GenomeNet

Database: Pfam
Entry: LT-IIB
LinkDB: LT-IIB
Original site: LT-IIB 
#=GF ID   LT-IIB
#=GF AC   PF06453.7
#=GF DE   Type II heat-labile enterotoxin , B subunit (LT-IIB)
#=GF AU   Finn RD
#=GF SE   Pfam-B_61882 (release 9.0)
#=GF GA   25.00 25.00;
#=GF TC   139.10 139.00;
#=GF NC   20.80 19.00;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 80369284 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF WK   Heat-labile_enterotoxin_family
#=GF RN   [1]
#=GF RM   8805549
#=GF RT   Crystal structure of a new heat-labile enterotoxin, LT-IIb. 
#=GF RA   van den Akker F, Sarfaty S, Twiddy EM, Connell TD, Holmes RK,
#=GF RA   Hol WG; 
#=GF RL   Structure 1996;4:665-678.
#=GF DR   INTERPRO; IPR010503;
#=GF DR   SCOP; 1tii; fa;
#=GF CC   Family of B subunits from the type II heat-labile enterotoxin.
#=GF CC   The B subunits form a pentameric ring, which interacts with one
#=GF CC   A subunit.  Thus, the structural arrangement of type I and type
#=GF CC   II heat-labile enterotoxins are very similar [1]. 
#=GF SQ   11
#=GS A0A029MIL0_ECOLX/1-122  AC A0A029MIL0.1
#=GS H6W8F2_ECOLX/1-121      AC H6W8F2.1
#=GS H6W8F9_ECOLX/1-122      AC H6W8F9.1
#=GS E2BB_ECOLX/1-122        AC P43529.1
#=GS E2BB_ECOLX/1-122        DR PDB; 1QCB E; 1-99;
#=GS E2BB_ECOLX/1-122        DR PDB; 1QCB H; 1-99;
#=GS E2BB_ECOLX/1-122        DR PDB; 1QCB F; 1-99;
#=GS E2BB_ECOLX/1-122        DR PDB; 4FO2 D; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 4FNF B; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 1QB5 F; 1-99;
#=GS E2BB_ECOLX/1-122        DR PDB; 4FO2 S; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 4FO2 I; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 1TII H; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 1QCB G; 1-99;
#=GS E2BB_ECOLX/1-122        DR PDB; 4FO2 O; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 4FO2 P; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 4FNF J; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 4FNF D; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 1QCB D; 1-99;
#=GS E2BB_ECOLX/1-122        DR PDB; 4FP5 G; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 4FO2 Q; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 4FNF F; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 1TII F; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 4FNF A; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 4FO2 R; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 1QB5 H; 1-99;
#=GS E2BB_ECOLX/1-122        DR PDB; 4FO2 T; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 4FO2 M; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 1TII E; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 4FO2 K; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 4FNF G; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 4FP5 D; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 4FO2 B; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 4FO2 A; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 4FNF E; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 4FO2 H; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 1QB5 G; 1-99;
#=GS E2BB_ECOLX/1-122        DR PDB; 4FNF C; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 4FP5 F; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 1QB5 E; 1-99;
#=GS E2BB_ECOLX/1-122        DR PDB; 4FO2 G; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 4FO2 N; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 4FNF I; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 4FO2 L; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 4FP5 H; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 1QB5 D; 1-99;
#=GS E2BB_ECOLX/1-122        DR PDB; 4FO2 F; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 4FO2 E; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 4FO2 J; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 1TII G; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 4FO2 C; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 4FP5 E; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 1TII D; 1-98;
#=GS E2BB_ECOLX/1-122        DR PDB; 4FNF H; 1-98;
#=GS A0A029QD39_ECOLX/1-122  AC A0A029QD39.1
#=GS E9YZX4_ECOLX/1-122      AC E9YZX4.1
#=GS H6W8G2_ECOLX/1-122      AC H6W8G2.1
#=GS E2AB_ECOLX/1-122        AC P13812.1
#=GS N6VCR3_ECOLX/5-125      AC N6VCR3.1
#=GS H6W8G5_ECOLX/1-121      AC H6W8G5.1
#=GS L4JCT9_ECOLX/1-122      AC L4JCT9.1
A0A029MIL0_ECOLX/1-122             MSSKKIIGAFVLMTGILSGQVYAGVSEHFRNICNQTTADIVAGVQLKKYIADVNTNTRGIYVVSNTGGVWYIPGGRDYPDNFLSGEIRKTAMAAILSDTKVNLCAKTSSSPNHIWAMELDRE..
H6W8F2_ECOLX/1-121                 MNFKKSIALLFIALNIASLPTYAGVSKTFKDKCASTTAKLVQSVQLVNISSDVNKDSKGIYISSSAGKTWFIPGGQYYPDNYLSNEMRKIAMAAVLSNVRVNLCASEAYTPNHVWAIEL---ap
H6W8F9_ECOLX/1-122                 MNFKKSIALLFVVLNITSLPTYADVSKNFKDNCGSTTAKIVQSVRLVKLASDTNKDSKGIYITDSTGKTRFIPGGQYYPENYLSNEMRKIAMAAVLSNVRVNICASEAYTPNHVWAIELAAE..
E2BB_ECOLX/1-122                   MSFKKIIKAFVIMAALVSVQAHAGASQFFKDNCNRTTASLVEGVELTKYISDINNNTDGMYVVSSTGGVWRISRAKDYPDNVMTAEMRKIAMAAVLSGMRVNMCASPASSPNVIWAIELEAE..
#=GR E2BB_ECOLX/1-122        SS    XXXXXXXXXXXXXXXXXXXXXXX---HHHHHHHHTSSSEEEEEEEEEEEEEE-STTT-EEEEEETTS-EEEE---SSTTHHHHHHHHHHHHHHHHHHT-EEEEEEETTSSSEEEEEEEEE-X..
A0A029QD39_ECOLX/1-122             MSSKKIIGAFVLMTGILSGQVYAGVSEHFRNICNQTTADIVAGVQLKKYIADVNTNTRGIYVVSNTGGVWYIPGGRDYPDNFLSGEIRKTAMAAILSDTKVNLCAKTSSSPNHIWAMELDRE..
E9YZX4_ECOLX/1-122                 MSSKKIIGAFVLMTGILSGQVYAGVSEHFRNICNQTTADIVAGVQLKKYIADVNTNTRGIYVVSNTGGVWYIPGGRDYPDNFLSGEIRKTAMAAILSDTKVNLCAKTSSSPNHIWAMELDRE..
H6W8G2_ECOLX/1-122                 MNFKKSIALLFIALNIASLPTYAGVSKTFKDKCASTTAKLVQSVQLVKLASDTNKDSKGIYITDSTGKTRFIPGGQYYPENYLSNEMRKIAMAAVLSNVRVNICASEAYTPNHVWAIELAAE..
E2AB_ECOLX/1-122                   MSSKKIIGAFVLMTGILSGQVYAGVSEHFRNICNQTTADIVAGVQLKKYIADVNTNTRGIYVVSNTGGVWYIPGGRDYPDNFLSGEIRKTAMAAILSDTKVNLCAKTSSSPNHIWAMELDRE..
N6VCR3_ECOLX/5-125                 MNFKKSIALLFIALNIASLPTYAGVSKTFKDKCASTTAKLVQSVQLVNISSDVNKDSKGIYISSSAGKTWFIPGGQYYPDNYLSNEMRKIAMAAVLSNVRVNLCASEAYTPNHVWAIEL---ap
H6W8G5_ECOLX/1-121                 MNFKKLIALLFIVLNIASLPTYAGVSKTFKDNCASTTAKLVQSVQLVNISSDVNKDSKGIYISSSAGKTWFIPGGQYYPDNYLSNEMRKIAMAAVLSNVRVNLCASEAYTPNHVWAIEL---ap
L4JCT9_ECOLX/1-122                 MNFKALIKIFVFMISLVSIQTFAGVSQEFRTNCGGTTARIVEGVKLTQYFADANVNRKGIYVVSSTGGVWIIPGAQNYPDNYVADEMRKIAMAAILSDMKVNLCASEAYSPNHIWAIELDAE..
#=GC SS_cons                       XXXXXXXXXXXXXXXXXXXXXXX---HHHHHHHHTSSSEEEEEEEEEEEEEE-STTT-EEEEEETTS-EEEE---SSTTHHHHHHHHHHHHHHHHHHT-EEEEEEETTSSSEEEEEEEEE-X..
#=GC seq_cons                      MsFKKlIuhhhlhhsIsSl.sYAGVScpF+spCspTTAclVpuVQLsKhhuDVNpso+GIYlsSSTGtsWaIPGGp.YPDNaLSsEMRKIAMAAlLSss+VNLCASpA.oPNHlWAIELstE..
//
DBGET integrated database retrieval system