GenomeNet

Database: Pfam
Entry: LT-IIB
LinkDB: LT-IIB
Original site: LT-IIB 
#=GF ID   LT-IIB
#=GF AC   PF06453.6
#=GF DE   Type II heat-labile enterotoxin , B subunit (LT-IIB)
#=GF AU   Finn RD
#=GF SE   Pfam-B_61882 (release 9.0)
#=GF GA   25.00 25.00;
#=GF TC   139.10 139.00;
#=GF NC   20.60 19.00;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF WK   Heat-labile_enterotoxin_family
#=GF RN   [1]
#=GF RM   8805549
#=GF RT   Crystal structure of a new heat-labile enterotoxin, LT-IIb. 
#=GF RA   van den Akker F, Sarfaty S, Twiddy EM, Connell TD, Holmes RK,
#=GF RA   Hol WG; 
#=GF RL   Structure 1996;4:665-678.
#=GF DR   INTERPRO; IPR010503;
#=GF DR   SCOP; 1tii; fa;
#=GF CC   Family of B subunits from the type II heat-labile enterotoxin.
#=GF CC   The B subunits form a pentameric ring, which interacts with one
#=GF CC   A subunit.  Thus, the structural arrangement of type I and type
#=GF CC   II heat-labile enterotoxins are very similar [1]. 
#=GF SQ   7
#=GS H6W8G5_ECOLX/1-121  AC H6W8G5.1
#=GS H6W8F2_ECOLX/1-121  AC H6W8F2.1
#=GS H6W8F9_ECOLX/1-122  AC H6W8F9.1
#=GS E2BB_ECOLX/1-122    AC P43529.1
#=GS E2BB_ECOLX/1-122    DR PDB; 1TII F; 1-98;
#=GS E2BB_ECOLX/1-122    DR PDB; 1QCB E; 1-99;
#=GS E2BB_ECOLX/1-122    DR PDB; 1QB5 D; 1-99;
#=GS E2BB_ECOLX/1-122    DR PDB; 1QCB H; 1-99;
#=GS E2BB_ECOLX/1-122    DR PDB; 1QCB F; 1-99;
#=GS E2BB_ECOLX/1-122    DR PDB; 1QB5 F; 1-99;
#=GS E2BB_ECOLX/1-122    DR PDB; 1QB5 G; 1-99;
#=GS E2BB_ECOLX/1-122    DR PDB; 1TII G; 1-98;
#=GS E2BB_ECOLX/1-122    DR PDB; 1TII H; 1-98;
#=GS E2BB_ECOLX/1-122    DR PDB; 1TII D; 1-98;
#=GS E2BB_ECOLX/1-122    DR PDB; 1QCB G; 1-99;
#=GS E2BB_ECOLX/1-122    DR PDB; 1QB5 H; 1-99;
#=GS E2BB_ECOLX/1-122    DR PDB; 1TII E; 1-98;
#=GS E2BB_ECOLX/1-122    DR PDB; 1QB5 E; 1-99;
#=GS E2BB_ECOLX/1-122    DR PDB; 1QCB D; 1-99;
#=GS E9YZX4_ECOLX/1-122  AC E9YZX4.1
#=GS H6W8G2_ECOLX/1-122  AC H6W8G2.1
#=GS E2AB_ECOLX/1-122    AC P13812.1
H6W8G5_ECOLX/1-121             MNFKKLIALLFIVLNIASLPTYAGVSKTFKDNCASTTAKLVQSVQLVNISSDVNKDSKGIYISSSAGKTWFIPGGQYYPDNYLSNEMRKIAMAAVLSNVRVNLCASEAYTPNHVWAIEL---ap
H6W8F2_ECOLX/1-121             MNFKKSIALLFIALNIASLPTYAGVSKTFKDKCASTTAKLVQSVQLVNISSDVNKDSKGIYISSSAGKTWFIPGGQYYPDNYLSNEMRKIAMAAVLSNVRVNLCASEAYTPNHVWAIEL---ap
H6W8F9_ECOLX/1-122             MNFKKSIALLFVVLNITSLPTYADVSKNFKDNCGSTTAKIVQSVRLVKLASDTNKDSKGIYITDSTGKTRFIPGGQYYPENYLSNEMRKIAMAAVLSNVRVNICASEAYTPNHVWAIELAAE..
E2BB_ECOLX/1-122               MSFKKIIKAFVIMAALVSVQAHAGASQFFKDNCNRTTASLVEGVELTKYISDINNNTDGMYVVSSTGGVWRISRAKDYPDNVMTAEMRKIAMAAVLSGMRVNMCASPASSPNVIWAIELEAE..
#=GR E2BB_ECOLX/1-122    SS    XXXXXXXXXXXXXXXXXXXXXXX---HHHHHHHTTSSSEEEEEE-EEEEEEE-STTT-EEEEEETTS-EEEE---SSTTHHHHHHHHHHHHHHHHHHT-EEEEEEETTSSSEEEEEEEEE--..
E9YZX4_ECOLX/1-122             MSSKKIIGAFVLMTGILSGQVYAGVSEHFRNICNQTTADIVAGVQLKKYIADVNTNTRGIYVVSNTGGVWYIPGGRDYPDNFLSGEIRKTAMAAILSDTKVNLCAKTSSSPNHIWAMELDRE..
H6W8G2_ECOLX/1-122             MNFKKSIALLFIALNIASLPTYAGVSKTFKDKCASTTAKLVQSVQLVKLASDTNKDSKGIYITDSTGKTRFIPGGQYYPENYLSNEMRKIAMAAVLSNVRVNICASEAYTPNHVWAIELAAE..
E2AB_ECOLX/1-122               MSSKKIIGAFVLMTGILSGQVYAGVSEHFRNICNQTTADIVAGVQLKKYIADVNTNTRGIYVVSNTGGVWYIPGGRDYPDNFLSGEIRKTAMAAILSDTKVNLCAKTSSSPNHIWAMELDRE..
#=GC SS_cons                   XXXXXXXXXXXXXXXXXXXXXXX---HHHHHHHTTSSSEEEEEE-EEEEEEE-STTT-EEEEEETTS-EEEE---SSTTHHHHHHHHHHHHHHHHHHT-EEEEEEETTSSSEEEEEEEEE--..
#=GC seq_cons                  MsFKK.IuhhhlhhsIsSl.sYAGVScpFKDpCspTTAclVpuVQLsKhhSDlNpso+GIYlsSSTGtsWaIPGGp.YPDNaLSsEMRKIAMAAVLSssRVNlCASpA.oPNHlWAIELttE..
//
DBGET integrated database retrieval system