RHIID/153-235                   ............................................................................................................................................................................................p-RFLTLFLLGSLTSFV.IDHL.LTQNHIt............................................eyP---Kdi...pkLIDTAAWIP........PTCG.A...............SAVLVGSLFPFADYWFMR.-----.-.---.............................................------KPQEFQREWSNVM-----...--......------....-.........................----...--....-.........---........---------------------.-------.-------...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------ryy..................................................
S3DDR7_GLAL2/116-353                   ............................................................................................................................................................................................w-RTILLFGIGMGYGGL.VRHL.HDDRKL..............................................aAFQVEg....iiKPRDDWTYL........VFWG.V...............AGVALGSLLPYIDTLMYP.PTSER.V.DSGsvskr..................................rlsgpvDDENLDSSGLLGADWTPAIRSVGA...FV......GIAYAI....R.........................KLPW...AS....S.........LQA........SLTLFLVNPVLWYLIDRSVPG.FVLSSAV.GAAGTAL...LLA.....S..NPDMM.PS...PATYG............................................RTSNNSL..SH..TEILGE...LQvmgve.................vgdyvsRES...IEGGIWILSVLFCSCVCFGNIGRRLA.....................................................
G3N9F3_GASAC/34-215                    ............................................................................................................................................................................................i-RGAMLFSVGVFLALV.LNLL.QVQRNVtlf.........................................ppdV-ISS.......IFSSAWWVP........PCCG.T...............ASALIGLLYPCIDS----.-----.-.---.............................................---RLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...AN....N.........VQL........SLTLAALSVGLWWTFDRSRSG.FGLGVSI.ALLATLAt.qLLV.....Y..NGVFQ.--...-----............................................-------..--..-----Y...TS............................PDF...LYIRSWLPCIFFAGVITMGNIGRQLA.....................................................
Q6CH05_YARLI/99-282                    ............................................................................................................................................................................................f-KTALLFVLGCGYGCV.VHFL.YEKQVG...............................................----T.......RRDTDKLTL........PMWG.V...............HCVLLGLGLPLLDKYKPS.TSAPA.K.GLQ.............................................RIRAKNGGSSPNKKWGSLVRTVGA...FL......GVAYGV....K.........................NLNW...HS....T.........TEV........AVIWALLNPFLWYLLDTTSNG.FGLAAVS.SLIGAAV...MSA.....-..-IGVI.--...PVGL-............................................-------..--..------...--............................-GE...WAGLVWLASNLFCGAICFGNLGR---ii...................................................
F6Y9K5_CALJA/20-115                    ........................................................................................................................................................................................rgppr----------------.----.------...............................................-----.......---------........----.-...............------------------.-----.-.---.............................................------------------------...--......----AS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
A0A0L0NDC3_9HYPO/300-533               .............................................................................................................................................................................................FRAGLLFLLGVGYGVL.VTRL.HNEQQY...............................................LADMAeg...iiKPGSNWEYL........AFWG.V...............SGVVLGSLLPWFDKVWER.AFGSD.I.DNDav........................................aggDGGAAEEELGRGTDWALVMRAIGA...FV......GIIFAI....R.........................KLAW...AS....T.........LQV........SATLALVNPLLWWLIDRSKPG.FLLSAGV.GLTGSML...LLG.....V..NPEIM.PA...PSRPApphaae................................vashngSATADAA..PA..AVVLGG..lAS............................QET...VETGVWMLSVLFCSCVCFGNIGRRLA.....................................................
A0A0D2XZ81_FUSO4/153-370               .............................................................................................................................................................................................LRGLLLFVLGVGYGVL.VTSRfHESDSL...............................................P---P.......RATYNWGHL........TFWG.L...............AGVALGALFPWFDRVWEN.SFGDK.G.DEAv...........................................lETSASAKDDDPSTDWALAVRAIGA...FV......GIVFAI....R.........................KVAW...AS....T.........LQV........SLTLALVNPLLWWLIDRSKPG.FLLSAAV.GLAGSVV...LLG.....V..NPDMM.PA...PTQVPfr.......................................hlvNATMAAD..GD..MPILGG..lAQ............................QKT...LETGMWMLSVLFCSCVCFGNIGRRL-t....................................................
B6QHG7_TALMQ/129-335                   ............................................................................................................................................................................................l-KTSLLFICGVTYGTI.IAHL.HENNWI..............................................aPVKLE......yIDRNSYVYL........LAWG.I...............AGVAFAFVLPWLDKLGDN.D----.-.---.............................................TADQNKDVENKQSTVTLAIRSIGA...FV......GIAFAM....R.........................RLPW...ES....A.........TQE........SVTLALVNPLLWYLIDRTRTG.FWLSTVV.AIVGMGI...TLG.....L..HPELI.PS...SSSTV............................................GLGLRNW..RL..EYDIEG..gIS............................QDA...TAVAVWLASVFYSACVCFGNIGRQL-t....................................................
A0A059A8Z1_EUCGR/59-253                ...........................................................................................................................................................................................ls---LSLFGSGFFLGTL.IDGL.HSRVNL...............................................VVYENgsi.dlgPLHTNIWVP........PLLG.L...............FYCTVGLLQLYLDE----.-----.-.--R.............................................TSSKGSSQGSLEKTVASLIALVG-...FI......ELSAEL....Y.........................KAGV...AA....N.........IEA........YI-LFAMAELMWLLLDRSWFG.FALACVV.GLACPLAeipLMK.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------ffnlwyypqanveilgqglvtwtitcyfvytpflvnlsrwlrsvissc.....
A0A0F7TVA5_9EURO/140-352               ...........................................................................................................................................................................................ls--SALLFGFGIVYGVI.TVHL.HDNHWI..............................................tPVKLEn.....iHYYDSWQYL........GFWG.M...............AGIALGNILPWLDG-WRD.S----.E.SAE.............................................DDSKEDDDANRTPSWVTVARSVGA...FV......GIAFAM....R.........................RLPW...QS....T.........TQA........SLTLALANPVLWYLIDRTSTG.FLLSTTV.GLTGMSV...VLG.....L..KPELI.--...PASNGpt........................................fgTTLLNGT..GW..EHALGA..eIS............................QES...IAVRTWVASVIFCACMCFGNIGRQLA.....................................................
A0A0D9R2G0_CHLSB/86-267                ............................................................................................................................................................................................q-RSLVLFSVGVVLALV.LNLL.QIQRNVtl..........................................fpeE---Vi....atIFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
I1JBD8_SOYBN/56-215                    ..........................................................................................................................................................................................svs---LTLFGTGFLLGPL.LDGL.HSRVNL...............................................VVYESgsi.digPLHTNIWVP........FLLG.L...............FYSSVGLLQLYLDEKV--.-----.-.---.............................................-LNKVQEASLAKTIVSLI--LLAL...FI......ELSADL....Y.........................KAGI...SN....N.........IEA........YI-LFAAAEFIWFFLDRTWLG.FTLACIV.GLG----...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------cplaevpimklfhlwyypqanie..............................
D5GBX7_TUBMM/267-460                   .............................................................................................................................................................................................MRGMALFAFGVAYGAI.VTDL.HNSKKF..............................................sPSTVD.......IDRYNPRYL........VQWG.L...............AGVVLGSLLPWLDG----.-----.-.---.............................................-KDTGNGSIGAKIDWDPAVRSIGA...FV......GIAYAI....R.........................KLPW...QS....T.........LQV........SVSLSFVNPFLWYLIDRTRVG.FWLSAAV.GITGTVF...LLQ.....T..NPEMI.QT...PETIS............................................------F..PD..ESKIAG..sVS............................VES...FGVTVWIASVLFCSCVCFGNVGRRFA.....................................................
A0A0G4LU39_9PEZI/1126-1344             ............................................................................................................................................................................................a-RVAVLFLLGMGYGAL.VTRL.HGKHQLa............................................alPA--Eg....tsGPGFNWKYL........TLWG.I...............CGVLLGALLPWFDGVWEE.AFGGD.T.AVVd..........................................ggRDETLDNANRSSTDWALGVRSIGA...FV......GIVFAI....R.........................RLPW...AS....T.........LQL........SLTLALVNPFLWYLIDRSKPG.FLLSAAV.GLIGSAV...LMG.....V..DPEMV.PT...PSASS............................................-FRNETV..SD..SLTFGG..lAS............................QKT...METGIWMLSVLFCSCVCFGNIGRRLA.....................................................
M7UWF2_BOTF1/111-338                   .............................................................................................................................................................................................FRSVLLFGLGLLYGLL.VKHL.HDDRHL..............................................aPLQVEt....iiKPSHDWKYL........VFWG.I...............AGVGLGSVLPLVDKFWEE.RVQLP.F.ESStct......................................pseeAIDVSNSQGVLGGDWILAVRSVGA...FV......GIAYAI....R.........................KLPW...AS....D.........MQA........SLALALVNPVLWYLIDRSKPG.LAFSAAV.GATGSVL...LLA.....S..NSDLM.PS...PAASMkn.......................................ntvSHQPADY..-S..EAESEK..lVT............................RGN...LEAGIWIASVLFCSCVCFGNIGRRLA.....................................................
A0A090N2W3_OSTTA/63-328                ...........................................................................................................................................................................................ne--VLLIFVSGAILGPL.LDHQ.HSRFNVlhytepvrvhfdalmapmwqs.....pfgrmfdsvlpgfikdavrvaFVNEN......gVLETGWWVP........PLFG.V...............AAIVIGTGTTILDERRIR.DSVRR.A.RETeirrgmhgid.........................eqvsrtsdliDRCPGKPALGFMPGWMSVNWCISV...FA......FQYLAS....G.........................VLAS...PQ....SplvdgflpyHLI........DFVLCVWGVSTWYIFDRSAQG.FFMASLT.AVAGPVA...EIV.....L.iNYGHL.--...-----............................................-------..--..----YS..yAH............................PDV...LGIPTWIPWVYFCGAPAVGNLSRQL-r....................................................
A0A0K8L739_9EURO/131-350               .............................................................................................................................................................................................FRSVLLFGFGVAYGVI.TVHL.HENHWI..............................................tPVKLEn.....iRAYDSWQYL........GLWG.L...............AGVALGNVLPWLDSFAGE.WDTDR.S.RVV............................................kGQGSHRPSEDRTPAWVTVARSVGA...FV......GIAFAL....R.........................RLPW...ES....T.........TQA........SATLALVNPVLWYLIDRTKAG.FILSTVV.GLAGTGV...VLG.....L..KPELV.PT...PADTPat........................................aiP-LLNGT..VL..EYGLVT..gLT............................QEA...VAIRIWLSSVLFCACVCFGNVGRQLA.....................................................
K0KJ43_WICCF/67-260                    ...........................................................................................................................................................................................is--LFILSISGILYNQL.GQHI.HDNHILvpelas..................................kpleigiKI--Gn....alVFHDSVPKW........VIYS.I...............EGIIFGLIQPLIDYIFN-.-----.-.---.............................................---LKSGKIQTKIDSNSIIRASVA...FL......GVSFAV....R.........................KIEW...NS....S.........IQA........SIAWSLLSPCLWLLLDGTLSG.FLTSVTI.ASIASFS...VVV.....L..E--GL.--...PKNWN............................................-------..--..------...QD............................YEF...SAIMLWLGNFFFFGLIIFGKIGRYLF.....................................................
H3CKD4_TETNG/28-209                    ............................................................................................................................................................................................i-RGAMLFSVGVFLALV.LNLL.QVQRNVtl..........................................fppDVLSS.......IFSSAWWVP........PCCG.S...............ASAIIGLLYPCIDR----.-----.-.---.............................................---RLGEPHRFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...AN....N.........VQL........SLTLAALSVGLWWTFDRSRSG.FGLGVSI.ALLATLAt.qLLV.....Y..NGVFQ.--...-----............................................-------..--..-----Y...TS............................PDF...LYIRSWLPCIFFAGVITMGNIGRQLA.....................................................
E7KH17_YEASA/114-275                   ...........................................................................................................................................................................................qa--VLILSLSGFAYHEL.SRNL.HDNHLLhpd........................................fasrP---Ll....lgVKLCNWLSNgvl..pnwLGYG.V...............EGLLFGSVVPILDNIFQT.E----.-.---.............................................----VVKSSVHHDSLTSVIRSINA...ML......GVTFGI....R.........................KIQW...NS....S.........LQA........AGAWGLLNIILWLFFDGSISM.LMSCICI.GVGC---...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------ciscykdiidgsqf.......................................
E7KPH9_YEASL/102-290                   ..........................................................................................................................................................................................aaf---FILFIAGILFPMI.SECL.FDNDQLakgdiv..................................sflkhgiEIKNK.......IVAEPDMVPd......wAVFG.T...............EGVIFGSIVPFIDSFVRY.-----.-.---.............................................QHQPKTRSSVYKNTLGSFIRCSNT...LL......GLIFGI....R.........................KLEW...SS....S.........LQA........AGAWSLLNIVLWLFFDGTLTV.FFPGLVI.GALSAFT...CS-.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------qcfsqlslalyfidfyffgflmfsklgrylf......................
M3AT74_PSEFD/33-265                    ...........................................................................................................................................................................................gq--VVALFSVGVLYGLL.ISHL.HDRQRI..............................................aPVAVN.......LDRSRWSYL........ATWG.I...............MGVLLGQALPYADKLFWS.DSESA.L.DDEeet.......................................eeeAERRELRKARGADGWLDVVRSIGA...FV......GIAFAI....R.........................KLPW...QS....T.........LQL........SLTLALANPAVWYLIDRSSSG.FVLSTLV.ALGGTAV...LLS.....V..NPSLI.PQ...PSPVEviqehv...............................artggvlNGTIEAL..KG..EGYVLG..iFT............................QES...VGVATWIASVLFVSSVCFGNIGRRL-s....................................................
F6US22_MONDO/86-267                    ............................................................................................................................................................................................q-RSVVLFAVGVFLALV.LNLL.QIQRNVtl..........................................fpeE---Vi....atIFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
INSI1_MOUSE/68-249                     ............................................................................................................................................................................................q-RSLVLFSFGVVLALV.LNLL.QIQRNVtl..........................................fpdE---Vi....atIFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
G3AY76_CANTC/103-323                   .............................................................................................................................................................................................LKAAVLSVCAYTYNEI.TRHI.RNNHIKlgaqtfqplflte.....................lfltksfhaveplKVLSK.......NFTPSQNYA........TVLV.F...............QGMIMGLVHPFLDFVIPP.KHNRR.L.FS-.............................................SNPDPKKRYEPATLFNDILRSLIT...FL......GISYAI....R.........................NLEW...SS....S.........LQV........SVVWSLLSPCLWLLLDGTVAG.LLAGLVV.TVWGCLF...VYS.....M..NSDLI.--...-----............................................-------..--..-NIYTS..fES............................SDF...IAIWLWTSSFFFCGMIIFGKIGRALF.....................................................
W6PUC4_PENRO/137-350                   ............................................................................................................................................................................................l-SSVLLFGFGLAYGVI.TVYL.HDNHWI..............................................tPVKLEn.....iHYYDLSQYL........VSWG.L...............AGVVLGNLLPWLDGEVE-.----S.D.SEL.............................................ASTDEDESGDRTPAWVAVARSVGA...FV......GIAFAM....R.........................RLPW...ES....T.........TQA........SLTLALVNPVLWYLIDRTTTG.FVLSTTV.GLAGMGV...VLG.....L..KPELV.--...PASTGp.........................................frTSILNGT..GL..EHVLGPdfgCT............................QES...FAVGTWIASVIFCACVCFGNVGRQLA.....................................................
INSI1_XENTR/60-241                     ............................................................................................................................................................................................r-RSLVLFAVGVFLALV.LNLL.QIQRNVtl..........................................fpeE---Vi....atIFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
A0A094G8H0_9PEZI/139-362               .............................................................................................................................................................................................LRSTLLFLLGTAYGLL.VTHL.HNEQRL..............................................aPFGSQg....fiQPSYDKKYL........IFWG.V...............AGVAMGSALPWFDGMWEE.YFGEE.V.TGSav........................................ggkVIDGTNEEEGFAAQWTPAVRSIGA...FF......GIAFAI....R.........................KLAW...TS....T.........LQA........SLTLALVNPFLWYLLDRSKTG.FILSATV.GLIGTTG...LLM.....F..DSSMV.QS...PLATHp.........................................pyNSTSGSA..HT..GFSAQG...DN............................NEL...FESAVWVMSVLFCSVLCFGHIGRRLA.....................................................
G3N9G6_GASAC/29-210                    ............................................................................................................................................................................................i-RGAMLFSVGVFLALV.LNLL.QVQRNVtlf.........................................ppdV-ISS.......IFSSAWWVP........PCCG.T...............ASALIGLLYPCIDS----.-----.-.---.............................................---RLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...AN....N.........VQL........SLTLAALSVGLWWTFDRSRSG.FGLGVSI.ALLATLAt.qLLV.....Y..NGVFQ.--...-----............................................-------..--..-----Y...TS............................PDF...LYIRSWLPCIFFAGVITMGNIGRQLA.....................................................
A0A093Y4I8_9PEZI/138-357               .............................................................................................................................................................................................LRSALLFLLGTAYGLL.VTHL.HNEQRL..............................................aPFGAQg....fiQPSYDKKYL........IFWG.V...............AGVAMGSALPWFDGLWEE.YFGEE.V.TSSa...........................................vGGKGANEEDGVAAQWTPVVRSIGA...FF......GIAFAI....R.........................KLAW...TS....T.........LQA........SLTLALVNPFLWYLLDRSKPG.FVLSVTV.GLIGTTG...LLM.....F..DSTMV.QS...PLASQ............................................SSYNSTV..SAhtGTHAQG...GN............................NEL...FESAVWIMSVLFCSVLCFGHIGRRLA.....................................................
H2N2V0_ORYLA/100-179                   ............................................................................................................................................lmgsqvgirmapsslevgggfkmlesrhwgalkrhpvppfedaplslry----------------.----.------...............................................-----.......---------........----.-...............------------------.-----.-.---.............................................------------------------...--......------....-.........................----...--....-.........---........---------------------.-------.-------...---.....-..-----.--...-----............................................-------..--..------...TS............................PDF...LYIRSWLPCIFFAGVITMGNIGRQLA.....................................................
A0A0P7V927_9TELE/2-146                 .........................................................................................................................................................................................lfsv----------------.----.------...............................................-----.......---------........----.-...............-AAFVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SMTLAALSLGLWWTFDRSRSG.FGLGITI.AFFATLIt.qFLI.....Y..N-GVY.QL...-----............................................------C..VP..PRLFSR..yTS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
E1BP19_BOVIN/30-211                    ............................................................................................................................................................................................i-RGVVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-IAS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...DN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATVVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
J8Q304_SACAR/114-276                   ...........................................................................................................................................................................................qa--VLILSLSGIAYHEL.SRNL.HDNHLLhpe........................................fasrP---Ll....lgVKITNWLSKgvl..pdwLGYA.T...............DGVLLGSVIPILDNIFQT.-----.-.---.............................................---EVVKNSAHHDSLTSVIRSINA...ML......GVTFGI....R.........................KIQW...NS....S.........LQA........AGAWGLLNVILWLFFDGSISM.LLSCVCI.GVGCC--...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------iscykniidgsqfl.......................................
A0A015J8X1_9GLOM/153-318               ............................................................................................................................................................................................p-RFLTLFLLGSLTSFV.IDHL.LTQNHIt............................................eyP---Kdi...pkLIDTAAWIP........PTCG.A...............SAVLVGSLFPFADYWF--.-----.-.---.............................................----MRKPQEFQREWSNVMRCMGG...FI......GVAYAA....T.........................KLSW...NS....N.........YQV........SCTLALISIVLWFLFDRTSHG.FMMSTLF.SSIGTGV..mYML.....V..SNGI-.--...-----............................................-------..--..------...--............................---...--------------------------ysfthadffgvrswipti...................................
G0W6S5_NAUDC/139-324                   ..........................................................................................................................................................................................ysg---SVLFICGLLFGEL.SKFL.FDNHDLqkgglsi.................................vfknlvqL---Ld....kiITVSKVTEY........IGFG.I...............QGIILGVILKISDNIF--.-----.-.---.............................................RPSKEKTGINRKNSFRSIIRLVNA...ML......GISLGV....R.........................RLPW...TS....S.........NQG........SILWLLLNVIVWLFFDGSL-S.FLMSGIV.QTLFIAF...FYY.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------nrfdhmsqllylinfhflgmlffgklqrylf......................
J7S777_KAZNA/79-275                    ...........................................................................................................................................................................................tt--LVVLALSGIVYHEL.ARMM.HDNHKLhed........................................iisrP---Ll....vgVHFLDWAVG........GSLG.Isiptw.....vgyalEGVLFGLSVPVLDRYLPE.SRI--.-.---.............................................TGTGGSGTSPRGDSLFSVLRTVNS...ML......GITFGI....R.........................KIKW...AS....S.........MQA........SVAWLSLNFMLWLLLDSTVPL.LLHSATL.GCLVSAL...SS-.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------qgagpavhlpevlylfdfyflgflvfgklgrylt...................
G1PVG6_MYOLU/88-269                    ............................................................................................................................................................................................q-RSLVLFSVGVVLALV.LNLL.QVQRNVtl..........................................fpeE---Vi....atIFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCVAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
C1GA12_PARBD/174-384                   .............................................................................................................................................................................................LRAVLLFAFGVAYGTL.IMHL.HDNHRL..............................................tPMRMEn.....iTDHGSWVYM........VFWG.L...............AGVALGGLLPWFDGVWEE.FVGGE.C.GGGilkeg...................................dignlNAQGDDDKQLKVADWNSVVRSTGA...FV......GIAFAI....R.........................KLPW...QS....T.........LQV........SLTLALVNPFLWYLIDRSKPG.FMLSTAV.GLVGMVA...LLG.....I..NSDVV.PA...PGVPV............................................GAGGMQV..AS..QESIA-...--............................---...--------------------------vvsgslrmerwkieeyek...................................
G3JQS6_CORMM/181-412                   ............................................................................................................................................................................................a-RTAVLFVLGLGYGAL.VTRL.HEHEQAp.............................................pPAAAEgp...vaLPAFNSTYL........GAWG.V...............AGVVLGTLLPWFDGVWEA.RFGEP.D.AEEesa.......................................gadGDNAPSQVVDTGLDSALVMRAIGA...FV......GIVFAI....R.........................KLAW...DS....T.........LQI........SATLALANPLLWWLIDRSQAG.FLLSAAV.GLVGSLL...LLG.....I..SPDMM.PA...PTLQLlrn.....................................anavNGTGDDA..A-..ATATGGp.vAD............................GQM...IETGVWMLSVLFCSCLCFGNIGRRLF.....................................................
R8BTY1_TOGMI/159-380                   .............................................................................................................................................................................................MRAALLFGLGMGYGVL.VSQL.HDEQNIa............................................slP--AEg....lvNPGYNWRYL........TFWG.V...............CGVVLGGLLPWFDGLWEQ.IFEKA.S.LE-.............................................DEEIESKNVKADTDWALVIRGIGA...FA......GIVFAI....R.........................KLPW...AS....T.........MQV........SLTLALVNPFLWYLIDRSKPG.FLLSAAV.GLTGSAI...LMG.....L..NPQIV.PT...PAGFSsdg......................................lhrNGTAPSF..AE..PLTLGG..lAS............................QET...VETGIWMLSVLFCSCVCFGNIGRRLA.....................................................
L8FM11_PSED2/139-362                   .............................................................................................................................................................................................LRSALLFLLGTAYGLL.VTHL.HNEQRL..............................................aPFGAQg....liQPSYDKKYL........IFWG.V...............AGVAMGSALPWFDGMWEE.YFGEE.V.TTSai........................................ggkVVDGANEEEGVAVQWTPVVRSIGA...FF......GIAFAI....R.........................KLAW...TS....T.........LQA........SLTLALVNPFLWYLLDRSKPG.FVLSVTV.GLIGTTG...LLM.....F..DSSMV.QR...PLAAHs.........................................scNSTTGSA..HT..GFYAPG...DN............................NEL...FESAVWVMSVLFCSVLCFGHIGRRLA.....................................................
M1W7U7_CLAP2/164-379                   .............................................................................................................................................................................................LRGVLLCVLGLGYGVI.VTRL.HSEHNHl............................................prLLDDSi.....mKTGSDWKYL........GFWG.A...............GGVVLGSLLPWFDTLWAS.AFDRG.S.EK-.............................................VVEDGARGAAPGTDWALVMRAVGA...FV......GILFAI....R.........................KLAW...AS....T.........LQV........SAALALVNPLLWWLIDRSKPG.FVLSAVV.GLTGSAV...LLS.....L..NGDVG.GA...PHVQA............................................SLSGWEE..-E..PFVLLG..lAG............................HEA...IETAMYMLSVLFCSCLCFGNIGRRLA.....................................................
H3B8S7_LATCH/32-213                    ............................................................................................................................................................................................i-RGVVLFSIGVFLALV.LNLL.QVQRNVtlf.........................................ppdV-IAS.......IFSSAWWVP........LCCG.T...............ASVTVGLLQLAADT----.-----.-.---.............................................---HCLFNQSFLLHFSSNFMCVCV...CV......SVNTGP....K.........................KVDF...AN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGIGI.AFLATVVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
F8W4P3_DANRE/1-103                     .............................................................................................................................................................................................----------------.----.------...............................................-----.......---------........----.-...............------------------.-----.-.---.............................................------------------MRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.FGLGLTT.ALLATLIa.qLLV.....Y..N-GIY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFSGGVTVGNIGRQLA.....................................................
A1CXK5_NEOFI/121-340                   .............................................................................................................................................................................................FRSVLLFGFGVAYGVI.TVHL.HENHWI..............................................tPVKLEn.....iRYYDSWQYL........GLWG.L...............AGVALGNVLPWLDSFAGEwDTGRS.R.TVK.............................................GQENNRLREDRTPAWVTVARSVGA...FV......GIAFAL....R.........................RLPW...ES....T.........TQA........SATLALVNPVLWYLIDRTKAG.FLLSTVV.GLAGTGV...VLG.....L..KPELV.--...PTSADtpa......................................ttiP-LLNGT..VL..EYGLPT..gLT............................QEG...VAVRIWLSSVLFCACVCFGNVGRQLA.....................................................
A3LUC1_PICST/90-312                    .........................................................................................................................................................................................ikvi----ILSLSAFVYNEI.TKHI.NYQHFAtnelanfpltvtn....................vfvfsvleklklgnYFNVD......gDFVKLADFF........FAVT.V...............QGLIMGLIQPIMDKVLPA.NFSKR.L.LSS.............................................-NPFPHAQTTYSNLFNDLLRASVT...FL......GISYAI....R.........................KIEW...SS....F.........LQV........SIIWSLMNPGLWLLLDGTLSG.FLSSTIV.SLAACGI...VYF.....E..NYVFV.--...-----............................................-------..--..-NQYYS..lQQ............................EDS...IAVWLWVCSFFFCGLIIFGKIGRGLF.....................................................
E9E550_METAQ/164-401                   .............................................................................................................................................................................................LRGTLLFLLGLGYGAL.VTRL.HNEQNQl............................................pqM---Pdd..silKPGNNWKYL........AFWG.V...............AGIGLGSLLPWFDKLWED.TFGNE.E.DD-.............................................--NVADKGASPGTDWALVMRAIGA...FV......GIIFAI....Vspksnigvsi....pkcatdksfqrKLAW...VS....T.........LQV........SATLALVNPLLWWLIDRSKPG.FVLSAAV.GLTGSIL...LLG.....V..DPEIM.PA...PSGLPt..........................................rNSSNAFH..SD..PLALGG..lAT............................QET...VETGVWMLSVLFCSCLCFGNIGRRL-t....................................................
A0A074Z2F4_9PEZI/144-376               ...........................................................................................................................................................................................gk--NVVLGLAGIAYGQL.IARL.HDRQTL..............................................vPVQVE......gMPSDSWAYI........AYWC.F...............SGIALGQALPRVDSIWMS.DGSGE.N.EAEreyrt..................................sgnlrsAQDTRNRSQSWTPGWNEVVRFIGA...AV......GIVYAI....R.........................RLPW...QS....P.........LQL........SLTLALANPAIWYCLDRTGPC.FILATTV.ALTGTGL...LLS.....I..NPELI.PS...PHTANiasf....................................sklaNATADAT..KG..QDLVLG..tFT............................MES...VGVATWIASVLFVSAVAFGNIGRRL-.....................................................
K7XAX2_SHEEP/30-211                    ............................................................................................................................................................................................i-RGVVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-IAS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...DN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGIGI.AFLATVVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
INSI2_PONAB/30-211                     ............................................................................................................................................................................................i-RGVVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-IAS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...DN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATVVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
G1L328_AILME/1-130                     ............................................................................................................................................................................................a----------------.----.------...............................................-----.......---------........----.-...............---VVGLLYPCIDS----.-----.-.---.............................................---RLGEPHKFKREWASVMRCVAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITV.AFLATVIt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
F2T2W4_AJEDA/171-427                   .............................................................................................................................................................................................LRSALLFIFGVAYGII.ITHL.HDNPRV..............................................tPIKIEni...dlIRRGSWVYM........VFWG.G...............AGVALGGLLPWFDVVWEE.FVGGD.G.EGEedgagvgekmdggggnvevs....nrdltgsgsgsgdgkvnvkvnGGQQLKSSQSIAADWNQVVRSIGA...FV......GIAFAI....R.........................KLPW...QS....T.........LQV........SLTLALVNPFLWYLIDRSKPG.FMLSTAV.GLLGMVT...WLG.....V..NPDVV.PA...PTANV............................................GEANAIA..GS..G-GMLL...AS............................QES...IAVGTWIASVLFCSCVCFGNIGRRLA.....................................................
A0A068XVQ8_HYMMI/6-182                 .............................................................................................................................................................................................LRGVALFVSGVSFYYI.FGVI.QGFRSGif...........................................tdGFSKS.......LLLTGSGIP........YCCG.F...............LSVLCGLVSPRLYR----.-----.-.---.............................................---HLKISSAQEAEWSSIMRCVIF...FM......GICHAS....A.........................KLEI...VS....I.........SQL........FLTSFCFSIGIWWIFDRSISG.LLMGFLM.GILGTGS...CLW.....L.gDKNIT.--...-----............................................-------..--..------...--............................AID...PLLTSWLPCVFFSGGITAALVGRQLA.....................................................
G3RT31_GORGO/86-267                    ............................................................................................................................................................................................q-RSLVLFSVGVVLALV.LNLL.QIQRNVtl..........................................fpeE---Vi....atIFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
A0A0A1SZH1_9HYPO/153-372               .............................................................................................................................................................................................LRTSLLFVLGLGYGAL.VTHF.QAEQKL...............................................SSGII.......DPTYNKTYL........AFWG.V...............SGVFLGSLLPWFDTFWEE.AFPNT.E.NEEae.........................................vgEDEEEDRAAATASDWTLVMRAIGA...FV......GIVFAI....R.........................KLAW...AS....S.........LQL........SITLALVNPLLWWLIDRSKPG.LLLSTAV.GVIGSAL...LMG.....V..NPEVM.PT...PAGQIt.........................................hnSTMQVPS..SE..ALMLGG..lAT............................QQT...VETGVWMVSVLFCSCVCFGNIGRRL-t....................................................
B6HVF3_PENRW/138-352                   ............................................................................................................................................................................................l-SSVLLFGFGLAYGVI.TVHL.HDNHWI..............................................tPVKLEn.....iHYYDSWQYL........GFWG.L...............AGIALGNLLPWLDSCREG.DSDSK.-.--L.............................................AGTNEEDSEDRTPSWVTVARSVGA...FV......GIAFAM....R.........................RLPW...ES....T.........TQA........SLTLALANPVLWYLIDRTTTG.FVLSTTV.GLAGMGV...VLG.....L..KPELV.--...PISTGps........................................fgTTLLNGT..GL..ENVLGA..gIT............................QES...IAVGTWIASVIFCACVCFGNVGRQLA.....................................................
U9TGE2_RHIID/1-100                     ............................................................................................................................................................................................m----------------.----.------...............................................-----.......---------........----.-...............------------------.-----.-.---.............................................----------------------GG...FI......GVAYAA....T.........................KLSW...NS....N.........YQV........SCTLALISIVLWFLFDRTSHG.FMMSTLF.SSIGTGV...MYM.....L.vSNGIY.--...-----............................................-------..--..-----S..fTH............................ADF...FGVRSWIPCILYSSCVCFGTIGRQL-m....................................................
H0YQZ7_TAEGU/81-263                    ............................................................................................................................................................................................q-RSVVLFVVGAFMALV.LNLL.QIQRNVtl..........................................fpdE---Vi....stLFSSAWWVP........PCCG.T...............AAGERGGGAECVTR----.-----.-.---.............................................--AHFQPTASDADIWEDARPALSP...RT......VLNIFF....Q.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFVATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
A0A0C4DGZ4_HUMAN/30-211                ............................................................................................................................................................................................i-RGVVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-IAS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...DN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATVVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
G3UQT2_MELGA/30-211                    ............................................................................................................................................................................................i-RGIVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-ITS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCMDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...AN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATLVs.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
E7QFP9_YEASZ/13-175                    ................................................................................................................................................................akgdivsflkhgieiknkivaepdmvpdw----------------.----.------...............................................-----.......---------........AVFG.T...............EGVIFGSIVPFIDSFVRY.-----.-.---.............................................QHQPKTRSSVYKNTLGSFIRCSNT...LL......GLIFGI....R.........................KLEW...SS....S.........LQA........AGAWSLLNIVLWLFFDGTLTV.FFPGLVI.GALSAFT...CS-.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------qcfsqlslalyfidfyffgflmfsklgrylf......................
G3NID4_GASAC/7-188                     ............................................................................................................................................................................................r-RGLVLFTVGAFLALV.LNLL.QIQRHVtl..........................................fpeEV--Ma.....tLFSSAWWIP........PCCG.T...............GAAVVGLLYPCLDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....V.........................KLDF...DN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.FGLGITT.AVLATVFt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFSGGVTVGNIGRQLA.....................................................
H2V9D0_TAKRU/22-203                    ............................................................................................................................................................................................r-RGLVLFTVGVFLALV.LNLL.QIQRKVtl..........................................fpeEV--Ma.....tLFSSTWWIP........PCCG.T...............GAAVVGLLYPCLDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....V.........................KLNI...DN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITT.AFLATVFt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QH...TS............................PDF...LYVRSWLPCIFFSGGVTVGNIGRQLA.....................................................
NSG2_YEAST/114-274                     ...........................................................................................................................................................................................qa--VLILSLSGFAYHEL.SRNL.HDNHLLhpd........................................fasrP---Ll....lgVKLCNWLSNgvl..pnwLGYG.V...............EGLLFGSVVPILDNIFQT.E----.-.---.............................................----VVKSSVHHDSLTSVIRSINA...ML......GVTFGI....R.........................KIQW...NS....S.........LQA........AGAWGLLNIILWLFFDGSISM.LMSCICI.GVGC---...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------ciscykdiidgsq........................................
B2GRG1_DANRE/60-241                    ............................................................................................................................................................................................r-RGLVLFIVGVVLALV.LNLL.QIQRNVtl..........................................fpeEVLDT.......LFSSAWWIP........LCCG.T...............AAAVVGLLYPCLDH----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.FGLGLTT.ALLATLIa.qLLV.....Y..N-GIY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFSGGVTVGNIGRQLA.....................................................
M3YDU4_MUSPF/1-103                     .............................................................................................................................................................................................----------------.----.------...............................................-----.......---------........----.-...............------------------.-----.-.---.............................................------------------MRCVAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
A0A061DTD6_THECC/48-206                ...........................................................................................................................................................................................is---LSLFGSGFVLGPL.IDGL.HSRVDL...............................................VVYQSgai.nigPLHTNIWVP........PLLG.L...............FYCTVGLLQLFLDEKA--.-----.-.---.............................................-SSEVPEGTLEKAG--GSLIALVL...FI......ELSAEM....Y.........................KNGV...AD....N.........IEA........YIL-FAAAELLWFSLDRTRLG.FTLASII.GICCP--...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------laeiplmkffhlwyypqayve................................
A0A0D9MNR2_ASPFL/130-349               .............................................................................................................................................................................................LKAALLFSFGIVYGII.TIHL.HENHWI..............................................tPVKLEn.....tHYYGSWEYL........GFWG.V...............AGVVLGNVLPGLDLFSED.VTVDY.A.KQP............................................sRSSNDEENEERTLSWVAAVRSVGA...FV......GVAFAM....R.........................RTPW...QS....T.........TQA........SATLALANPVLWYLIDRTRTG.FFMSTIV.GVGGMGI...VLA.....L..RPDLV.P-...PSTGAsa........................................saIPALNST..LR..DLGFGT..gIT............................QES...LAVRTWVASVLFSACVCFGNIGRQLA.....................................................
INS1_SCHPO/95-281                      ............................................................................................................................................................................................c-KLCVIFGLGFVFTYL.AEQI.VQDAKL...............................................PLLT-.......VNLKSWKFEpp....wpAIFG.F...............VAVILGLSYRRMDTKY--.-----.-.---.............................................PLGAAPLRPSQSSKWQWISRYLAA...FA......TLLLSM....K.........................KLLF...IS....N.........SHS........IVALVASSASIWYIFDRSRNG.IILSTIT.SVLGSIL...YYN.....L.vDTSK-.--...-----............................................-------..--..-IELNG...VE............................FPE...IQFRLWIPMILFSASTIVGNAGRLLF.....................................................
M3WVQ4_FELCA/1-135                     ..........................................................................................................................................................................................cfv----------------.----.------...............................................-----.......---------........----.-...............LTAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCVAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
F9G507_FUSOF/153-370                   .............................................................................................................................................................................................LRGLLLFVLGVGYGVL.VTSRfHESDSL...............................................P---P.......RATYNWGHL........TFWG.L...............AGVALGALFPWFDRVWEN.SFGDK.G.DEAv...........................................lETSASAKDDDPSTDWALAVRAIGA...FV......GIVFAI....R.........................KVAW...AS....T.........LQV........SLTLALVNPLLWWLIDRSKPG.FLLSAAV.GLAGSVV...LLG.....V..NPDMM.PA...PTQVPfr.......................................hlvNATMAAD..GD..MPILGG..lAQ............................QKT...LETGMWMLSVLFCSCVCFGNIGRRL-t....................................................
G1K9U7_ANOCA/38-219                    .............................................................................................................................................................................................LRGVVLFLIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-ITS.......IFSSAWWVP........LCCG.T...............ASAVIGLLYPCMDK----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...AN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGIGI.AFLATVVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
A0A0B1PDX9_UNCNE/110-343               .............................................................................................................................................................................................IRAILLFGTGICYGLL.IQHL.QDKPDLi............................................fhEVQNE......tQHNISRLYL........FLWG.I...............SGVAIGSLVPRVDASFSL.HSTSS.N.KQNspkds...................................ayalnENSKMEENNLLRQDWTPVIRSVGA...FV......GIAFAL....R.........................KLPW...SS....T.........FQA........SLALSLVNPVLWYLVDRSKSG.FFLSSVV.GTLGTSI...LII.....L..KSKKT.VY...PTLLSpirt....................................yyiaF-THGET..EK..KLDGLN..lID............................KEN...LEDAIWILSVLFCSCICFGNIGRRLA.....................................................
M3ZJW1_XIPMA/84-265                    ............................................................................................................................................................................................r-RGLVLFTVGAFLALV.LNLL.QIQRNVtl..........................................fpeEV--Mt.....tLLSSAWWIP........PCCG.T...............GAAVIGLLYPCLDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....V.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.FGLGITT.AFLATVIt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFSGGVTVGNIGRQLA.....................................................
A0A0F4ZAG7_9PEZI/204-434               .............................................................................................................................................................................................LRLALLFVLGAVYGNI.LLSL.HATRAV..............................................gP---V.......RQTLDWRYM........TLWG.S...............VGVVFGALLPWFDTAWDG.IFEDK.D.DMDepivsep...............................epavsdlHSVAASRGADTLKEWTLAIRSIAT...FV......GILFAI....R.........................RLPW...DS....T.........LQA........SISLALVNPFLWYVIDRSAPG.LVLSSLM.GAAGTGV...LMG.....V..NPGIM.PT...PPAPArlv......................................anwSATPFDD..DA..VAFVWR..tAS............................AST...VETLVWMLSVLFCCSLCFGNIGRRLA.....................................................
G0VA72_NAUCC/110-294                   ...........................................................................................................................................................................................ys--FFILFTCGIVFGEL.AENL.FDNDKLykgmtav.................................iledgvkLIDKV.......VPKSSVTNY........IGFG.I...............EGILLSLVLRVSDYLI--.-----.-.---.............................................RPNKDKIGQSKKNSFRSIVRISNA...IL......GISLGV....R.........................RLPW...TS....S.........LQG........SMLWLLVNVIVWLFFDGTLSI.LTSGVIQ.ALLICLT...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------ysrgietsqtlylinfhflgllifgklsrylf.....................
C5DZL8_ZYGRC/86-242                    ...........................................................................................................................................................................................fa--MVVLSLAGIAYHEL.SRHL.HDNHKLhpelas...................................rpllvgV---Qls...qfF-TGNM--Ap.....dwAVYA.F...............EGIFFGSCIPLIDYIF--.-----.-.---.............................................------SIKTRHASWLSILKTVNA...ML......GVTFGI....R.........................KVQW...SS....S.........LQA........AIAWGLLNIILWLFFDGTISM.FITCSTL.GLLSCAT...CY-.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------sditdksql............................................
T5AFN7_OPHSC/157-279                   .............................................................................................................................................................................................LRALLLFLLGVGYGVL.VTRL.HNEQQY...............................................LADLTeg...iiKPGANWRYL........TFWG.V...............AGVVLGSLLPWVDRRWEK.AFGSD.A.GDAv..........................................ddGDEAARAAQRPGTDWALVMRAIGA...FV......GIIFAI....V.........................----...--....-.........---........---------------------.-------.-------...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------sgsldakvpgr..........................................
G5AVC9_HETGA/63-244                    ............................................................................................................................................................................................q-RSLVLFSVGVVLALV.LNLL.QIQRNVtl..........................................fpdE---Vi....atIFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
V5G359_BYSSN/130-342                   .............................................................................................................................................................................................VRSVLLFGFGVAYGTL.VSHL.HENHWI..............................................tPVKTN.......IDSSSWEYI........GLWG.L...............AGVALGSVLPWLDVLWGD.FLGEA.A.KP-.............................................--AKQPDAESRFSRWSPVVRSVGA...FV......GIAFAT....R.........................RLPW...QS....T.........AQA........SLTLALVNPVLWYLVDRSKPG.FFLSTAV.SIIGMGV...ILQ.....V..NPEVI.PM...PTDPPa..........................................rITIPNRS..GQ..SYGVEL..gLS............................WDS...IAIGTWVASVLFCACVCFGNIGRLLA.....................................................
A0A0F2LXZ0_SPOSC/218-464               ............................................................................................................................................................................................a-RAVLLFTLGMGYGVL.VSRL.RSETHIpfddlges...............................tsssadtsPATEY.......VASYDWRYL........VSWG.L...............SGIALGTLLPWFDGVWDR.SFGRN.G.RV-.............................................---LGKTRTAPDTDWALVVRGIGA...FA......GVAFAM....R.........................KLPW...TS....T.........MQA........SLTLALANPFLWYLLDRSKSG.LLLAAAF.GVVGSGA...LMI.....L..NLDWM.PN...PGMHSspyyvgygagv......................ggaygtssfhqNGSSASS..ND..GSGLDA..sAS............................AVT...AETAIWMLSVLFCSSVCFGNIGRRLF.....................................................
G8JUI6_ERECY/93-247                    ...........................................................................................................................................................................................cs--LVVLGVSGIAYHEL.SRNL.HDNHLLheela....................................srplvlG--VK......vCQQLSFGIL........PMWA.Gy............avEGIFFGSLLPIVDY-W--.-----.-.---.............................................-----RGISVGKVNLSSVLRAINA...IM......GVSFGI....R.........................RVEW...SS....S.........LQA........SGAWLLLDGIIWLLFDGSFSV.FLLGFGI.GLVTVIT...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------cyddithfa............................................
L5JZP7_PTEAL/30-211                    ............................................................................................................................................................................................i-RGIVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-IAS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...DN....N.........IQL........SLTLAALSIGLWWTFDRSRTG.FGLGVGI.AFLATLVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
A0A016PKP1_GIBZA/154-371               .............................................................................................................................................................................................MRGLLLFVLGVGYGVL.VTSR.FNSDSD...............................................--SQA.......GSTYNWAHL........SFWG.L...............AGVALGALFPWFDRVWED.SFGEK.E.DEA............................................vAENAPAKDDDSGTDWAIAIRAIGA...FV......GIVFAI....R.........................KVAW...AS....T.........LQV........SLTLAMVNPLLWWLIDRSKPG.FFLSTAV.GLAGSMI...LLG.....I..NPDMM.PA...PAHAPfrq......................................lvnATTPSQD..EV..VPILGG..fAH............................QET...LETGMWMLSVLFCSCVCFGNIGRRL-t....................................................
F7W133_SORMK/225-506                   .............................................................................................................................................................................................LRTILLFALGMGYGVL.VTRL.PNGDSV...............................................-----.......TGGYGWRYL........TFWG.Axxxxxx..xxxxxxxXXAVLGRLLPWFDQVWEE.TFGKR.A.RVTkqekerrraaaaaeaa............aalkssvsatllpteteSSTGEGITSPPEADWPLVVRSIGA...FV......GIVFAI....R.........................RLPW...TS....T.........MQV........SITLALANPFLWYLIDRSKPG.FLLSAAV.GVTGSAI...LMG.....L.gDPDMM.PA...PVAGGmgayhdhiltngq..................pamgvlngttsrlPRDATGR..MG..GGAMGG..aSG............................NAA..vIETGIWMLSVLFCSCVCFGNIGRRLA.....................................................
G5BIB8_HETGA/30-211                    ............................................................................................................................................................................................i-RGVVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-IAS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...DN....N.........IQL........SLTLAALSIGLWWSFDRSRSG.FGLGVGI.AFLATVVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
A0A015K756_9GLOM/153-334               ............................................................................................................................................................................................p-RFLTLFLLGSLTSFV.IDHL.LTQNHIt............................................eyP---Kdi...pkLIDTAAWIP........PTCG.A...............SAVLVGSLFPFADYWF--.-----.-.---.............................................----MRKPQEFQREWSNVMRCMGG...FI......GVAYAA....T.........................KLSW...NS....N.........YQV........SCTLALISIVLWFLFDRTSHG.FMMSTLF.SSIGTGV...MYM.....L.vSNGIY.--...-----............................................-------..--..-----S..fTH............................ADF...FGVRSWIPCILYSSCVCFGTIGRQL-m....................................................
M3XP89_MUSPF/30-211                    ............................................................................................................................................................................................i-RGVVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-IAS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...DN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATLVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
M2LBR2_BAUCO/157-378                   .............................................................................................................................................................................................VRMLAMASVGVMYGLL.ISHL.HDRQGI..............................................aPVKLE......gVNRQSWTYL........SLWA.C...............LGVTLSEALPRLDKLWTP.HEDED.L.E--.............................................EKERPQRRGHGSGDWFDVVRAIGI...FV......GIAFAI....R.........................RLPW...QS....T.........MQL........ALTLAIANPALWYLIDRTPAG.FTLSTLV.SVSGTAI...ILS.....V..NPALV.PS...PSAAQvlqs...................................qtnkqANGANAV..LG..QGLVLG..lFS............................QES...VSVATWIASVLFVSSVCFGNIGRRL-v....................................................
Q6CIB9_KLULA/75-235                    ...........................................................................................................................................................................................la--WVVLSIAGIAYHEL.SKNL.HDNHELhndft.....................................srpllL---Ga....tiAQSLSFGYLp.....pwTFYA.I...............EGILFGSIVPFVNWIL--.-----.-.---.............................................-----GTFDRQPTTISSVLRSTNA...ML......GVSFGI....R.........................RIEW...SS....S.........LQA........SGAWFLLNIILWLFFDSSFTM.LASGLAI.GLVTCVT...CY-.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------qditdsaqllyf.........................................
T1ED94_HELRO/6-185                     ............................................................................................................................................................................................t-RVVSLFFAGVLFSLV.LNLL.QFQRQIti..........................................fpdLV--D......nVFSSTWWVP........PSCG.F...............AAALLGMFYPYTDRHF--.-----.-.---.............................................------GLFNEKQEWSGVMRCVAV...FV......GINQAS....A.........................KIDF...SN....S.........LQF........SLTLLIMSFGLWWLFDKSMVG.LLLGVLF.SFVATFMt.qLLV.....-..YWELF.--...-----............................................-------..--..-----K..ySN............................PDF...VFVRSWLPCIFFSASVTMGLIGRQLA.....................................................
A0A0A8LDT1_9SACH/75-253                ...........................................................................................................................................................................................ia--WVVLSAAGIAYHEL.SKNL.HDNHELhndf......................................tsqplL---Lga...tiAQSLSFGYVp.....pwTFYA.I...............EGILFGSFVPIIDWLL--.-----.-.---.............................................-----GSFDTNPITISSVLRSTNA...ML......GVSFGI....R.........................RIEW...SS....S.........LQA........SGAWFLLNVILWLFFDGTFTM.LASGLTV.GLITCVT...CYQ.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------hvtdsaqllyfvdfyflgllfftrlgkyl........................
INSI2_XENTR/23-204                     .............................................................................................................................................................................................LRGLLLFLIGVFLALV.LNLL.QVQRNVtl..........................................fppDVLSS.......LFSSAWWVP........LCCG.T...............AAAAIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...AN....N.........TQL........SLTLAALSIGLWWTFDRSRSG.LGLGIGI.SFFATVVs.qLLV.....Y..-NGVY.--...-----............................................-------..--..-----E..yTA............................PDF...LYVRSWLPCIFFAGGITMGNIGRQL-e....................................................
G1RMF4_NOMLE/30-211                    ............................................................................................................................................................................................i-RGVVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-IAS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...DN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATVVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
A5DXC0_LODEL/116-354                   .......................................................................................................................kliilsssaylyneitrhinydhfndkqlasfpltithvflysfvskfklgnyienidtselgraldgif----------------.----.------...............................................-----.......---------........-ALT.L...............QGLLMASLHPIFDRLLPK.IFTKR.L.LSSnpiqsas..............................stsstlstSSTSSSTSLSNTNFMNDLIRTCIT...FL......GISYAI....R.........................KIEW...SS....F.........LQV........SIIWSLINPGLWLLLDGTISG.FLSSLLV.TALCCII...IYL.....Q..NTHII.--...-T---............................................-------..--..--SYSK...TT............................NDV...IALWLWIGSFFFCGIIIFGKIGRGLF.....................................................
A0A017SDM9_9EURO/126-341               .............................................................................................................................................................................................LRSAFLFGFGIVYGVI.TVHL.HENHWI..............................................tPVKLEn.....iHYYESWQYL........GFWG.L...............TGIALGNVLPWLDVFFEG.TVPDT.V.RR-.............................................-TKQAHSNEDRTSTWVAAVRSVGA...FV......GIAFAM....R.........................RLPW...ES....T.........TQA........SLTLALVNPVLWYLIDRTKTG.FLLSTVV.GVAGMGL...VLG.....L..KPELM.PS...SIESPp..........................................tTFGLNST..GL..EFAFAT..gIT............................QEG...IAVRTWIASVLFCACVCFGNIGRQLA.....................................................
F6V608_HORSE/30-211                    ............................................................................................................................................................................................i-RGVVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-IAS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...DN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATLVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
INSI1_CHICK/61-242                     ............................................................................................................................................................................................q-RSVVLFVVGAFMALV.LNLL.QIQRNVtl..........................................fpdE---Vi....atLFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFVATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
E7LZH0_YEASV/114-244                   ...........................................................................................................................................................................................qa--VLILSLSGFAYHEL.SRNL.HDNHLLhpd........................................fasrP---Ll....lgVKLCNWLSNgvl..pnwLGYG.V...............EGLLFGSVVPILDNIFQT.E----.-.---.............................................----VVKSSVHHDSLTSVIRSINA...ML......GVTFGI....R.........................KIQW...NS....S.........LQA........AGAWGLLNIILWLF-------.-------.-------...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------f....................................................
B2AXP1_PODAN/181-429                   .............................................................................................................................................................................................LRASLLFALGLGYGVL.VTRL.PRAQNFdp...........................................qqPPTTS.......DEPLDWRYL........LFWG.A...............SGVLLGCLLPWFDQFFIP.AAKKN.G.PLTgkplp..................................sspqqqRQQNEREGRQQEADYVLVIRSIGL...FV......GIVFAI....R.........................KLSW...TS....T.........MQV........SLTLALINPFIWYLIDRSKPG.FLLSASV.GLVGTVG...MIGlglkdV..FPGLM.PA...PSFYQhgdggglgs..........................grmrrngsaN--AGYV..AG..S-----...-Ggik.....................lvgeREV...VETGVWMLSVLFCSCVCFGNIGRRLA.....................................................
U3KGT8_FICAL/30-211                    ............................................................................................................................................................................................i-RGVVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-ITS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCMDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...AN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATLVs.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
W2RSC6_9EURO/134-340                   ............................................................................................................................................................................................l-QTALLFAFGVGYGSI.VTHL.HKTRQI..............................................tPVPVP......gAELSSSYYH........LAWG.L...............FGILVGNGLPLLDEWLND.SVVTD.S.TQPrhh......................................rsnsGTSDHDREDSIGPIWYSAVRSVGA...FV......GIAFAV....R.........................KLPW...QS....T.........LQV........SSTLALANPVLWYLIDRSMPG.FAFSTTL.AIVGTVF...LSI.....M..SPNFV.PV...PAIHQ............................................-------..--..-----A...VA............................SEQ...VGVYMWLASILFCSTLCFGAIGRKL-q....................................................
H2V9C8_TAKRU/60-241                    ............................................................................................................................................................................................r-RGLVLFTVGVFLALV.LNLL.QIQRKVtl..........................................fpeEV--Ma.....tLFSSTWWIP........PCCG.T...............GAAVVGLLYPCLDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....V.........................KLNI...DN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITT.AFLATVFt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QH...TS............................PDF...LYVRSWLPCIFFSGGVTVGNIGRQLA.....................................................
A0A0F8WSP6_9EURO/126-345               .............................................................................................................................................................................................LKSALLLGFGVIYGII.TIHL.HENHWI..............................................tPVKLEy.....tHFYGSWQYL........GFWG.I...............IGVTLGNLLPWLDSFLEK.AAAKS.A.KED............................................kRPSSEQDATELNLSWASVVRSVGA...FV......GIAFAM....R.........................RTPW...ES....T.........TQA........SATLALVNPVLWYLIDRTKTG.FLLSTIL.GVGGMGL...LLG.....L..KPDLI.PPstePVAST............................................MPFLNGT..GL..ESTFGA..gVT............................QES...LAVRIWVASVLFCACVCFGNIGRQLA.....................................................
G8ZPQ7_TORDC/109-265                   ..........................................................................................................................................................................................fat---SLLSIAGISYHEL.SRQL.HDNHLLhpdfa....................................srplslGV--Ei.....sNLLTGGRVPd......wGAYA.L...............EGILFGLSIPLMDHIF--.-----.-.---.............................................------NIKTPRNSVGSIIRSVNA...ML......GVTFGI....R.........................RVEW...SS....S.........LQA........AGAWGLLNIILWLLFDSTSSM.FFGCSFM.GLLACAS...C--.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------yrevsdksqf...........................................
W9X4N9_9EURO/127-335                   ............................................................................................................................................................................................l-QTMLLCGFGIGYGSI.ITHL.HKTQRI..............................................tPVPVP......dVDRSTLSYQ........MLWG.L...............FGVLLGNALPVVDSLWEN.FVSSD.A.RSVptka....................................asangVGSASSSESGLGPLWYSAVRSMGV...FV......GIAFAV....R.........................RIPW...QS....T.........LQV........ALTLALANPVLWYLIDRSLPG.LAFSAVV.SIVGTMV...LLV.....F..DPNFV.PV...PAIHQ............................................Q------..--..------...MA............................SEK...FGVYTWLASILFCTSICFGTIGRRL-q....................................................
G3Y8M7_ASPNA/123-339                   ............................................................................................................................................................................................l-KSAFLLGFGVVYGVI.TIHL.HENHWI..............................................tPVKLEn.....tHYYGSWQYL........AFWG.V...............AGAVLGNILPWFDQFSDE.IIGSP.K.QAK.............................................-GSSDPETADRTLSWVSVVRSVGA...FV......GIAFAM....R.........................RLPW...ES....T.........TQA........SLTLALVNPVLWYLIDRTRTG.FVLSTVV.GLAGMGI...ILG.....L..KPDLI.--...PSAETsa........................................faASKFDVT..GW..GYGLAV..eMS............................QES...IAVRTWVASVLFCACVCFGNIGRQLA.....................................................
E3QR22_COLGM/151-366                   ............................................................................................................................................................................................s-RAALLFLIGMGYGLM.VTRL.QNEHRFs............................................sfQ--VEs....miKPGYDWQYL........TVWG.L...............FGVALGGLLPWFDGVWED.TFGKE.E.EA-.............................................--GTSPEDTSPVKDWALVVRSIGA...FV......GIVFAI....R.........................KLPW...AS....T.........MQV........SLTLALVNPFLWYLIDRSKPG.FLLSAAV.GLAGSAM...LMG.....I..NPDIM.PT...PSSLTy..........................................rNESERAY..SD..PITLGG..lAS............................QET...IETGIWMLSVLFCSCVCFGNIGRRLA.....................................................
D4AY09_ARTBC/174-386                   ..........................................................................................................................................................................................qqs---GLLFLFGVTFGVI.IMHL.HDSPQMadll.......................................plhiPVRVEi....inFGLEWWHYL........VFWG.V...............AGVALGNLLPWFDLMWED.FMGEN.-.---.............................................-----PVKGSSEAGWNPMVRSIGA...FV......GVAFAI....R.........................KLPW...QS....S.........TQV........CLTLALVNPFLWYLIDRSKSG.FVLSTAI.GLTGMMA...LLE.....M..NPDII.FS...PSNAA............................................DA-VDET..VF..GIAGLT...LS............................QGQ...LAVGTWIASVLFCSCVCFGNIGRKLA.....................................................
A0A068YE24_ECHMU/5-181                 .............................................................................................................................................................................................FRSFILFVIGVLFYYI.FGLI.QGFRSG...............................................IFNDKfs...qcLLSTSFGIP........LCCG.L...............LSVACGLTSPRLYH----.-----.-.---.............................................---NLKIPNAYEPEWSSIMRCVIF...FM......GISHAS....A.........................KLDI...IS....I.........SQL........LLTSFCFAIGIWWIFDRSVSG.ILTGFLM.SLLGTGI...CLV.....L..GDQTI.--...-----............................................-------..--..------...-R............................SID...PLLTSWLPCIFFSGGITTSLVGRQLA.....................................................
A0A0A2LA49_PENIT/138-350               ............................................................................................................................................................................................l-SSVLLFGFGLAYGVI.TVHL.HENHWI..............................................tPVKLEn.....iHYYDSWHYL........GFWG.L...............AGIALGNLLPWLDS-WRE.GESDS.-.---.............................................KLASTEESEERTPSWVSVARSVGA...FV......GIAFAM....R.........................RLPW...ES....T.........TQA........SLTLALANPVLWYLIDRTTTG.FVLATTV.GLTGMGV...ILG.....L..KPELV.--...PTSTGps........................................fgASLLNGT..GL..ENVLGA..gIT............................QES...IAVRTWVASVIFCACVCFGNVGRQLA.....................................................
A0A0G4LTK5_9PEZI/158-275               ............................................................................................................................................................................................a-RVAVLFLLGMGYGAL.VTRL.HGKHHLa............................................alPADET......sGPGFNWKYL........TLWG.I...............CGVLLGALLPWFDGVWEE.AFGGD.T.AVVd..........................................ggRDETSDNASRSSTDWALGVRSIGA...FV......GIVFAI....R.........................RLPV...A-....-.........---........---------------------.-------.-------...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------v....................................................
M3BTQ2_SPHMS/169-399                   ............................................................................................................................................................................................g-RTTAMASVGVLYGLL.ISHL.HDHQNF..............................................aAIELN.......LDTENWSYL........TIWG.G...............IGAVLGEALPYVDRLWRS.EEDED.E.TLEe...........................................eENENNRTHNKNGQDWLNVVRSIGA...FV......GIAFAI....R.........................KLPW...QS....A.........LQL........NLTLALVNPAIWYLLDRSSTG.FILSTFV.AIIGTAL...LLV.....A..DPALV.PA...PGPKQafqeqvg.............................rhagsgimNGSLHAL..RD..ENYVLG..iFS............................LES...VGVATWIASVLFVSAVCFGNIGRRL-v....................................................
G3X2R0_SARHA/30-211                    ............................................................................................................................................................................................i-RGVVLFLIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-IAS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHQT....Q.........................KVDF...DN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATLVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
F6XME3_CALJA/86-267                    ............................................................................................................................................................................................q-RSLVLFSVGVVLALV.LNLL.QIQRNVtl..........................................fpeE---Vi....atIFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
M7NP36_PNEMU/109-303                   .............................................................................................................................................................................................LKFICLYIWGRVITIF.VFHA.QMKENIt.............................................sPYKFE.......ILTHIPHFR........TLYS.L...............GMALFGFLTPVIDSLMYK.FGFTQ.A.SK-.............................................NAYQIEIPNSKYIEIFEIMRVFST...FT......GIVYAF....V.........................KLSW...VL....D.........VKA........SLFLFFIGFSMWFIFDRAQTG.FFLSSIT.SIIFTII...LSF.....-..TSDIF.--...-----............................................-------..--..--KNED..lMR............................KEI...FGIRSWILGFFFSSCITASNIGRRLF.....................................................
C1GQD7_PARBA/168-384                   .............................................................................................................................................................................................LRAVLLFAFGVAYGTL.IMHL.HDNHRL..............................................tPMRMEn.....iTDHGSWVYM........VFWG.L...............AGVALGGLLPWFDGVWEE.FVGGE.C.GGGilkes...................................dngnlNAQGDDDKQLKVADWNSVVRSTGA...FV......GIAFAI....R.........................KLPW...QS....T.........LQV........SLTLALVNPFLWYLIDRSKPG.FMLSTAV.GLVGMVA...LLG.....I..NSDVV.PA...PGVPV............................................G------..--..ASGMQV...AS............................QES...IAVGTWIASVLFCSCVCFGNIGRRLA.....................................................
F2SGT0_TRIRC/174-386                   ..........................................................................................................................................................................................qqs---GLLFLFGVTFGVI.IMHL.HDSPQMaall.......................................plhiPVRVEi....inFGLEWWHYL........VFWG.V...............AGVALGNLLPWFDLMWED.VMGEN.-.---.............................................-----PVKGSSEAGWNPMVRSIGA...FV......GVAFAI....R.........................KLPW...QS....S.........TQV........CLTLALVNPFLWYLIDRSKSG.FVLSTAI.GLIGMMA...LLE.....M..NPDII.FS...PSNAT............................................DA-VDET..VF..GIAGLT...LS............................QGQ...LAVGTWIASVLFCSCVCFGNIGRKLA.....................................................
F7HBW1_MACMU/30-211                    ............................................................................................................................................................................................i-RGVVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-IAS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...DN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATLVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
I3MYH4_ICTTR/33-214                    ............................................................................................................................................................................................q-RSLVLFSVGVVLALV.LNLL.QIQRNVtl..........................................fpdE---Vi....atIFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
F6US40_MONDO/30-211                    ............................................................................................................................................................................................i-RGVVLFLIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-IAS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...DN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATLVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
S6EEK1_ZYGB2/82-239                    ...........................................................................................................................................................................................ss--ILVLSLAGIGYNEL.SKNL.HDNHKLhpelas...................................rplllgV---Qls...kfFTGNM---Lp.....dwAAYA.V...............EGILFGSCIPLIDHIF--.-----.-.---.............................................------SIETRPTSWVSVLKTVNA...ML......GVTFGI....R.........................KVQW...SS....S.........LQA........AIAWGLLNIILWLLFDGTVSM.FVSCSGL.GLLTCVA...CYG.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------dvtdksqll............................................
T5AFN7_OPHSC/293-412                   ...........................................................................................................................................................................................ph----------------.----.------...............................................-----.......---------........----.-...............------------------.-----.-.---.............................................------------------------...--......---LAQ....R.........................KLAW...AS....T.........LQV........SAALALVNPLLWWLIDRSKPG.FLLSACV.GLMGSML...LLS.....V..NPDMM.PA...PSRSPpms......................................ataAPNFSLS..AG..GHVLGG..lAS............................QET...METGVWMLSVLFCSCVCFGNIGRRLA.....................................................
INSI2_HUMAN/30-211                     ............................................................................................................................................................................................i-RGVVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-IAS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...DN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATVVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
X0DLJ0_FUSOX/153-370                   .............................................................................................................................................................................................LRGLLLFVLGVGYGVL.VTSRfHESDSL...............................................P---P.......RATYNWGHL........TFWG.L...............AGVALGALFPWFDRVWEN.SFGDK.G.DEAv...........................................lETSASAKDDDPSTDWALAVRAIGA...FV......GIVFAI....R.........................KVAW...AS....T.........LQV........SLTLALVNPLLWWLIDRSKPG.FLLSAAV.GLAGSVV...LLG.....V..NPDMM.PA...PTQVPfr.......................................hlvNATMAAD..GD..MPILGG..lAQ............................QKT...LETGMWMLSVLFCSCVCFGNIGRRL-t....................................................
X0JUS6_FUSOX/153-387                   .............................................................................................................................................................................................LRGLLLFVLGVGYGVL.VTSRfHESDSL...............................................P---P.......RATYNWGHL........TFWG.L...............AGVALGALFPWFDRVWEN.SFGDK.G.DEAv...........................................lETSASAKDDDPSTDWALAVRAIGA...FV......GIVFAI....Vsqptakpl........fritnilqrKVAW...AS....T.........LQV........SLTLALVNPLLWWLIDRSKPG.FLLSAAV.GLAGSVV...LLG.....V..NPDMM.PA...PTQVPfr.......................................hlvNATMAAD..GD..MPILGG..lAQ............................QKT...LETGMWMLSVLFCSCVCFGNIGRRL-t....................................................
F0UIK0_AJEC8/174-435                   .............................................................................................................................................................................................LRSALLFVFGVVYGTI.ITHL.HDNPRV..............................................tPIKIEni...dvIKRGSWVYM........VFWG.V...............AGVALGGLLPWFDVVWEE.FVEGE.S.EGEgvvvgaeeteggsgnvevsnrdlngsgdgsgvvrangngkvpvqvDREQLKDSGSIAADWNQVVRSIGA...FV......GIAFAI....R.........................KLPW...QS....T.........LQV........SLTLALVNPFLWYLIDRSKPG.FMLSTAV.GLLGMVT...LLG.....I..NPDVV.PG...PTVNA............................................AESAVAG..N-..GSGILS..fAS............................QES...IAVGTWIASVLFCSCVCFGNIGRRLA.....................................................
Q2UGK5_ASPOR/130-349                   .............................................................................................................................................................................................LKAALLFSFGIVYGII.TIHL.HENHWI..............................................tPVKLEn.....tHYYGSWEYL........GFWG.V...............AGVVLGNVLPGLDLFSED.VTVDY.A.KQP............................................sRSSNDEENEERTLSWVAAVRSVGA...FV......GVAFAM....R.........................RTPW...QS....T.........TQA........SATLALANPVLWYLIDRTRTG.FFMSTIV.GVGGMGI...VLA.....L..RPDLV.P-...PSTGAsa........................................saIPALNST..LR..DLGFGT..gIT............................QES...LAVRTWVASVLFSACVCFGNIGRQLA.....................................................
NSG1_YEAST/102-290                     ..........................................................................................................................................................................................aaf---FILFIAGILFPMI.SECL.FDNDQLakgdiv..................................sflkhgiEIKNK.......IVAEPDMVPd......wAVFG.T...............EGVIFGSIVPFIDSFVRY.-----.-.---.............................................QHQPKTRSSVYKNTLGSFIRCANT...LL......GLIFGI....R.........................KLEW...SS....S.........LQA........AGAWSLLNIVLWLFFDGTLTV.FFPGLVI.GALSAFT...CS-.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------qcfsqlslalyfidfyffgflmfsklgrylf......................
C4QV83_PICPG/77-292                    ........................................................................................................................................................................................yhlli-----IGVLGNVFIKV.SEHT.HDNRGIlpdltnfklffif.....................kniiksvahkfhfRFESN.......EIFDEYSYY........ISNA.T...............EGIILAVLPIFIER----.ALGF-.-.---.............................................-SSKNSNKSRGSNDLGLIMRASVS...LV......GICFGL....R.........................KLEW...TS....A.........FQA........SLAWSLLNPCLWLLLDGTLGG.FLTSTII.SLVSIIL...SIA.....V.gFDDTI.--...PKDYS............................................-------..--..--FIHS...HD............................TEA...YARVLWVGSFVFLASIIFGKLGRYF-f....................................................
M3ZL26_XIPMA/35-216                    ............................................................................................................................................................................................i-RGGMLFFVGVFLALV.LNLL.QVQRNVtlf.........................................ppdV-ISS.......IFSSVWWVP........PSCG.I...............ASAMIGVLYPCIDR----.-----.-.---.............................................---RLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...AN....N.........VQL........SLTLAALSIGLWWTFDRSRSG.FGLGISI.ALLATLTt.qILV.....Y..N-GVF.--...-----............................................-------..--..----QY...TN............................PDF...LYIRSWLPCIFFAGVITMGNIGRQLA.....................................................
A0A0D2WK22_CAPO3/143-366               ............................................................................................................................................................................................m-RMGTLFLCGVFFSIL.FNVL.QRQHHVtqfpgassssgggstsaaaaaaaaafsspvsqaatdqllapslqvlgSWSAA.......IMSSAWWVP........VVCG.L...............AAILVGVAFPYVDYLL--.-----.-.---.............................................-----RAPHVFKRDWSSVMRCVGV...CI......GINYAS....A.........................KLPF...ST....N.........VQL........SLMLALMAIALWWMFDRTLRG.FLMGLVV.ALGSTSAi.qLLV.....F..FGAFN.--...-----............................................-------..--..-----F...TQ............................PDF...FWVRSWIPCIFFATGVTFGCIGRQLA.....................................................
B8MK92_TALSN/135-340                   ............................................................................................................................................................................................l-KTSLLFACGVAYGTI.IAHL.HENNWI..............................................tPVKLE......yIDRNSYVYL........LSWG.V...............AGVAFAFVLPWLDNLWDN.GT---.-.---.............................................-TDRSKDVGKKQSNRTLAIRSIGA...FV......GIAFAM....R.........................RVPW...ES....T.........TQE........SLTLALVNPLLWYLIDRTQTG.FWLSTVV.ALTGMGI...TLR.....M..HPELI.--...PSSSA...........................................vGVGLRNW..RL..EYDVEG..gIS............................KDA...TAVAVWLASVFYSACVCFGNIGRQLA.....................................................
W9XLJ6_9EURO/133-349                   ............................................................................................................................................................................................l-QTVLLFAFGLGYGSI.VTHL.HKQQLI..............................................tPVPVP......dIERNSLYYQ........LSWG.V...............FGILLGNALPLVDSLWER.AGSSA.P.SGQttqnassg............................aettsvtdgSTSSPSYDSGLGPIWYSAVRSVGV...FV......GIAFAV....R.........................RIPW...QS....T.........LQV........ALTLALANPVLWYLIDRSLPG.FAFSAAV.STIGTMV...LLL.....V..DPDFV.PV...PAIHQ............................................P------..--..------...TA............................SEQ...FGVYTWLASIVFCTSICFGAIGRRL-q....................................................
A0A063C484_9HYPO/162-378               .............................................................................................................................................................................................LRGALLFALGLGYGVL.ITRL.HSEQNHt.............................................aPMRDDs....imKPGSNWKYL........NSWG.V...............AGVALGSLLPWFDTVWEG.VFGSG.T.EK-.............................................--SARNKDAAPGTDWALVMRAIGA...FV......GIVFAI....R.........................KIPW...VS....T.........LQV........SVALALVNPTLWWLIDRSKSG.FVLSAAV.GLAGSVL...LVG.....L..NPEIM.PA...PSGLP............................................AQNASGWfgSD..ARTLDG..fAH............................QQA...VETGVWILSVLFCSCVCFGNIGRRL-t....................................................
G4VHB2_SCHMA/46-224                    ............................................................................................................................................................................................y-RGLLLFFLGICFCWA.SEAL.HNIRGE...............................................FTASKis..fytETAAKFWIS........FCCG.V...............ASVTVGLFSPCVDS----.-----.-.---.............................................---KLGAYDAYNKEWSSVLRCSAL...FF......GFSHAT....A.........................RIDF...AT....Y.........SQL........SLTAIGLSIALWWVFDRSLVG.FVFGMAV.ALIATFI...FQS.....F.vWKQLY.--...-----............................................-------..--..------...-R............................FSH...PMMAAWLPCLFFSGGVVIVLVGRQLA.....................................................
N1S6D3_FUSC4/153-370                   .............................................................................................................................................................................................LRGLLLFVLGVGYGVL.VTSRfHESDSL...............................................P---P.......RATYNWGHL........TFWG.L...............AGVALGALFPWFDRVWEN.SFGDK.G.DEAv...........................................lETSASAKDDDPSTDWALAVRAIGA...FV......GIVFAI....R.........................KVAW...AS....T.........LQV........SLTLALVNPLLWWLIDRSKPG.FLLSAAV.GLAGSVV...LLG.....V..NPDMM.PA...PTQVPfr.......................................hlvNATMAAD..GD..MPILGG..lAQ............................QKT...LETGMWMLSVLFCSCVCFGNIGRRL-t....................................................
H0ZMV6_TAEGU/2-103                     ..........................................................................................................................................................................................amc----------------.----.------...............................................-----.......---------........----.-...............------------------.-----.-.---.............................................----------------------GS...LC......GINHAS....A.........................KVDF...AN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATLVs.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
C4Y5U1_CLAL4/96-302                    ............................................................................................................................................................................................f-RVATVSTAALVYNEV.TKHI.HASNLNdigt......................................qinayLVTFM.......ENWKPIRYLanvdhpadAFFS.La.............sEGLILSSILPLLDNVMPG.SFSKR.L.L--.............................................--SSSPDPYYRSNLMNDIVRSSIA...FL......GVSYAI....R.........................HIEW...KS....S.........LQM........AMTWSLINPCLWLLLDGTISG.FIASTGT.AFGGSAI...VYY.....Q..-NGVK.--...-----............................................-------..--..---FST...DK............................DTD...LIILLFIASFFFCGVIIFGKLGRLLF.....................................................
A0A067H4W0_CITSI/61-249                ...........................................................................................................................................................................................is---LALFSAGFFLGPA.IDGL.HSRVNL...............................................VVYENgsi.nvgPLHTNIWVP........PLLG.L...............FYCTVGLLQLFLDD----.-TDSD.R.ASS.............................................ESEVPDDGSLQKTVFA--LITLLL...FI......ELSAEL....Y.........................KAGV...GD....N.........IEA........YI-LFAVAELIWFSLDRTWLG.FTLASII.GLVCPL-...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------aeipimklfhlwyypkanieilgqglvawtitcyfvytpflin..........
A0A0D2LYV2_GOSRA/48-205                ...........................................................................................................................................................................................is---LSLFGCGFILGPL.IDGL.HSRVDL...............................................VVYQNgai.nigPLHTNKWVP........PLLG.L...............FYTTVGLLQIYLDE----.-----.-.---.............................................----KNSSNVPQGSLEKAVRSLIAlvlFI......ELSSEM....Y.........................KNGV...PD....N.........IEA........YI-LFAAAEVLWYSLDRTRLG.FTLASVI.GICCP--...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------laeiplmkffhlwyypqani.................................
F4NY11_BATDJ/58-266                    ............................................................................................................................................................................................s-RLIVLFAFGSVLSLL.VDSL.QRSHHItrwpqssrsdglg.....................sissvfeyaflmaS---AwrggsgsLFSTAGWVP........LSCG.L...............SACLMGTLYPLLDQWL--.-----.-.---.............................................--LSRQQVLGVRRDWSSALRCCGG...FI......GISYAA....S.........................KLTL...AS....S.........IHM........SVTLALLALGLWYLFDRTIHG.FVVSFIG.AAIGTLV...VSM.....L.vQNGVY.--...-----............................................-------..--..-----S..fTQ............................ADL...FGVRSWVPCILYTACICIGSIGRLL-.....................................................
H0XST0_OTOGA/78-262                    ............................................................................................................................................................................................q-RSLVLFLVGVVLALV.LNLL.QIQRNVtl..........................................fpeE---Vi....atVFSSAWWVP........PCCG.T...............AAAVVGVLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....Av......................slKLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
A0A059A7Q1_EUCGR/59-218                ...........................................................................................................................................................................................ls---LSLFGSGFFLGTL.IDGL.HSRVNL...............................................VVYENgsi.dlgPLHTNIWVP........PLLG.L...............FYCTVGLLQLYLDE----.-----.-.--R.............................................TSSKGSSQGSLEKTVASLIALVG-...FI......ELSAEL....Y.........................KAGV...AA....N.........IEA........YI-LFAMAELMWLLLDRSWFG.FALACVV.GLACPLA...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------eiplmkffnlwyypqanve..................................
F2U6C6_SALR5/4-178                     ............................................................................................................................................................................................l-SWLVLFGCGYVTAAV.LYLL.HMEHSV...............................................LIIR-.......PTISTNALF........VAAG.L...............TTLFIGLLFPAVDKFF--.-----.-.---.............................................------NNKPRPQAWSLVLRSILA...LI......GVAIAA....V.........................RFPS...QR....S.........HEL........NISLLIMASSMWWLVDGTAVG.LGTAVAV.TSFGITAs.qYLS.....-..YLGVL.--...-----............................................-------..--..-----E..wAQ............................PDF...FYVQATLIPILFLATMSFGLLGRQLA.....................................................
G2YX13_BOTF4/111-338                   .............................................................................................................................................................................................FRSVLLFGLGLLYGLL.VKHL.HDDRHL..............................................aPLQVEt....iiKPSHDWKYL........VFWG.I...............AGVGLGSVLPLVDKFWEE.RVQLP.F.ESStct......................................pseeAIDVSNSQGVLGGDWILAVRSVGA...FV......GIAYAI....R.........................KLPW...AS....D.........MQA........SLALALVNPVLWYLIDRSKPG.LAFSAAV.GATGSVL...LLA.....S..NSDLM.PS...PAASMkn.......................................ntvSHQPADY..-S..EAESEK..lVT............................RGN...LEAGIWIASVLFCSCVCFGNIGRRLA.....................................................
G1KKP8_ANOCA/71-252                    ............................................................................................................................................................................................q-RSLVLFTVGTFLALV.LNLL.QIQRNVtl..........................................fpeE---Vi....dtIFSSAWWVP........PCCG.T...............AAAVIGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........IQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFVATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
A0A0L0NY62_9ASCO/99-306                ............................................................................................................................................trlaivafaaflynqvtrnihiahvdgtgllineylenfveawrlyqaw----------------.----.------...............................................-----.......VKEYDLEFVd.....raVAWS.L...............EGFLLSIFVPVLDKLLPQ.F-SRR.L.---.............................................-LSSNPNPYHRGNLPNDLIRSLIT...FL......GITYAI....R.........................HIEW...SS....L.........LQM........AMTWSLVNPALWLLLDGTING.FLASTTV.AFVASAI...IYF.....Q..NHNVI.--...-----............................................-------..--..-----V...LD............................QSS..lITIFLYVGSFFFCGVIIFGKLGRFLF.....................................................
S0E992_GIBF5/153-370                   .............................................................................................................................................................................................LRGLLLFVLGLGYGVL.VTSRfHESDSL...............................................P---S.......RATYNWGHL........TFWG.L...............AGVALGALFPWFDRVWEN.SFGDN.G.DEAv...........................................lENSASAKDDDPSTDWALAVRAIGA...FV......GIVFAI....R.........................KVAW...AS....T.........LQV........SLTLALVNPLLWWLIDRSKPG.FLLSAAV.GLAGSIV...LLG.....V..NPDMM.PA...PTQVPfr.......................................hlvNATMAGD..GD..MPILGG..lAQ............................QKT...LETGMWMLSVLFCSCVCFGNIGRRL-t....................................................
H2QVN6_PANTR/86-267                    ............................................................................................................................................................................................q-RSLVLFSVGVVLALV.LNLL.QIQRNVtl..........................................fpeE---Vi....atIFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
A0A074XHQ6_AURPU/143-375               ...........................................................................................................................................................................................gk--NVVLGLAGIAYGQL.IAHL.HDRQTL..............................................vPVQVE......gMPSESWAYI........AYWC.F...............SGIALGQALPWVDAIWMS.DGSGE.H.EAEreyrt..................................sgnlrsAQDSQNRSQTWTPGWNEIVRFIGA...AV......GIVFAI....R.........................RLPW...QS....P.........LQL........SLTLALANPAIWYLLDRTGPC.FILATTV.ALSGTGL...LLS.....I..NPELI.PS...PHAANlhtf....................................snvaNATANAI..KG..QDLVLG..tFT............................LES...VGVATWIASVLFVSAVAFGNIGRRL-.....................................................
C4JUE9_UNCRE/81-309                    ............................................................................................................................................................................................r-KSVFLFLFGMAYGGI.ITHL.HGHPKVag...........................................rvPVNMDn....idLDQRSLGYL........GLWG.L...............AGVALGSLQPWFDLFWGD.NLIVG.R.SQ-.............................................-ATERRSKGSGLLEWSPMVRSIGA...FV......GIAFAI....R.........................KLPW...QS....T.........LQV........SLTLALVNPVLWYLIDRSKPG.FVLSTVV.GLTGMLA...LLG.....I..NPTIV.PS...PATAQpssssa................................avspgtLLNSSTL..LQ..TAKVIG...VT............................QES...LAVGTWIASVLFCSCVCFGNIGRRLA.....................................................
G2R9T8_THITE/190-458                   .............................................................................................................................................................................................LRAGLLFVLGVGYGVL.VTRL.PQQHGR...............................................RLAAY.......ESPYEWRYL........AFWG.A...............AGVALGSLLPWFDRFWEE.STASR.Q.RGGgapatrkdvavp....................gpragliegveapVTEKPSAAAAPRADWALVVRGVGA...FV......GIVFAI....R.........................KLPW...AS....T.........MQV........SLTLALANPFLWYLIDRSKPG.FLLSAAV.GLAGSVV...LMG.....L..NPDVM.PA...PTANAhltaaasssslgata.............andtasgdsggaawggGNGNAAA..AA..ATSLWG..lAS............................QET...IETGIWMLSVLFCSCVCFGNIGRRLA.....................................................
R1GGX4_BOTPV/251-330                   ............................................................................................................................................................................................h----------------.----.------...............................................-----.......---------........----.-...............------------------.-----.-.---.............................................------------------------...--......---IAP....R.........................KLQW...QS....T.........LQI........SLTLALVNPALWYLLDRSKPG.FTLSMLV.GLTGTAV...LLLlg.qhA.dSVAFI.PS...P----............................................-------..--..------...--............................---...--------------------------pivggsgpnssir........................................
Q7SBU0_NEUCR/220-500                   .............................................................................................................................................................................................LRTTLLFALGAGYGVL.VTRL.PNGDSV...............................................-----.......TGGYGWRYL........TFWG.A...............AGVVLGRLLPWFDQVWEE.AFGKR.T.RMTkkekerrraaaaaeaaaallqqappsssrtfprktpvtttlpvetDSNSGGVTSPPEADWPLVVRSIGA...FV......GIVFAI....R.........................RLPW...AS....T.........MQV........SITLALANPFLWYLIDRSKPG.FLLSAAV.GVTGSAI...LMG.....L.gNPDMM.PA...PVAGAgyhdhhflttsgq.................pamdvlngttsglpRSAAAAR..MS..GMGGAS..sEN............................A-A..vIETGIWMLSVLFCSCVCFGNIGRRLA.....................................................
G3QHP4_GORGO/86-267                    ............................................................................................................................................................................................q-RSLVLFSVGVVLALV.LNLL.QIQRNVtl..........................................fpeE---Vi....atIFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
F5H6P3_HUMAN/21-115                    .........................................................................................................................................................................................gppr----------------.----.------...............................................-----.......---------........----.-...............------------------.-----.-.---.............................................------------------------...--......----AS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
X0CM28_FUSOX/153-387                   .............................................................................................................................................................................................LRGLLLFVLGVGYGVL.VTSRfHESDSL...............................................P---P.......RATYNWGHL........TFWG.L...............AGVALGALFPWFDRVWEN.SFGDK.G.DEAv...........................................lETSASAKDDDPSTDWALAVRAIGA...FV......GIVFAI....Vsqptakpl........fritnilqrKVAW...AS....T.........LQV........SLTLALVNPLLWWLIDRSKPG.FLLSAAV.GLAGSVV...LLG.....V..NPDMM.PA...PTQVPfr.......................................hlvNATMAAD..GD..MPILGG..lAQ............................QKT...LETGMWMLSVLFCSCVCFGNIGRRL-t....................................................
L5L606_PTEAL/80-261                    ............................................................................................................................................................................................q-RGLVLFSVGVGLALV.LNLL.QVQRNVtl..........................................fpeEVTAT.......AFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCVAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
A0A061DRL3_THECC/48-206                ...........................................................................................................................................................................................is---LSLFGSGFVLGPL.IDGL.HSRVDL...............................................VVYQSgai.nigPLHTNIWVP........PLLG.L...............FYCTVGLLQLFLDEKA--.-----.-.---.............................................-SSEVPEGTLEKAG--GSLIALVL...FI......ELSAEM....Y.........................KNGV...AD....N.........IEA........YIL-FAAAELLWFSLDRTRLG.FTLASII.GICCP--...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------laeiplmkffhlwyypqayve................................
B7QLN0_IXOSC/10-191                    ............................................................................................................................................................................................w-RVAFLFLVGVFFSLM.LDFF.QIQYRLsaf.........................................ernL---Ig....smFMSSPWWVP........AICG.T...............AAVSVGLLYPCVDH----.-----.-.---.............................................----KLGEETIPHRWSDVMKCIAL...FV......GINQAS....A.........................KIEL...QS....D.........WQP........SLSLVLLSVSLWWLCDRTHSG.FGLSILT.ALIATLVa.hFLV.....Y.yRIGRC.--...-----............................................-------..--..------...SD............................KDL...TFVRSWLPCVFFSGGITVGNIGRLLA.....................................................
W5LQT0_ASTMX/31-212                    ............................................................................................................................................................................................i-RGAMLFGVGVFLALV.LNLL.QVQRNVtlf.........................................ppdV-ISS.......IFSSAWWVP........PCCG.T...............ASALIGLLYPCIDR----.-----.-.---.............................................---RLGEPHKLKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...AN....N.........VQL........SLTLAALSVGLWWTFDRSRSG.FGLGVAI.ALLATLAt.qLLV.....Y..NGVFQ.--...-----............................................-------..--..-----Y...TS............................PDF...LYIRSWLPCIFFAGVITMGNIGRQLA.....................................................
W9Y8B8_9EURO/134-351                   ............................................................................................................................................................................................l-QTVLLFAFGIAYGSV.VTHL.HKRQLI..............................................tPVPVP......nVERDSLYYQ........LSWG.V...............FGILLGNALPLVDSLWEK.AGSSV.V.SGEqttqatqlg...........................peiaaategPTSSPSSDSGLGPIWYSAVRSIGV...FV......GIAFAV....R.........................RLPW...QS....T.........LQV........ALTLALANPVLWYLIDRSLSG.FAFSAAV.STIGTMV...LLL.....V..DPSFV.PL...PAIHQ............................................P------..--..------...TA............................SQQ...FGVYTWLASILFCTSICFGAIGRRL-q....................................................
F7H2Z8_MACMU/1-130                     ............................................................................................................................................................................................a----------------.----.------...............................................-----.......---------........----.-...............---VVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
INSI1_RAT/68-249                       ............................................................................................................................................................................................q-RSLVLFSFGVVLALV.LNLL.QIQRNVtl..........................................fpdE---Vi....atIFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
G3U9S8_LOXAF/8-189                     ............................................................................................................................................................................................q-RSLVLFSVGVVLALV.LNLL.QIQRNVtl..........................................fpdE---Vi....atIFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
H3D5G0_TETNG/60-241                    ............................................................................................................................................................................................r-RGLVLFTVGASLALV.LNLL.QIQRKVtl..........................................fpeE---Vi....ttLFSSTWWIP........PCCG.T...............GAAVVGLLYPCLDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....V.........................KLNF...DN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.FGLGITT.AFLATVFv.qLLV.....Y..-NGVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFSGGVTVGNIGRQLA.....................................................
W5N440_LEPOC/60-241                    ............................................................................................................................................................................................r-RGLVLFTVGVFLALV.LNLL.QVQRNVtl..........................................fpeE---Vl....atLFSSAWWVP........LCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.FGLGITI.AFLATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
INSI2_RAT/30-211                       ............................................................................................................................................................................................i-RGVVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-ITS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...DN....N.........FQF........SLTLAALSVGLWWTFDRSRSG.FGLGVGI.AFLATVVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
A0A0D9RVF8_CHLSB/30-211                ............................................................................................................................................................................................i-RGVVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-IAS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...DN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATLVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
E4ZG61_LEPMJ/204-433                   ............................................................................................................................................................................................t-KLAALYLFGATYGLI.VSQL.HETRPL..............................................aAVHVE......gVDRRSRFYL........PSWG.L...............FGLVLGSLLPYVDLFWDS.RRPES.D.RK-.............................................GKEADKHESPISEQVNDVVRSVAA...FV......GIAFAI....R.........................RLPW...QS....T.........LQL........TLTLALVNPALWYILDRSKPG.LSFSLIVtSVLTSFI...FLS.....-..NPNAL.PS...PPLPSstnitqlp............................psqsghasGSPTSTS..PP..GELFAG..vVS............................YEN...LAVVTWVGSVLFCSCVCFGNIGRRL-g....................................................
Q0UXK1_PHANO/188-411                   ............................................................................................................................................................................................g-KLAALFLFGVIYGLI.VSHL.HDTRQL..............................................tAVHIE......gINHENWIYL........ISWG.F...............FGVALGSLLPYVDVAWGG.HDIEE.H.TEE.............................................EESDKDGQSPMSEQINDVVRSVAA...FV......GIAFAI....R.........................RLPW...QS....T.........LQL........TLTLALVNPALWYILDRSKPG.LSCSLIVtSILTSCI...FLS.....-..NPEVL.PS...PSLPVmnna...................................tqlptSKATTGQ..MK..NDFFAG..vVS............................YDN...LAVVTWVGSVLFCSCVCFGSIGRRLA.....................................................
G2QCW9_MYCTT/184-468                   .............................................................................................................................................................................................LRAALLFVLGVGYGVL.VTRL.PQNSHHqhh........................................psrrL---Aa....ayESHCEWRYL........VFWG.V...............AGVALGSLLPWFDRFWEE.RAQPS.S.SSSsssssssssssssfs..............cpssmaraehadadapVTSKPSLTSPPQTDWALVIRGIGA...FV......GIVFAI....R.........................RLPW...AS....T.........MQV........SLTLALANPFLWYLIDRSKPG.FLLSAAV.GLGGAAL...LMG.....L..DPEVM.PA...PTAAAaaggggwaaavrdrlrg..........ggginadnttapggavpDGAGRDA..AG..GVLLGG..lAS............................RET...IETGIWMLSVLFCSCVCFGNIGRRLA.....................................................
A0A0J9WP47_FUSO4/153-387               .............................................................................................................................................................................................LRGLLLFVLGVGYGVL.VTSRfHESDSL...............................................P---P.......RATYNWGHL........TFWG.L...............AGVALGALFPWFDRVWEN.SFGDK.G.DEAv...........................................lETSASAKDDDPSTDWALAVRAIGA...FV......GIVFAI....Vsqptakpl........fritnilqrKVAW...AS....T.........LQV........SLTLALVNPLLWWLIDRSKPG.FLLSAAV.GLAGSVV...LLG.....V..NPDMM.PA...PTQVPfr.......................................hlvNATMAAD..GD..MPILGG..lAQ............................QKT...LETGMWMLSVLFCSCVCFGNIGRRL-t....................................................
M3XID4_LATCH/60-241                    ............................................................................................................................................................................................r-RGVVLFLVGAFFALV.LNLL.QIQRHVal..........................................fpeEVVSS.......LFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.FGLGITI.AILATLIt.qLLV.....Y..N-GIY.--...-----............................................-------..--..----QY...TS............................PDF...IYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
V7BHX8_PHAVU/55-216                    ..........................................................................................................................................................................................isl----KLFGTGFLLGPL.LDGL.HSRVNLl............................................vyD---Sgai.higPLHTNIWVP........FLLG.L...............FYSSVGLLQLYLDQKLFN.-----.-.---.............................................---KVQEASLPKTIVSFI--LLAL...FI......EVSAEL....Y.........................KGGI...AD....N.........VEA........YILFAGA-EFMWFFLDRTWLG.FTLACIV.GLACPLA...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------evpimkffhlwyypkpnieifg...............................
G1T648_RABIT/87-271                    ............................................................................................................................................................................................q-RSLVLFLVGVVLALV.LNLL.QIQRNVtl..........................................fpeE---Vi....atIFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....Ah......................hqKLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITV.AFLATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
G3NIC8_GASAC/60-241                    ............................................................................................................................................................................................r-RGLVLFTVGAFLALV.LNLL.QIQRHVtl..........................................fpeEV--Ma.....tLFSSAWWIP........PCCG.T...............GAAVVGLLYPCLDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....V.........................KLDF...DN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.FGLGITT.AVLATVFt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFSGGVTVGNIGRQLA.....................................................
C0NAF6_AJECG/174-435                   .............................................................................................................................................................................................LRSALLFVFGVVYGTI.ITHL.HDNPRV..............................................tPIKIEni...dvIKRGSWVYM........VFWG.V...............AGVALGGLLPWFDVVWEE.FVEGE.S.EGEgvvvggeetegssgnvevsnrdlngsgdgsgvvrangngkvpvqvDREQLKDSGSIAADWNQVVRSIGA...FV......GIAFAI....R.........................KLPW...QS....T.........LQV........SLTLALVNPFLWYLIDRSKPG.FMLSTAV.GLLGMVT...LLG.....I..NPDVV.PG...PTVNA............................................AESAVAG..N-..GSGILS..fAS............................QES...IAVGTWIASVLFCSCVCFGNIGRRLA.....................................................
B2WFT2_PYRTR/189-396                   ............................................................................................................................................................................................g-KLAALYAFGVIYGII.VSHL.HETRQL..............................................aPVHVD......gVGRESRTYL........ASWG.L...............FGVALGSLLPYVDLVWDV.QKRAS.Q.TD-.............................................EKEVETHDSPISEQINDVVRSVAA...FL......GIAFAI....-.........................----...-S....T.........LQL........TLTLALVNPALWYILDRSKPG.LSVSLTVtSILTSFI...FLS.....-..NPNVL.PS...PSLPPttnatqvps..........................msdsthmqgRPSTVAP..MG..QEFFAG..mIS............................YES...LAVVTW--------------------sg...................................................
L5LQ78_MYODS/86-267                    ............................................................................................................................................................................................e-RSLVLFSVGVVLALV.LNLL.QVQRNVtl..........................................fpeE---Vi....atIFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCVAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
G9NND2_HYPAI/172-401                   ............................................................................................................................................................................................s-RAVVLFVLGAGYGVL.VTHL.HQEPQLl............................................qlT---Eas...saVPRYNGSYL........ALWG.Fg.............lTGVALGALQPWFDGLWDG.LFGAD.E.QAVve........................................paePLSDTTKATASETDWALVVRAVGV...FV......GVAFAV....R.........................RLAW...SS....S.........MQL........SVAVALASFVLWWLIDRSVSA.LILSAGV.GLAGSVL...VWG.....V..NPDMI.PA...PAAQNiss......................................ngiPSMASYT..DL..TTALNS..iAS............................HET...IEASIWIVSVLFCTCLCFGNIGRRLA.....................................................
B3RT72_TRIAD/16-202                    ...........................................................................................................................................................................................ri--VIALFFIGVIFALV.LNVL.QVQRNVaaf........................................srdvL---Sgla.lfgLSMSTWWML........PSYG.T...............GAVLIGLAFPCADH----.-----.-.---.............................................---HLGESPKIKNEWTSIMRCTAL...WI......GINHAA....A.........................TLNF...ST....P.........AQL........TFWVSAMSLCLWWLYDRTRTG.LFLAMLS.AVVATGF..nQIL.....V..SNGVF.--...-----............................................-------..--..-----S..yNE............................PDL...LSVKSWLPSIYFSGGLTIGNIGRQL-v....................................................
N4VFS0_COLOR/156-377                   ............................................................................................................................................................................................s-RVALLFIIGMGYGVM.VTRL.QNQHRFp............................................sfQ--VDa....atSPGYEWHYL........SLWG.L...............SGVVLGNLLPWFDGVWED.KFGKE.E.QQAp..........................................agRGSPVPEDVSPVKDWALVVRSIGA...FV......GIVFAI....R.........................KLPW...AS....T.........LQV........SLTLALVNPFLWYLIDRSKPG.FLLSTVV.GLTGSAI...LLG.....T..NPDVM.PT...PSSLTy..........................................rNGSNKAY..AE..PSALDG..fAS............................QEV...FETGIWMLSVLFCSCVCFGNIGRRLA.....................................................
A6R3L5_AJECN/8-163                     .............................................................................................................................................................................sgvvrangngkvpvqv----------------.----.------...............................................-----.......---------........----.-...............------------------.-----.-.---.............................................DREQLKDSGSIAADWNQVVRSIGA...FV......GIAFAI....R.........................KLPW...QS....T.........LQV........SLTLALVNPFLWYLIDRSKPG.FMLSTAV.GLLGMVT...LLG.....I..NPDVV.QG...LTVNA............................................-AESAAA..GN..GSGILS..fAS............................QES...IAVGTWIASVLFCSCVCFGNIGRRLA.....................................................
A0A0G4LTK5_9PEZI/273-489               ............................................................................................................................................................................................v---AVLFLLGMGYGAL.VTRL.HGKHQLa............................................alPA--Eg....tsGPGFNWKYL........TLWG.I...............CGVLLGALLPWFDGVWEE.AFGGD.T.AVVd..........................................ggRDETLDNANRSSTDWALGVRSIGA...FV......GIVFAI....R.........................RLPW...AS....T.........LQL........SLTLALVNPFLWYLIDRSKPG.FLLSAAV.GLIGSAV...LMG.....V..DPEMV.PT...PSASS............................................-FRNETL..SD..SLTFGG..lAS............................QKT...METGIWMLSVLFCSCVCFGNIGRRLA.....................................................
INSI2_PIG/30-211                       ............................................................................................................................................................................................i-RGVVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-IAS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...DN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATLVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
U3J911_ANAPL/1-90                      ............................................................................................................................................................................................t----------------.----.------...............................................-----.......---------........----.-...............------------------.-----.-.---.............................................------------------------...--......------....Q.........................KVDF...AN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATLVs.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
L0PAN2_PNEJ8/106-270                   ............................................................................................................................................................................................a-KLTVLYVWGYSIAVF.VFHT.QTKQKA...............................................TSTCNf.....qILTHVPHFQ........VFYG.L...............GTVLFGLLIPITDSITLK.LRCTP.I.SK-.............................................SVSHTESQKSRCMEISETIRVFTT...SM......GIVYAF....A.........................KLSW...VL....D.........VKT........PLFLVFVGFFMWFIFDRAQTG.LFLSSIM.SVLFTIV...ILS.....F..PSDIF.--...-----............................................-------..--..------...--............................---...--------------------------rfsff................................................
C1N570_MICPC/177-400                   ..................................................................................................................................................................aarvsdhaipnekiasllelvfaretg----------------.----.------...............................................-----.......ALESAWWVP........LLFG.G...............AGVVIGLGHTTLDGIRLT.RAAKE.D.E-Rfiaaassttkngp..................dgdaafaeekrafaRRCPGAPRTSFEPSWPVVFAAISV...FA......TQYAAS....Gvltt................ttppiPFPD...LP....S.........RAA........DAILFLWGLGAWAAFDNTKQG.FAMATLT.AVAGPAT...EIV.....L..INAFH.--...-----............................................-------..--..---LYA..yTS............................PDF...FGIPAWIPWVYFCGSPAVGLL-----srav.................................................
U3ITA8_ANAPL/30-123                    ............................................................................................................................................................................................i-RGIVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-ITS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCMDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....-.........................----...--....-.........---........---------------------.-------.-------...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------a....................................................
W1P6T2_AMBTC/54-254                    ...........................................................................................................................................................................................is---LSLFGSGFILGPL.IDGI.HSRVQL...............................................VVYQNgai.qigPLYTNLWVP........LLLG.V...............FYCTVGLLQLFLDERV--.-----.-.--S.............................................SNSNDTQGSLPKTALSL--ILLAS...FI......EMSAEM....Y.........................KAGL...PS....S.........TET........YI-LFAVAELIWFFFDGTWLG.FTLACIV.GFGCPLAeipIMK.....L.wNLWYY.PH...P----............................................-------..--..------...--............................---...--------------------------dinvfgeglvswtstcyfvytpflinlsrwlnssssltikemt..........
S9WZ57_SCHCR/102-288                   ............................................................................................................................................................................................f-KFLAIFGLGAIFTYM.AEGI.VQEAKL...............................................SLLT-.......VRYGNWVFKpn....wsVTFG.L...............VAIGLAVSYRLMDVRY--.-----.-.---.............................................PSGSSGTKTSNSSQFQVFSRYLAA...FA......TLLLTM....K.........................RLLS...TQ....S.........THS........FAALIASAITIWYVFDRSKNG.FTVSCVM.SIVGSIT...YYV.....F.vDSAPF.--...--S--............................................-------..--..---LFE...TN............................PPE...YQFRYWIPMILFSASTIVGNAGRLLF.....................................................
A0A022RFC5_ERYGU/72-230                ...........................................................................................................................................................................................vs---LSLFGCGFFIGPL.IDGL.HSRVNL...............................................VVYQNgai.digPLHTNIWVP........PLLG.V...............FYCSFGLLQLLLDEILSP.-----.-.---.............................................----AAPPQRSPDRLAASFIALVV...FI......ELSAEL....Y.........................KAGV...AD....N.........IEA........YILFAGAE-LVWLLLDKTRLG.FAIACLV.GLCC---...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------plaeipimklyhlwyypeanv................................
A0A091EDK5_FUKDA/30-211                ............................................................................................................................................................................................i-RGVVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-IAS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...DN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATVVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
F1NHV3_CHICK/1-131                     ............................................................................................................................................................................................a----------------.----.------...............................................-----.......---------........----.-...............--AVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFVATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
A0A0F8CP01_CERFI/92-215                .............................................................................................................................................................................................LRIAILFVLGAAYGNM.VSGR.NSTRTS...............................................-NSLP.......RQILDWEYL........MVWG.C...............IGIACGVLFRCADAVWDL.IFREA.E.DEPmpse.....................................ikthGHLSQTASPDTLKEWALVVRSIAA...FV......GIVFAI....V.........................SLS-...--....-.........---........---------------------.-------.-------...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------simligtsr............................................
J9P0Z4_CANLF/30-211                    ............................................................................................................................................................................................i-RGVVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-IAS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...DN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATLVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
A0A0B0MY15_GOSAR/48-206                ...........................................................................................................................................................................................is---LSLFGCGFILGPL.IDGL.HSRVDL...............................................VVYQNgai.nigPLHTNKWVA........PLLG.L...............FYTTVGLLQIYLDE----.-----.-.---.............................................KNSSDVPQGSLEKAVGSLIA-LVL...FI......ELSSEM....Y.........................KNGV...PD....N.........VEA........YI-LFAAAEVLWYSLDRTRLG.FTLASVI.GICCP--...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------laeiplmkffhlwyypqanid................................
W9CGH4_9HELO/111-338                   .............................................................................................................................................................................................FRSILLFGLGLLYGLL.VRHL.HDDRHL..............................................aPLQVEs....iiKPSHDWRYL........VFWG.I...............AGVGLGSLLPLVDKLWEE.KMRSP.F.GNYiga......................................sseeAIDASDSQGILGGDWILAVRSVGA...FV......GIAFAI....R.........................KLPW...AS....D.........MQA........SLTLALVNPVLWYLIDRSKPG.LAFSAAV.GATGSAL...LLA.....S..NSDLL.PS...PAASIkn........................................stVSHQSVD..YS..ESGSED..lAT............................RGN...LEAGIWIASVLFCSCVCFGNIGRRLA.....................................................
G8B781_CANPC/108-326                   ........................................................................................................................lklvilatsayiynqiirhinynhfnenqlvnypltithiflyafvskfklgnyidihddlliagdeil----------------.----.------...............................................-----.......---------........-ALT.L...............QGLLMASLHPILDKLLPK.FFSKR.L.LS-.............................................---SNPNPSSKSNVSSDLIRSGIT...FL......GISYAI....R.........................KIEW...SS....F.........LQV........SIIWSLINPGLWLLLDGTISG.FLASLVA.STVACVS...IYS.....S..NHQFI.--...-----............................................N------..--..---GYS..kTT............................DDV...IALWLWVGSFFFCGIIIFGKLGRGLF.....................................................
G1NIA2_MELGA/48-152                    .....................................................................................................................................................................................qcnavcss----------------.----.------...............................................-----.......---------........----.-...............------------------.-----.-.---.............................................------------------------...LC......GINHAS....A.........................KVDF...AN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATLVs.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
G3N9G9_GASAC/16-197                    ............................................................................................................................................................................................i-RGAMLFSVGVFLALV.LNLL.QVQRNVtlf.........................................ppdV-ISS.......IFSSAWWVP........PCCG.T...............ASALIGLLYPCIDS----.-----.-.---.............................................---RLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...AN....N.........VQL........SLTLAALSVGLWWTFDRSRSG.FGLGVSI.ALLATLAt.qLLV.....Y..NGVFQ.--...-----............................................-------..--..-----Y...TS............................PDF...LYIRSWLPCIFFAGVITMGNIGRQLA.....................................................
G0SFN6_CHATD/205-510                   .............................................................................................................................................................................................VRAMLLFALGVGYGVL.VTRL.PGDPARklqllqvve............................eglkeeiqgaT---Ang..cssKVAGGWWYL........MIWG.I...............AGVALGSFLPWFDRIWEE.TIATR.V.RNAgnekptkrqtrqqrqrqrras..algmqelpnvpssvtnntanseATSAGSRAAASQADWPLIMRGIGA...FV......GIVFAI....R.........................KLPW...TS....T.........MQV........SLTLALANPFLWYLIDRSKPG.FFFSAAV.GLAGSAVl.kLMG.....L..DPGMM.PV...PIMHGrts......................................plaSSIPTEQ..QQ..HMALQG..nVSgandvngger.......talvwgewgwsQES...VEASIWMLSVLFCSCVCFGNIGRRLA.....................................................
T0JUU4_COLGC/148-368                   .............................................................................................................................................................................................FRIALLFIIGMGYGVM.VTRL.QNEHRF..............................................sSFQVEs....iiKPSYNWQYL........SLWG.L...............SGVVLGGLLPWFDGVWEE.TFGKE.E.EIAe...........................................eRESPSSEDASPVKDWALVVRSIGA...FV......GIVFAI....R.........................KLPW...AS....T.........LQV........SLSLALVNPFLWYLIDRSKPG.FLLSMAV.GVTGSAV...LLG.....I..NPDVM.PT...PSSLTy..........................................rNESERAY..AE..PMTLGG..lAS............................QET...IETGIWMLSVLFCSCVCFGNIGRRLA.....................................................
M3WAK3_FELCA/30-211                    ............................................................................................................................................................................................i-RGVVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-IAS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...DN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATLVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
A0A0B2X667_9HYPO/164-380               .............................................................................................................................................................................................FRGTLLFLLGLGYGAL.VTRL.HNEQSHl.............................................pPIPDDs....ilKPGNNWRYL........AFWG.V...............AGVGLGSLLPWFDRLWDN.IFGSE.G.DNV.............................................---VDDSRAGPGTDWALVVRAIGA...FV......GIIFAI....R.........................KLSW...AS....T.........LQV........SATLALVNPLLWWLIDRSKPG.FVLSAAV.GLTGSIL...FLR.....V..DPEIM.PA...PLGLSp..........................................rNFSNVFE..GD..PFTLGG..lAT............................RKT...VETGVWMLSVLFCSCLCFGNIGRRL-t....................................................
A0A0P7UU87_9TELE/54-146                ............................................................................................................................................................................................r-RGLVLFAVGVLLALV.LNLL.QVQRNVtlf.........................................pdqV-VAT.......LFSSAWWVP........LCCG.S...............AAAVVGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHA-....-.........................----...--....-.........---........---------------------.-------.-------...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------s....................................................
W1QBN7_OGAPD/97-291                    ..............................................................................................................gkslvlcvlgnlfiklieqlyklnpalpnladfrliylvrdnanlplspvqmeilnnslmgllfgsirplselvftwng----------------.----.------...............................................-----.......---------........----.-...............------------------.-----.-.---.............................................-------KKRSFPETAALVRFTVA...LI......GFSYGL....R.........................KVEW...ES....K.........LEA........SLVFLGICALLWIVMDSSIGG.LLSSFIV.SLGTIAV...YTYf...tF..QQNLL.--...-----............................................-------..--..----SV..fSD............................PDI...LADLLWNGSFLFISLVIFGRISKRL-i....................................................
E4UVZ6_ARTGP/177-390                   ..........................................................................................................................................................................................qqs---GLLFLFGVTFGVI.IMHL.HDSPQMaall.......................................plhiPVRVEa....inFGLEWWHYL........VFWG.V...............AGVALGNLLPWFDLMWED.FMGEK.-.---.............................................----PVQKGSSEAGWNPMVRSIGA...FV......GVAFAI....R.........................KLPW...QS....S.........TQV........CLTLALVNPFLWYLIDRSKSG.FVLSTAI.GLTGMMA...LLE.....M..NPGIV.FS...PSDAS............................................D-ALNDT..AF..GIAGLT...LS............................QGQ...LAVGTWIASVLFCSCVCFGNIGRKLA.....................................................
C6H4X0_AJECH/174-435                   .............................................................................................................................................................................................LRSALLFVFGVVYGTI.ITHL.HDNPRV..............................................tPIKIEni...dvIKRGSWVYM........VFWG.V...............AGVALGGLLPWFDVVWEE.FVEGE.S.EGEgvvvgaeeteggsgnvevsnrdlngsgdgsgvvrangngkvpvqvDREQLKDSGSIAADWNQVVRSIGA...FV......GIAFAI....R.........................KLPW...QS....T.........LQV........SLTLALVNPFLWYLIDRSKPG.FMLSTAV.GLLGMVT...LLG.....I..NPDVV.PG...PTVNA............................................AESAVAG..N-..GSGILS..fAS............................QES...IAVGTWIASVLFCSCVCFGNIGRRLA.....................................................
G1M1N7_AILME/30-211                    ............................................................................................................................................................................................i-RGVVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-IAS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...DN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATVVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
G1RI47_NOMLE/86-267                    ............................................................................................................................................................................................q-RSLVLFSVGVVLALV.LNLL.QIQRNVtl..........................................fpeE---Vi....atIFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
J8Q1F0_SACAR/101-289                   ...........................................................................................................................................................................................ta--FFVLFIVGIIFPMV.SECL.YDNDKLtkgria..................................fflkhgiTIKNK.......IVAEPDMVPd......wAVFG.T...............EGVIFGSIVPFIDYLVRH.-----.-.---.............................................QHRPNTRLSVYKNTFGSFIKCVNA...LL......GIIFGI....R.........................KIEW...AS....S.........LQA........AGAWSLLNIVLWLFLDGTSTV.LLSGLVV.GMISAFS...CAQ.....Y..APQLS.--...-----............................................-------..--..------...--............................---...--------------------------qtlyfidfyffgllmfsklgrylf.............................
H2V9C9_TAKRU/25-206                    ............................................................................................................................................................................................r-RGLVLFTVGVFLALV.LNLL.QIQRKVtl..........................................fpeEV--Ma.....tLFSSTWWIP........PCCG.T...............GAAVVGLLYPCLDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....V.........................KLNI...DN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITT.AFLATVFt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QH...TS............................PDF...LYVRSWLPCIFFSGGVTVGNIGRQLA.....................................................
G3UB33_LOXAF/72-253                    ............................................................................................................................................................................................q-RSLVLFSVGVVLALV.LNLL.QIQRNVtl..........................................fpdE---Vi....atIFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
R7YYL4_CONA1/155-390                   ............................................................................................................................................................................................a-RILALFVIGMAYGVI.VSHL.HDNQHI..............................................aPVRMEl.....rIARTSWTYL........AFWG.V...............AGVALGSALPWVDWMWEG.DGGEG.G.IRLdg........................................edgGSEMDMVKGAEESDWNPVVRSIGA...FV......GIAYAI....R.........................KLPW...QS....T.........LQV........SLTLALVNPVLWYLIDRSRPG.FALSSLV.GLAGTTA...LLF.....T..NPDIV.PS...PAAPLaesskty.............................nasrgtasATGTTVG..KE..ELLLGG..mVS............................YES...VGVATWILSVLFCSCVCFGNIGRRLA.....................................................
B3S4T4_TRIAD/5-189                     .............................................................................................................................................................................................LRTLIVFVVGVLLSLA.LLIL.QIERNVal..........................................fppGVLSD.......LSSIPWWVP........ISCG.A...............GAATIGLSLPKMDEWF--.-----.-.---.............................................--QRKYDYHHDQVEWVGVLRCVGI...FV......GITYAS....T.........................LAYN...SV....I.........AKF........SVSLSLMAIGQWWLFDRSVSG.FVLGVAV.SFTATAV...TQI.....I.vHYGIF.--...-----............................................-------..--..-----S..fSK............................PDF...LSIRSWLPGVFFSATIAIGSLGRQLA.....................................................
K9H3N0_PEND2/138-351                   ............................................................................................................................................................................................l-SSVLLFGFGLAYGVI.TIHL.HENHWI..............................................tPVKLEn.....iHYYESWQYL........GLWG.L...............AGIALGNLLPWLDS-WRE.GESDS.K.---.............................................LAGADDESEERTPSWVAVARSVGA...FV......GIAFAM....R.........................RLPW...ES....T.........TQA........SLTLALANPVLWYLIDRTTTG.FVLSTTV.GLAGMEV...VLG.....L..KPELV.--...PTSTGps........................................fgASLLNGT..GL..EIVLGV..gIT............................QES...IAVRTWVASVIFCACVCFGNVGRQLA.....................................................
W5M5U3_LEPOC/33-214                    .............................................................................................................................................................................................IRAVVLFSIGVFLALV.LNLL.QVQRNVtlf.........................................ppdM---Ia.....sIFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDN----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...AN....N.........MQL........SLTLAALSIGLWWTFDRSRSG.FGLGMGI.AFLATLAt.qLLV.....Y..NGVFQ.--...-----............................................-------..--..-----Y...TS............................PDF...LYIRSWLPCIYFAGGITMGNIGRQLA.....................................................
L2GHS1_COLGN/148-368                   .............................................................................................................................................................................................FRIALLFIIGMGYGVM.VTRL.QNEHRF..............................................sSFQVEs....iiKPSYNWQYL........SLWG.L...............SGVVLGGLLPWFDGVWEE.TFGKE.E.EIAe...........................................eRESPSPEDASPVKDWALVVRSIGA...FV......GIVFAI....R.........................KLPW...AS....T.........LQV........SLSLALVNPFLWYLIDRSKPG.FLLSMAV.GVTGSAV...LLG.....I..NPDVM.PT...PSSLTy..........................................rNESERAY..AE..PMTLGG..lAS............................QET...IETGIWMLSVLFCSCVCFGNIGRRLA.....................................................
K1XKZ2_MARBU/136-376                   .............................................................................................................................................................................................LRSVLLFSIGMGYGSL.VRHL.HDDHQL..............................................aPFQVEg....iiKLQNDWRYL........VFWG.F...............AGVGLGSLMPWVDTLFLA.PASEE.R.VDLgrkg.....................................mgteVEHEEREGGVFGADWTPVVRSVGA...FV......GIAYAI....R.........................KLPW...SS....P.........LQA........SLTLFLVNPVLWYLLDRSYSG.FILSSFV.GLFGTTA...LLV.....S..NPGMV.PS...PATTVlpgttkp.............................fgipalnaTHQAGGV..YL..EGVLGGp.gLS............................RET...LEAGIWTLSVLFCSCVCFGNVGRRLA.....................................................
W9X135_9EURO/134-342                   ..........................................................................................................................................................................................lqn---SLLFGCGIGYGTI.ITHL.HRTQRI..............................................tPVPVP......dIDRSSLYYQ........VSWG.I...............FGILLGNALPLVDSFWER.FVPSD.A.KSAktts....................................lqpegATSGSSSDSGLGPLWYSAVRSMGA...FV......GIAFAV....R.........................RIPW...QS....T.........LQV........ALTLALANPVLWYLIDRSLPG.FAFSAAV.GIIGTLV...MLV.....V..DPDFV.PV...PEIHQ............................................P------..--..------...MA............................SEK...FGVYTWLASILFCTCLCFGAIGRRL-r....................................................
A0A010RP60_9PEZI/147-368               ............................................................................................................................................................................................s-RIALLFVIGMGYGLM.VTRL.QNEHRFs............................................sfQV--Ds....mmKPGYDWQYL........TLWG.L...............SGVGLGGLLPWFDGVWED.TFGKE.E.VVLe..........................................etNGSPSPEDVSPVKDWAVVVRSIGA...FV......GIVFAI....R.........................KLPW...AS....T.........LQV........SLTLALVNPFLWYLIDRSKPG.FLLSAAV.GLAGSAV...LLG.....I..NPDVM.PT...PSSLTy..........................................rNESERAY..SE..PITLGG..lAS............................QET...IETGIWMLSVLFCSCVCFGNIGRRLA.....................................................
A0A094GNI1_9PEZI/139-255               .............................................................................................................................................................................................LRSTLLFLLGTAYGLL.VTHL.HNEQRL..............................................aPFGAQg....liQPSYDKKYL........LFWG.V...............AGVAMGSALPWFDGMWEE.YFGEE.V.TSSai........................................ggkVADGANEEEGVAAQWTPVVRSIGA...FF......GIAFAI....-.........................----...--....-.........---........---------------------.-------.-------...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------vgpp.................................................
A0A0L1JG75_ASPNO/130-349               .............................................................................................................................................................................................LKAALLFSFGIVYGII.TIHL.HENHWI..............................................tPVKLEn.....tHYYGSWEYL........GFWG.V...............AGVVLGNVLPGLDLFSED.VTVDN.S.KQS............................................sRSSSDEENEERTLSWVAAVRSVGA...FV......GVAFAM....R.........................RTPW...QS....T.........TQA........SATLALANPVLWYLIDRTKTG.FFMSSIV.GIGGMGI...VLA.....L..RPDLV.PS...STGASa.........................................taIPALNST..LR..DLGLGA..dLT............................QES...LAVRTWVASVLFSACVCFGNIGRQLA.....................................................
M2SYS3_COCSN/166-416                   ............................................................................................................................................................................sikqprqgtwkylviag-KLAALYVFGVMYGVI.VSHI.HETKQL..............................................aAIHVE......gVDQKGHAYL........ATWG.L...............FGVALGSLLPYVDLLWNT.QSSES.E.EIQp...........................................gGKEAEEHDPPISEQVNDVVRSVAA...FI......GIAFAI....R.........................RLPW...QS....T.........LQL........TLTLALVNPALWYILDRSKPG.LSVSLTVtSILTSLI...FLS.....-..DPNVL.PS...PFLPAyvnathlps..........................ttrnpqvkgGLNTGAP..MA..QTLFFG..mMS............................YEE...LAIVTWVGSVLFCSCVCFGSIGRRLA.....................................................
A0A0P7WCY1_9TELE/95-276                ............................................................................................................................................................................................i-RGLLLFLIGVFLALV.LNLL.QVQRNVtl...........................................fpP---Dgf...asIFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDRLL--.-----.-.---.............................................-----GEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...AN....N.........VQL........SLTLAALSIGLWWTFDRSCSG.LGLGFAI.AFLATLTt.qLLV.....Y..NGLFQ.--...-----............................................-------..--..-----Y...TS............................PDF...LYVRSWLPCIFFAGVITMGSIGRQLA.....................................................
A0A0F9XZD5_TRIHA/181-412               ............................................................................................................................................................................................s-RALVLFVLGAGYGVL.VTHL.HQEQGL..............................................lQ-LSDag...ngMPRYNGSYT........AMWG.Fa.............lAGVGMGALQPWVDGEWDG.MFGCD.S.GETead......................................svesTYDDDERQPLPETDWALVMRAIGV...FV......GVAFAV....R.........................RLSW...TS....S.........SQV........SLAVALANLFLWWLIDRTMPA.LVVSTVV.GLVGTVF...LLS.....V..SPDII.RA...PSTTFaqa......................................nssFYAEPHT..EP..AMMLGG..iAS............................QET...VEAGIWILSVLFCTCLCFGNIGRRLA.....................................................
A0A087WQP7_MOUSE/1-103                 .............................................................................................................................................................................................----------------.----.------...............................................-----.......---------........----.-...............------------------.-----.-.---.............................................------------------MRCVAV...FV......GINHAS....A.........................KVDF...DN....N.........FQF........SLTLAALSVGLWWTFDRSRSG.FGLGVGI.AFLATVVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
J3K2N1_COCIM/134-362                   ............................................................................................................................................................................................r-RSVLLFLFGMAYGGI.ITHL.HGHPNVag...........................................rvPVNMEh....idLDQRSLGYL........ALWG.V...............AGVALGSLQPWFDLLWGD.DLIVG.R.SQ-.............................................-NAARTAKGNGLLEWSPMVRSIGA...FV......GIAFAI....R.........................KLPW...QS....T.........LQV........SLTLALANPVLWYLIDRSKPG.FVLSTVV.GITGMLA...LLG.....I..NPTIV.PS...PATASlsspla................................atspdtTMNGAPI..PS..TTNIMG...MT............................QES...VAVGTWIASVLFCSCVCFGNIGRRLA.....................................................
J4U3W6_SACK1/114-297                   ...........................................................................................................................................................................................qa--VLILSLSGFAYHEL.SRNL.HDNHLLhpe........................................fasrP---Ll....lgVKICNWLSNgvl..pdwLGYA.V...............EGVLFGSVIPILDNIFQ-.-----.-.---.............................................--TEIVKSSAHHDSLTSVIRSLNA...ML......GVTFGI....R.........................KIQW...NS....S.........LQA........AGAWGLLNVILWLFFDGSISM.LLSCICI.GVGCCIS...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------cykditdgsqflyfmdfyflgslmfgklgryly....................
H7C5L3_HUMAN/1-176                     ...........................................................................................................................................................................................xs--------VGVVLALV.LNLL.QIQRNVtl..........................................fpeE---Vi....atIFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
G3ID14_CRIGR/4-194                     .....................................................................................................................lhdhvwscssssaarpyslprgmitaarclqgsgapepaswnhhhllirlvgapvlwhgsrllsayctpcid----------------.----.------...............................................-----.......---------........----.-...............------------------.-----.-.---.............................................--SHLGEPHKFKRKWASIMHCIAM...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDLSRSG.LGLGITI.AFLATLIt.qFLM.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPYIFFSGGVTVGNIGPQLA.....................................................
T1JCX2_STRMM/17-207                    ............................................................................................................................................................................................y-RGIILFAVGVFFTFI.FRIL.QLQRKQ..............................................gV-LNShf...ttAFLCTLGVS........TMTG.T...............LSVLIGLLYPHLNR----.-----.-.---.............................................----SGHSWALPVDWASVMRCIVI...YM......GINQAN....Avsl..................kgifKLDF...AN....N.........LHL........SLTLAGMSVGLWWLFDRSQRG.FGLGLST.ALIATTIt.qLLT.....-..-YSAL.--...-----............................................-------..--..YKYIER..dFF............................NLR...YHAYSWLPYIFFAAGITIGNLGRQLA.....................................................
A0A093Z558_9PEZI/139-362               .............................................................................................................................................................................................LRSALLFLLGTAYGLL.VTHL.HNEQRL..............................................aPFGSQg....fiQPSYDKKYL........IFWG.V...............AGVAMGSALPWFDGMWED.YFGEE.I.TNSav........................................ggkVIDGKNEEEGVAAQWTPVVRSIGA...FF......GIAFAI....R.........................KLAW...TS....T.........LQA........SLTLALVNPFLWYLLDRSKPG.FVLSVTV.GLIGTTG...LLM.....F..DSTMV.QS...PLATH............................................SSYNSTS..GS.gHPSIYAq.gDN............................TEL...FGSAVWIMSVLFCSVLCFGHIGRRLA.....................................................
S8A8P3_DACHA/171-391                   ............................................................................................................................................................................................g-KSTILFLAGASYGLI.IARL.HDQSHI..............................................aPVKVP.......VERDTPGYL........ALWG.F...............ASVVLGSIMPWADGMWED.YLWES.G.NNSsgkqqngr.............................tpvpvisvSDAEDAKSLDVTPVWNPAVRSIGA...FV......GIAYAI....R.........................KLPW...ES....T.........SQA........SLTLAFVNPVLWYILDRTKMG.FWLSTLV.AIFGSLF...LIG.....F..NPDFV.AI...PSGDGvg........................................lvEKL---R..MT..TMPGRGgveMQ............................MQV...IGATTWIASVL---------------aqv..................................................
F0XH28_GROCL/205-478                   ............................................................................................................................................................................................g-RAVLLFVLGMGYGVL.VSRL.HSETQDrfvdgtaa..............................saveqdtasA---Arrg.tayDATNDWCYL........VSWG.I...............SGVVLGLLLPWFDSLWNR.TFGID.G.QH-.............................................--ARDKSHMAPETDWALVVRGIGA...FA......GIALAM....R.........................KLQW...AS....T.........LQA........SLTLALTNPFLWYLLDRSKSG.LLLATAV.GLVGSVV...LTA.....L..ELDLM.PN...PGSRRddlyathcggngvyasqfngsttlssasraessssataisssasTAATAAA..AA..AAAARN..lVS............................GAT...VEMAIWMVSVLFCSCVCFGNIGRRLA.....................................................
G3MWS1_BOVIN/30-211                    ............................................................................................................................................................................................i-RGVVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-IAS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...DN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATVVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
A0A093DEU4_CHAPE/1-131                 ............................................................................................................................................................................................t----------------.----.------...............................................-----.......---------........----.-...............--AVIGLLYPCMDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...AN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATLVs.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
L1JGI9_GUITH/101-209                   ......................................................................................................................................................................acvsffcfqyycsgllfqqgved----------------.----.------...............................................-----.......---------........----.-...............------------------.-----.-.---.............................................------------------------...--......------....-.........................----...--....-.........VSL........HLSLAISAVACWWIFDRTRTG.AIMSIVT.GLCGPLVevfLLQ.....V..WPAW-.--...-----............................................-------..--..------...--............................---...--------------------------tgqtlyaysapdmlgiplwiawvygcgapavgglsrl................
H0WWY3_OTOGA/30-211                    ............................................................................................................................................................................................i-RGVVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-IAS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...DN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATVVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
C5DCV5_LACTC/80-258                    ...........................................................................................................................................................................................fs--LTFLGVAGISYNEL.SKQL.HDNHELheefa....................................srplalG--VE......iCRTLSFGVVp.....twMAYA.L...............EGVLFGALLPLMDTLW--.-----.-.---.............................................------GSPVRTTTFTSFLRSTNA...ML......GVAFGI....R.........................KIEW...SS....S.........LQA........SGAWFLLNIVLWMFFDGTPSM.LLGCLGI.GTIASVT...SYR.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------dvtefsqmlyfmdfyflglllfgklgryly.......................
F6HZC0_VITVI/68-227                    ...........................................................................................................................................................................................is---LSLFGSGFFLGTL.IDGI.HSRVNL...............................................VVYQNgsi.digPLHTNVWVP........PLLG.L...............FYCTVGLLQLFLDEKF--.-----.-.---.............................................---SSKAPKGSLKKTGSSLIALVL...FI......ELSAEM....Y.........................KAGV...AD....N.........IEA........YI-LFAVAEFIWLFLDGTRQG.FALACIV.GLG----...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------cplaeipimklfhlwyypqanini.............................
E7QJV4_YEASZ/114-280                   ...........................................................................................................................................................................................qa--VLILSLSGFAYHEL.SRNL.HDNHLLhpd........................................fasrP---Ll....lgVKLCNWLSNgvl..pnwLGYG.V...............EGLLFGSVVPILDNIFQT.E----.-.---.............................................----VVKSSVHHDSLTSVIRSINA...ML......GVTFGI....R.........................KIQW...NS....S.........LQA........AGAWGLLNIILWLFFDGSISM.LMSCICI.GVGCC--...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------iscykdiidgsqflyfmd...................................
A4RSA0_OSTLU/74-338                    ...........................................................................................................................................................................................ev---ALMFVAGAILGPL.LDHQ.HSRFDVlhyatplqihfdalfaplwns.....pfgpimnfiapepvkdlfrimFVNEN......gVLETGWWVP........PLFG.A...............AAIVIGLGHTSLDEFRIR.SSVKR.A.REIeirkglqgte.........................qivsrtseliENAKGKPALGWQPSWVSVNLCISV...FAfqylvsG-ILAS....P.........................QSPF...VDgflpY.........HLI........DIFLCVWAVTTWYFFDNSAQG.LFMASLT.AVCGPVA...EIV.....L.iNYGHL.--...-----............................................-------..--..----YS..ySH............................PDI...LGIPTWIPWVYFCGGPAVGNLSRQ--vr...................................................
I3KLI5_ORENI/39-220                    ............................................................................................................................................................................................i-RGAMLFSVGVFLALV.LNLL.QVQRNItlf.........................................ppdV-ITS.......IFSSAWWVP........LCCG.T...............AAAMIGLLYPCIDS----.-----.-.---.............................................---RLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...AN....N.........VQL........SLTLAALSIGLWWTFDRSRSG.FGLGICI.AFLGTLVt.qLLV.....Y..NGVFQ.--...-----............................................-------..--..-----Y...TS............................PDF...LYIRSWLPCIFFAGVITMGNIGRQLA.....................................................
W4XF92_STRPU/55-236                    ............................................................................................................................................................................................r-RGVVLFLIGIVMALV.LNLL.QVQNNVtl..........................................fppET--Ld.....sISSSAWWVA........PFCG.S...............AAVLVGLLYPCIDD----.-----.-.---.............................................---KLGETPYYKREWSHVMRCLAV...FV......GINHAC....A.........................KIEF...AN....N.........LQF........SLTLAAMSLGLWWLFDRSRSG.FGLALTI.AFLATLIt.qLLV.....-..YKGVY.--...-----............................................-------..--..-----R..yTE............................PDF...LYVRSWLPCVFFSGGVTIGNIGRQLA.....................................................
A0A0A2VEH2_BEABA/165-408               .............................................................................................................................................................................................VRTAVLFVLGLGYGAL.VTRL.HDSHEG...............................................LTADGf.....vEPGFNSTYL........GVWG.V...............AGVVLGSLLPWFDGVWEA.RYGDA.G.AEEdca.......................................aadGETSPSQAVDTGLDSALVMRAIGA...FV......GIVFAI....VrnlpcllpwrdassysvaniacvqrKLAW...DS....T.........LQI........SATLALANPLLWWLIDRSKPG.FLLSAAV.GLVGSLL...LLG.....I..SPDMM.PT...PSLQM............................................LRDAKSV..NG..TSPLIP...-D............................IQV...IETGVWMLSVLFCSCLCFGNIGRRLF.....................................................
U3IIK9_ANAPL/66-247                    ............................................................................................................................................................................................q-RSVVLFVVGAFMALV.LNLL.QVQRNVtl..........................................fpeE---Vi....atLFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFVATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
W4YYL3_STRPU/55-236                    ............................................................................................................................................................................................r-RGVVLFLIGIVMALV.LNLL.QVQNNVtl..........................................fppET--Ld.....sISSSAWWVA........PFCG.S...............AAVLVGLLYPCIDD----.-----.-.---.............................................---KLGETPYYKREWSHVMRCLAV...FV......GINHAC....A.........................KIEF...AN....N.........LQF........SLTLAAMSLGLWWLFDRSRSG.FGLALTI.AFLATLIt.qLLV.....-..YKGVY.--...-----............................................-------..--..-----R..yTE............................PDF...LYVRSWLPCVFFSGGVTIGNIGRQLA.....................................................
R4GK90_CHICK/30-211                    ............................................................................................................................................................................................i-RGIVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-ITS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCMDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...AN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATLVs.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
M2UB55_COCH5/182-416                   ............................................................................................................................................................................................g-KFTALYVFGVMYGVI.VSHI.HETKQL..............................................aAIHVE......gVDQKGRAYL........ATWG.L...............FGVALGSLLPYVDLLWNA.QSSES.EiQPE.............................................GKEAEEHDPPISEQVNDVVRSVAA...FI......GIAFAI....R.........................RLPW...QS....T.........LQL........TLTLALVNPALWYILDRSKPG.LSVSLTVtSILTSLI...FLS.....-..NPDVL.PS...PFLPAsvnathlps.........................tttrnpqvkaGLNNGAP..MA..QALFFG..mIS............................YEE...LAVVTWVGSVLFCSCVCFGSIGRRLA.....................................................
W5KPN8_ASTMX/56-161                    ............................................................................................................................................................................................r-RGLVLFTVGVFLALV.LYLL.QIRKNVvl..........................................fpeE---Al....dtLYSSSWWIP........LGCG.T...............AAAVVGLLYPCLDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................V---...--....-.........---........---------------------.-------.-------...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------sssntkltcil..........................................
G3X2R1_SARHA/30-211                    ............................................................................................................................................................................................i-RGVVLFLIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-IAS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHQT....Q.........................KVDF...DN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATLVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
J4KLX3_BEAB2/174-392                   .............................................................................................................................................................................................VRTAVLFVLGLGYGAL.VTRL.HDSHEG...............................................LTADGf.....vEPGFNSTYL........GVWG.V...............AGVVLGSLLPWFDGVWEA.RYGDA.G.AEEnca.......................................aadGETSPNQAVDTGLDSALVMRAIGA...FV......GIVFAI....R.........................KLAW...DS....T.........LQI........SATLALANPLLWWLIDRSKPG.FLLSAAV.GLVGSLL...LLG.....I..SPDMM.PT...PSLQM............................................LRDVKSV..NG..TSPLIP...-D............................IQV...IETGVWMLSVLFCSCLCFGNIGRRLF.....................................................
A1CH80_ASPCL/130-349                   .............................................................................................................................................................................................VRSALLFGFGVIYGVI.TVHL.HENHWI..............................................tPVKLEn.....iHDYDSWQYL........GFWG.F...............SGVALGNFLPWLDSFAEQ.MDANR.S.RAP............................................kGQGNTRDREDRTPAWVSVARSVGA...FV......GIAFAL....R.........................KLPW...ES....T.........TQA........SATLALVNPVLWYLIDRTKAG.FLLSTVV.GLAGTAV...VLG.....L..KPELI.--...PTSTEtpa......................................asiPLL-NNT..SR..DFGLVS..gVT............................QEG...AAVRIWLASVLFCACVCFGNVGRQLA.....................................................
J6EM76_SACK1/101-289                   ..........................................................................................................................................................................................aal---FILFISGILFPMI.SECL.FDNDQLvkgviv..................................sflkhgiTIKNR.......IVAEPDMVPd......wAVFG.T...............EGIIFGSIVPFIDSFVRH.K----.-.---.............................................-RLPNTRSIAYKNTLGSFIRCANT...LL......GIIFGI....R.........................KIEW...SS....S.........LQA........AGAWSLLNIVLWLFFDGTLTV.LFPGLAI.GVISSLC...CAQ.....Y..TSQL-.--...-----............................................-------..--..------...--............................---...--------------------------sqtlyfidfyffgflmfsklgrylf............................
L9L496_TUPCH/128-309                   ............................................................................................................................................................................................q-RSLVLFSVGVVLALV.LNLL.QIQRNVtl..........................................fpeE---Vi....atIFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
G7YNV0_CLOSI/2-133                     ........................................................................................................................................................................................dfkig----------------.----.------...............................................-----.......---------........----.-...............------------------.-----.-.---.............................................------AHDVYNKEWSSVFRCVAL...FF......GLSHAT....A.........................RIDF...AS....Y.........AQL........VIIIGGLSFGLWWIFDRTRVG.LCCGMVA.AIIATLL...GH-.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------afirrrllscldtlsfllwwsdscsyrtatskagclgtvqekdritvvahtii
G3AQH1_SPAPN/97-318                    ............................................................................................................................vkllilsgsaflyneitkhinykhfsdnklanipvtisnifvsgflskfristyipidsdvgkvl----------------.----.------...............................................-----.......------DQL........LALT.I...............QGAGMGLLHPIMDRILPT.YFTRR.V.LSS.............................................-NPYPTYSTTYSNLFNDLIRSCIT...FL......GISYAI....R.........................KIEW...SS....F.........LQV........SILWSLLNPGLWLLLDGTLSG.FLASLLG.SFVACAG...IFV.....E..NFAFV.--...-----............................................-------..--..--VLYG..aNS............................EDS...IALWLWIASFFFCGIIIFGKIGRGLF.....................................................
Q5B4R5_EMENI/131-343                   ...........................................................................................................................................................................................is--GALLFAFGVVYGII.TIHL.HENHWI..............................................tPVKLEy.....tHFYGSWEYL........GFWG.F...............TGVAIGNVLPWLDSYLGG.AIAQE.K.---.............................................--QSSNDSAELALSWSAVVRSVGA...FV......GIAFAM....R.........................RTPW...ES....T.........TQA........SLTLALANPVLWYLIDRTKTG.FILSTTL.AIGGMSL...LLG.....L..KPGLI.--...PATEGsa........................................pvIPSLNGV..GP..EATPGA..rLT............................QES...MAVRTWIASVLFCACVCFGNIGRQLA.....................................................
A0A0M0UGN9_9PEZI/173-435               .............................................................................................................................................................................................LRAVLLFVLGVGYGVL.VTRF.PRRGGQ...............................................QQQQQ......qVAVYEWWYL........GFWG.V...............AGVVLGGLLPWFDKVWER.RVAAV.A.ATGgvdagaglkgkrnr................aegggdgeidvdaipAATAATAPAQAETDWALVIRGIGA...FV......GIVFAI....R.........................KLPW...AS....T.........MQV........SLTLALTNPFLWYLIDRSKPG.FLLSAAV.GLAGSLAs.lVMG.....V..NTDMMmPA...PAATSvpsgspga...........................gsgsllpnmTAAVSSG..HG..ANTMGG..lAS............................QET...VEASIWMLSVLFCSCVCFGNIGRRLA.....................................................
H2AWA1_KAZAF/63-243                    ...........................................................................................................................................................................................fa--GLVLFCLGVVFAII.SEEI.YDNCSLtngv.......................................lsitL----.......NKINTWMNEyvtgtpkcVTYG.I...............LGVLCGFVIPIVDNIL--.-----.-.---.............................................---NIDKRQIKNNDFNSILKCLNA...ML......GICLGI....R.........................NIEW...SS....S.........LQA........SVAWCLLNIILWLFLDGTESI.ALVGIVI.SLTSCVI...SFQ.....-..--QLF.--...-----............................................-------..--..------...--............................--D...VTEIIYIVDFYFFSFLVFGKMGRYL-f....................................................
V8PEC7_OPHHA/83-264                    ............................................................................................................................................................................................q-RSLVLFAVGTFLALV.LNLL.QIQRNVtl..........................................fpeE---Vi....stIFSSAWWVP........PCCG.T...............AAAVIGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........IQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFVATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
A0A084QEF8_9HYPO/155-385               .............................................................................................................................................................................................LRAGVLFTLGTGFGVI.ITRY.HTEGRFt.............................................sLA--Dv....atAASLDWKYW........VFWG.V...............AAVLLGTSLPLFDRYWEE.THPPQ.T.HAKpvl.......................................kpvEDEPTSESLDAGMDWALVVRAIGA...FV......GIAFAV....R.........................RLAW...DS....T.........LQV........SATMTLVNPLLWWLIDRSKPG.FMLSAIV.SISGSAL...LMG.....V..NPEMV.PT...PPSLAsssqn..................................nssgyT-ASQPL..KP..QDGYTG..tST............................VEA...MGTGVWILSVLFCSCLCFGNIGRRL-t....................................................
M5XUG4_PRUPE/56-247                    ...........................................................................................................................................................................................is---FALFGSGFFLGPL.IDGL.HSRVELv............................................ayQ---Ngsi.nigPLHTNIWVP........VLLG.L...............FYCTVGLLQLFLDE----.-----.-.-N-.............................................ERAPLNSPEANQQKTIASFLALVL...FI......ELSAEL....Y.........................KAGT...AD....N.........IEA........YLLFA-AAEFIWFSVDRTWFG.FLLASII.GIACPLA...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------eiplmkffhlwhypqanveifgqglvswtltcyfvytlflinfsrwlksv...
A2QI27_ASPNC/123-339                   ............................................................................................................................................................................................l-KSAFLLGFGVVYGVI.TIHL.HENHWI..............................................tPVKLEn.....tHYYGSWQYL........AFWG.V...............AGAVLGNILPWFDQFSDE.IIGSP.K.QAK.............................................-GSSDPETADRTLSWVSVVRSVGA...FV......GIAFAM....R.........................RLPW...ES....T.........TQA........SLTLALVNPVLWYLIDRTRTG.FVLSTVV.GLAGMGI...ILG.....L..KPDLI.--...PSAETsa........................................faASKFDVT..GW..GYGLAV..eMS............................QES...IAVRTWVASVLFCACVCFGNIGRQLA.....................................................
U3JWN1_FICAL/81-262                    ............................................................................................................................................................................................q-RSVVLFVVGAFMALV.LNLL.QIQRNVts..........................................fpdE---Vi....stLFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........IQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFVATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
K3W054_FUSPC/154-372                   .............................................................................................................................................................................................MRGLLLFVLGVGYGVL.VTSR.FNSDSD...............................................-SHAS.......GSTYNWAHL........SFWG.L...............AGVALGALFPWFDRVWEE.SFGEK.E.DEA............................................vAENAPAKDDDSGTDWAIAIRAIGA...FV......GIVFAI....R.........................KVAW...AS....T.........LQV........SLTLAMVNPLLWWLIDRSKPG.FFLSTAV.GLAGSMI...LLG.....I..NPDMM.PA...PAHAPfrq......................................lvnATTPSQD..EV..VPILGG..fAH............................QDT...LETGMWMLSVLFCSCVCFGNIGRRL-t....................................................
G7X6S6_ASPKW/125-325                   ............................................................................................................................................................................................l-KSAFLLGFGVVYGVI.TIHL.HENHWI..............................................tPVKLEn.....tHYYGSWQYL........AFWG.V...............AGVVLGNILPWFDQFSDE.IIGSP.K.QAK.............................................-GSSDPETADRTLSWVSVVRSVGA...FV......GIAFAM....R.........................RLPW...ES....T.........TQA........SLTLALVNPVLWYLIDRTRTG.FVLSTVV.GLAETSA...FAA.....S..KFDVT.--...-----............................................-------..GW..GYGLAV..eMS............................QES...IAVRTWVASVLFCACVCFGNIGRQLA.....................................................
F7BYS4_HORSE/86-267                    ............................................................................................................................................................................................q-RSLVLFSVGVVLALV.LNLL.QVQRNVtl..........................................fpeE---Vi....atIFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCVAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
INSI1_HUMAN/86-267                     ............................................................................................................................................................................................q-RSLVLFSVGVVLALV.LNLL.QIQRNVtl..........................................fpeE---Vi....atIFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
A0A072NWI1_9EURO/134-352               ............................................................................................................................................................................................i-QTSLLFSFGVGYGSI.VTHL.HQTRRIt............................................plP--LP......dVEHRSLYYN........LCWG.L...............LGVLLGNALPAVDSLWEK.SISTT.I.SMDqapqksgrp..........................agtssktereSPATSNLDSGTGPIWYSAVRSVGA...FV......GIAFAL....R.........................RIPW...QS....T.........LQV........ALTLALANPVLWYVIDRSLPG.FAFSALV.GTIGTTF...LLV.....V..DPNFV.PV...PAIHQ............................................S------..--..------...MA............................SEQ...FGVYTWLASILFCTSICFGAIGRRL-q....................................................
G8Y6E7_PICSO/93-321                    ..........................................................................................................................................................................................gki---MVLSLCAFLYNEA.TKHI.HNRHIEssvlseqpllmsti..................flsrlvhnvkervstP---Lrev.fflPQDSYADYI........VALV.L...............QGSIMGLVHPIMDSILPP.TLTKR.L.L--.............................................-SSNPNNRQAKGNLWNDLLRSLVT...FL......GISYAV....R.........................KVEW...SS....S.........LQA........SMVWSLLNPGLWLLLDGTISG.FLSSVAV.AGLACVC...VYY.....Q..DPTMT.--...-VDLS............................................---SA--..--..--NVPK...EP............................AEM...ISPWLWVGSFFFCSLIIFGKIGRGLF.....................................................
H2AP64_KAZAF/66-205                    ...........................................................................................................................................................................................sn--VIIFALMGNIYSSL.LANL.HDYKIS...............................................F----.......YRNEQSNSI........LTNS.L...............EGIFCGLITPLIDWLL--.-----.-.---.............................................------GLNTCENDLVKIFRICNA...ML......GVIFGV....R.........................KIQW...TS....S.........LQG........SIAWFLLNFILWLFFDGTPSL.FIISSFL.SYLTGLY...HYS.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------vsnewsev.............................................
U3CHF3_CALJA/30-211                    ............................................................................................................................................................................................i-RGVVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-IAS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFNREWSNVMRCVAV...FV......GINHAS....A.........................KLDF...DN....N.........IQL........SLTLAALSVGLWWTFDRSRSG.FGLGVGI.AFLATVVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
A0A087YHQ8_POEFO/40-221                ............................................................................................................................................................................................i-RGGMLFSVGVFLALV.LNLL.QVQRNVtlf.........................................ppdV-ISS.......IFSSVWWVP........PSCG.I...............ASAMIGVLYPCIDR----.-----.-.---.............................................---RLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...AN....N.........VQL........SLTLAALSIGLWWTFDRSRSG.FGLGISI.ALLATLTt.qILV.....Y..N-GVF.--...-----............................................-------..--..----QY...TN............................PDF...LYIRSWLPCIFFAGVITMGNIGRQLA.....................................................
E7Q8D3_YEASB/114-248                   ...........................................................................................................................................................................................xa--VLILSLSGFAYHEL.SRNL.HDNHLLhpd........................................fasrP---Ll....lgVKLCNWLSNgvl..pnwLGYG.V...............EGLLFGSVVPILDNIFQT.E----.-.---.............................................----VVKSSVHHDSLTSVIRSINA...ML......GVTFGI....R.........................KIQW...NS....S.........LQA........AGAWGLLNIILWLFFXR----.-------.-------...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------ln...................................................
A0A066XL13_COLSU/151-384               ............................................................................................................................................................................................s-RAVVLFLIGMGYGLM.VTRL.QNEHRFs............................................sfQ--VEs....miKPGYDWQYL........TVWG.L...............FGVALGGLLPWFDGVWED.AFGKE.Q.EV-.............................................--GTSAEDTTPVKDWALVVRSIGA...FV......GIVFAI....Vsrsstvdve.......cqgsnngqrKLPW...AS....T.........MQV........SLTLALVNPFLWYLIDRSKPG.FLLSAAV.GLAGSAM...VMG.....I..NPDVM.PT...PSSLTy..........................................rNESVRAF..SD..PTTLGG..lAS............................QET...IETGIWMLSVLFCSCVCFGNIGRRLA.....................................................
F7H2V2_MACMU/1-130                     ............................................................................................................................................................................................a----------------.----.------...............................................-----.......---------........----.-...............---VVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
A0A0P7UU87_9TELE/144-214               ...........................................................................................................................................................................................ha----------------.----.------...............................................-----.......---------........----.-...............------------------.-----.-.---.............................................------------------------...--......------....-.........................----...--....-.........---........---------SLWWTFDRSRSG.FGLGITI.AFLATIVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFSGGVTVGNIGRQLA.....................................................
G9N7T2_HYPVG/173-404                   ............................................................................................................................................................................................s-RALVLFVLGAGYGVL.VTHL.HREQGLl............................................qlP---Dag...ngMPQYNGSYT........AMWG.Fa.............lAGVGMGALQPWVDGEWDG.VFGCD.G.DEAeve......................................svesLHDEDEEQSLLETDWALVMRAIGV...FV......GVAFAV....R.........................RLSW...TS....S.........SQV........SLAVALANLFLWWLIDRTMPA.LVVSTVV.GLVGTLF...LLS.....V..SPDMI.RA...PSTTFmqt......................................nssFYAQPHA..EP..AMMLGG..iAS............................QET...VEAGIWILSVLFCTCLCFGNIGRRLA.....................................................
E1ZIZ3_CHLVA/4-194                     ...............................................................................................................................................................ailgplcdgqhsqhdvlhyahpsllslgpl----------------.----.------...............................................-----.......RLETCWWVP........LLFA.A...............AGIILGVSHPLLDA-WQQ.E----.-.---.............................................-RGGQQPRGGADPSWSFVLAAITL...FV......LQYAAS....G.........................TLEE...PL....L.........RQAlpgglpalDALLLSSGVALWWAFDCSPQG.LLMACLT.AVAGPAV...EVA.....L..INGLH.--...-----............................................-------..--..---AYT..yTH............................PSF...LGIPSWIAWVYLAGGPAVGNLGRR--vs...................................................
A0A0F0II76_ASPPA/130-349               .............................................................................................................................................................................................LKAALLFSFGIVYGII.TIHL.HENHWI..............................................tPVKLEn.....tHYYGSWEYL........GFWG.V...............AGVVLGNVLPGLDLFSED.VTVDY.A.KQP............................................sRSSNDEENEERTLSWVAAVRSVGA...FV......GVAFAM....R.........................RTPW...QS....T.........TQA........SATLALANPVLWYLIDRTRTG.FFMSTIV.GVGGMGI...VLA.....L..RPDLV.P-...PSTGApa.......................................saiP-ALNST..LR..DLGLGT..gIT............................QES...LAVRTWVASVLFSACVCFGNIGRQLA.....................................................
E7Q4S8_YEASB/102-290                   ..........................................................................................................................................................................................aaf---FILFIAGILFPMI.SECL.FDNDQLakgdiv..................................sflkhgiEIKNK.......IVAEPDMVPd......wAVFG.T...............EGVIFGSIVPFIDSFVRY.-----.-.---.............................................QHQPKTRSSVYKNTLGSFIRCANT...LL......GLIFGI....R.........................KLEW...SS....S.........LQA........AGAWSLLNIVLWLFFDGTLTV.FFPGLVI.GALSAFT...CS-.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------qcfsqlslalyfidfyffgflmfsklgrylf......................
INSI2_PAPAN/30-211                     ............................................................................................................................................................................................i-RGVVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-IAS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...DN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATLVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
G1SNI6_RABIT/30-211                    ............................................................................................................................................................................................i-RGVVLFFIGVFLALV.LNLL.QIQRNVtlf.........................................ppdV-IAS.......IFSSAWWVP........PCCG.T...............ASAVIGLLYPCIDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...DN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGVGI.AFLATVVt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITMGNIGRQLA.....................................................
M7CC78_CHEMY/30-211                    ............................................................................................................................................................................................i-RGIVLFFIGVLLALV.LNLL.QIQRNVtlf.........................................ppdV-ITS.......IFSSAWWVP........PCCG.T...............AAAVIGLLYPCMDR----.-----.-.---.............................................---HLGEPHKFKREWSSVMRCVAV...FV......GINHAS....A.........................KVDF...AN....N.........IQL........SLTLAALSIGLWWTFDRSRSG.FGLGIGI.AFLATLVs.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYVRSWLPCIFFAGGITVGNIGRQLA.....................................................
G4UNT1_NEUT9/220-499                   .............................................................................................................................................................................................LRTTLLFALGAGYGVL.VTRL.PNGDSV...............................................-----.......TGGYGWRYL........TFWG.A...............AGVVLGRLLPWFDQVWEE.TFGKR.T.RMTkkekerrraaaaaeaaaallqqapppssrtfprktpvtttlpvetDSNSGGVTSPPEADWPLVVRSIGA...FV......GIVFAI....R.........................RLPW...AS....T.........MQV........SITLALANPFLWYLIDRSKPG.FLLSAAV.GVTGSAI...LMG.....L.gNPDMM.PA...PVAGAgyhdhhflttsgq..................pamdvlngttsglP--RSAA..AR..MSGMGG...AS............................SENaavIETGIWMLSVLFCSCVCFGNIGRRLA.....................................................
G0RQC4_HYPJQ/188-419                   ............................................................................................................................................................................................s-RALVLFVLGAGYGVL.VTHL.HQEQGL...............................................LQLSDag...tgMPRYNGSYT........AMWG.Fa.............lAGVAMGALQPWVDGEWDR.IFGRQ.Q.DQEpe........................................adsDESLPDDAAKLETDWTLIMRAVGV...FA......GVAFAV....R.........................RLAW...TS....S.........TQV........SVAMALVNIFLWWLIDRTMAA.LVVSTIV.GAAGTLF...LLS.....V..SPDVI.RA...PSTTLvtqt....................................hnvsSAEPSAE..PA..ATILGG..iAS............................PET...VEAGIWILSVLFCTCLCFGNIGRRLA.....................................................
H2UHY6_TAKRU/34-215                    ............................................................................................................................................................................................i-RGGVLFSVGVFLALV.LNLL.QVQRNItl..........................................fppDVLSS.......IFSSAWWVP........PCCG.T...............AAAVIGLLYPTIDR----.-----.-.---.............................................---RLGEPHRFKREWSSVMRCVAA...FV......GINHAS....A.........................KVDF...AN....N.........VQL........SLTLAALSVGLWWTFDRSRSG.FGLGVSI.ALLATLAt.qLLV.....Y..NGVFQ.--...-----............................................-------..--..-----Y...TS............................PDF...LYIRSWLPCIFFAGVITMGNIGRQLA.....................................................
A0A0B2X9B1_METRA/164-380               .............................................................................................................................................................................................LRGTLLFVLGLGYGAL.VTRL.HNEQNQl............................................ppM-PDDs....ilKPGNNWKYL........TFWG.V...............AGIGLGSLLPWFDKLWED.TFGNE.G.DD-.............................................--SVVDKGASPGTDWALVMRAIGA...FV......GIIFAI....R.........................KLAW...VS....T.........LQV........SATLALVNPLLWWLIDRSKPG.FVLSAAV.GLTGSIL...LLG.....V..DPEIM.PA...PSGLPt..........................................rNSSNPFN..SD..PLALGG..lAT............................QQT...VETGVWMLSVLFCSCLCFGNIGRRL-t....................................................
V4U6K1_9ROSI/61-249                    ...........................................................................................................................................................................................is---LALFSAGFFLGPA.IDGL.HSRVNL...............................................VVYENgsi.nvgPLHTNIWVP........PLLG.L...............FYCTVGLLQLFLDD----.-TDSD.R.ASS.............................................ESEVPDDGSLQKTVFA--LITLLL...FI......ELSAEL....Y.........................KAGV...GD....N.........IEA........YI-LFAVAELIWFSLDRTWLG.FTLASII.GLVCPL-...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------aeipimklfhlwyypkanieilgqglvawtitcyfvytpflin..........
G0VI67_NAUCC/79-242                    ............................................................................................................................................................................................f-NLIVLSLFGIAYNEL.AFYL.YQSTII...............................................-----.......NKMSPLRFM........MFYG.Lprwm.......nyslEGVSLGFLVPLLDVLLFK.KTVTV.E.YPE.............................................TETEIGIGTEFDYGWGFMLAIINI...IM......GIIYGI....R.........................KLEW...DS....A.........MQS........AEAWYLLNIILWLLLDNGSLS.ILSSWIVlSLMGIVS...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------ncygggspcq...........................................
E7KDH3_YEASA/102-238                   ..........................................................................................................................................................................................aaf---FILFIAGILFPMI.SECL.FDNDQLakgdiv..................................sflkhgiEIKNK.......IVAEPDMVPd......wAVFG.T...............EGVIFGSIVPFIDSFVRY.-----.-.---.............................................QHQPKTRSSVYKNTLGSFIRCSNT...LL......GLIFGI....R.........................KLEW...SS....S.........LQA........AGAWSLLNIVLWLF-------.-------.-------...---.....-..-----.--...-----............................................-------..--..------...--............................---...--------------------------fx...................................................
D4A242_RAT/68-249                      ............................................................................................................................................................................................q-RSLVLFSFGVVLALV.LNLL.QIQRNVtl..........................................fpdE---Vi....atIFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCIGV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSLSG.LGLGITI.AFLATLIt.qFLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLLCIFFSGGVTVGNIGRQLA.....................................................
N4UPA1_FUSC1/109-326                   .............................................................................................................................................................................................LRGLLLFVLGVGYGVL.VTSRfHESDSL...............................................P---P.......RATYNWGHL........TFWG.L...............AGVALGALFPWFDRVWEN.SFGDR.G.DEAv...........................................lETSASAKDDDPSTDWALAVRAIGA...FV......GIVFAI....R.........................KVAW...AS....T.........LQV........SLTLALVNPLLWWLIDRSKPG.FLLSAAV.GLAGSVV...LLG.....V..NPDMM.PA...PTQVPfr.......................................hlvNATMAAD..GD..MPILGG..lAQ............................QKT...LETGMWMLSVLFCSCVCFGNIGRRL-t....................................................
E2RJ47_CANLF/82-263                    ............................................................................................................................................................................................r-RSLVLFSVGVVLALV.LNLL.QVQRNVtl..........................................fpeE---Vi....atIFSSAWWVP........PCCG.T...............AAAVVGLLYPCIDS----.-----.-.---.............................................---HLGEPHKFKREWASVMRCVAV...FV......GINHAS....A.........................KLDF...AN....N.........VQL........SLTLAALSLGLWWTFDRSRSG.LGLGITI.AFLATLIt.qLLV.....Y..N-GVY.--...-----............................................-------..--..----QY...TS............................PDF...LYIRSWLPCIFFSGGVTVGNIGRQLA.....................................................
C7YYL3_NECH7/153-376                   .............................................................................................................................................................................................LRGLVLFVLGVGYGIL.VTTR.PDSLKS...............................................LRGNM......iRPAYNWAHL........AFWG.F...............AGVALGALLPWLDRVWEE.SFGDD.G.EEAv..........................................aeNDGASTKDDGPSTDWALVVRAIGA...FV......GIVFAIv.wqR.........................KVAW...AS....T.........LQV........SLTLALVNPLLWWLIDRSKPG.LFLSAVV.GLTGSVL...LLG.....V..NPEIM.PA...PTHVAlg........................................nfSLGQDGD..HD..LPVLGG..lAR............................QET...LETGVWMLSVLFCSCVCFGNIGRRLA.....................................................
#=GC seq_cons                          ..............................................................................................................................................................................................+shlLFhhGlhhuhl.lshL.p.pcpl...................................................t.......hhpssWhh.........shhG.h...............uusslGhLhPhlDp................................................................p.scspphppcWusVhRslus...FV......GIsaAh....t.........................Klsa...ss....s.........lQl........SLTLAhls.sLWahhDRS+sG.FhLussl.uhluohl...lLs.....h..s.shh.........................................................................h...ss.............................-h...lhhtsWlsslhFsuslshGNIGRpLA.....................................................
//
DBGET integrated database retrieval system