GenomeNet

Database: Pfam
Entry: Imm35
LinkDB: Imm35
Original site: Imm35 
#=GF ID   Imm35
#=GF AC   PF15581.1
#=GF DE   Immunity protein 35
#=GF AU   Zhang D, de Souza RF, Anantharaman V, Iyer LM, Aravind L, Finn RD
#=GF SE   [1]
#=GF GA   25.00 25.00;
#=GF TC   137.30 137.10;
#=GF NC   21.80 19.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   22731697
#=GF RT   Polymorphic toxin systems: comprehensive characterization of
#=GF RT   trafficking modes, processing, mechanisms of action, immunity
#=GF RT   and ecology using comparative genomics.
#=GF RA   Zhang D, de Souza RF, Anantharaman V, Iyer LM, Aravind L;
#=GF RL   Biol Direct. 2012;7:18.
#=GF CC   A predicted immunity protein with an alpha+beta fold and YxxxD,
#=GF CC   WxG, KxxxE motifs. Proteins containing this domain are present
#=GF CC   in bacterial polymorphic toxin systems as an immediate gene
#=GF CC   neighbor of the toxin gene [1].
#=GF SQ   5
#=GS D8P0K2_RALSL/15-109  AC D8P0K2.1
#=GS E8RJV8_DESPD/16-108  AC E8RJV8.1
#=GS Q8XSL9_RALSO/16-108  AC Q8XSL9.1
#=GS G2ZW42_9RALS/16-108  AC G2ZW42.1
#=GS A9BQY9_DELAS/1-91    AC A9BQY9.1
D8P0K2_RALSL/15-109             VVVCVALAYRVFDQGITRTYLDASVESSDRHIKLLTSLIEEDWRGMTQEQVLRCLEAVAQKRPLGSTVLKRdqETGAILFEGVRFEFVDGKLVHV
E8RJV8_DESPD/16-108             IICCAFFAYFWIDRSISLDYLQQSYETERSSVANLQKLIASEWKGLPEGQVQKKLEQVAAKSPERRIVVKK..EGSIIWFDQVPFNIEQGRLDSV
Q8XSL9_RALSO/16-108             VSASILFAYLWIDRSISLSYARQGEDTAIGTVRGLELILEHEWRGLPEPEVFHKLNAVAAQGAGAKIVVKK..EGNIIWFDEVRFNFDEGRLKSI
G2ZW42_9RALS/16-108             VSTSVLFAYLWIDRSISLSYARQGEDTAIETVRGLELVIEHEWRGLPESEVLQKLNAVAAQGAGAKIVVKK..EGNVIWFDEVRFNLDEGRLKSI
A9BQY9_DELAS/1-91               --MIIYLSYSVVDKSITLSYSNQGCESARADIDNVISLIEREWRGLDMEQIKYKIKTASINKKEIDSQIKM..ENDLIWYGDVRFIFSSGRLVKV
#=GC seq_cons                   VssslhFAYhWIDRSISLSYucQGpETAcuoV+sLppLIE+EWRGLPEsQVh+KLcAVAApustu+IVVKK..EGslIWFD-VRFNF--GRLcSV
//
DBGET integrated database retrieval system