GenomeNet

Database: Pfam
Entry: Luciferase_N
LinkDB: Luciferase_N
Original site: Luciferase_N 
#=GF ID   Luciferase_N
#=GF AC   PF05295.6
#=GF DE   Luciferase/LBP N-terminal domain
#=GF PI   Luciferase; 
#=GF AU   Moxon SJ, Bateman A
#=GF SE   Pfam-B_7906 (release 7.7)
#=GF GA   25.00 25.00;
#=GF TC   104.80 104.10;
#=GF NC   20.80 16.40;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF WK   Luciferase
#=GF RN   [1]
#=GF RM   11747464
#=GF RT   Members of a dinoflagellate luciferase gene family differ in
#=GF RT   synonymous substitution rates. 
#=GF RA   Okamoto OK, Liu L, Robertson DL, Hastings JW; 
#=GF RL   Biochemistry 2001;40:15862-15868.
#=GF RN   [2]
#=GF RM   9256416
#=GF RT   Three functional luciferase domains in a single polypeptide
#=GF RT   chain. 
#=GF RA   Li L, Hong R, Hastings JW; 
#=GF RL   Proc Natl Acad Sci U S A. 1997;94:8954-8958.
#=GF DR   INTERPRO; IPR007959;
#=GF CC   This family consists of a presumed N-terminal domain that is
#=GF CC   conserved between dinoflagellate luciferase and luciferin
#=GF CC   binding proteins. Luciferase is involved in catalysing the light
#=GF CC   emitting reaction in bioluminescence and luciferin binding
#=GF CC   protein (LBP) is known to bind to luciferin (the substrate for
#=GF CC   luciferase) to stop it reacting with the enzyme and therefore
#=GF CC   switching off the bioluminescence function. The expression of
#=GF CC   these two proteins is controlled by a circadian clock at the
#=GF CC   translational level, with synthesis and degradation occurring on
#=GF CC   a daily basis [1]. However This domain is not the catalytic part
#=GF CC   of the protein.  It has been suggested that this region may
#=GF CC   mediate an interaction between LBP and Luciferase or their
#=GF CC   association with the vacuolar membrane [2].
#=GF SQ   14
#=GS Q5UAZ3_PRORT/1-79  AC Q5UAZ3.1
#=GS Q5UAZ7_9DINO/1-79  AC Q5UAZ7.1
#=GS Q5UAZ4_PYRNO/1-82  AC Q5UAZ4.1
#=GS Q8W209_PYRLU/1-82  AC Q8W209.1
#=GS Q39913_LINPO/1-85  AC Q39913.1
#=GS Q5UAZ5_9DINO/1-82  AC Q5UAZ5.1
#=GS B1P1K4_ALECA/1-78  AC B1P1K4.1
#=GS Q39911_LINPO/1-85  AC Q39911.1
#=GS Q8W210_PYRLU/1-82  AC Q8W210.1
#=GS Q7XYY5_PYRLU/1-76  AC Q7XYY5.1
#=GS Q39910_LINPO/1-85  AC Q39910.1
#=GS O77206_LINPO/1-83  AC O77206.1
#=GS Q39909_LINPO/1-85  AC Q39909.1
#=GS Q5UAZ6_ALETA/1-79  AC Q5UAZ6.1
Q5UAZ3_PRORT/1-79             MA-..ELACFLTKDAKVDASVAAYVTKQLQLESVADFANYWTACEYERGVQDDVISQIELFK--.SGPAGKLQVARLRAAWQGAQ.
Q5UAZ7_9DINO/1-79             MA-..ELIRFLTDDANIDASVAAYVTKQLQLESVADFANYWTRDEYERGVQDDVISQIELFR--.SKPAGKLQVARLRAAWQRAQ.
Q5UAZ4_PYRNO/1-82             MSA..QLTGFLTKDAKLDPRIVEYITKTLLMENISDFSNSWTSTEYETGVRDDIVLNVAAFQNT.SQAASKVQIARLRAAWRLAQ.
Q8W209_PYRLU/1-82             MSR..EFAAFLTNDAKLDPTVVTYMTRDLKLDSISDFANYWTTGDYEKGVQDDIVRKVPAFQDT.SKAASKVQVARLRAAWLSAQ.
Q39913_LINPO/1-85             MASrgQLVQFLANEGKVDQKVIAYMTNQMKLTSVSDFANYFTSSEFEKGVQDDIVAQVSPFNADvSKPDAKIQTARLRAAWKAAQ.
Q5UAZ5_9DINO/1-82             MSA..QFTGFLTNDAKLDPRVVEYMTKTLQLESISDFANFWTSDEYENGVRDDILLNVAAFQNT.SQAATKIQVARLRAAWRLVQ.
B1P1K4_ALECA/1-78             MS-..SLAQFLSSDARVDAKIVSYMTQTLKLETVSDFANFWTAAEYEKGVQSDIIQKLPGLQ--.-DAASRLQTARLRAAWKLAQ.
Q39911_LINPO/1-85             MASrgQLVQFLANEGKVDQKVIAYMTNQMKLASVSDFANYFTSTEFEKGVQDDILAQVAPFNADlSKPDAKIQTARLRAAWKAAQ.
Q8W210_PYRLU/1-82             MST..QFLTFLTNDAKLDPNIVTYMTRDLKLESIADFAHLWTTGEYEKGVQDDIVRKVPAFQDT.SKAPSKVQIARLRAAWLSAQ.
Q7XYY5_PYRLU/1-76             MA-..ELQAFL-QEAKVDPKVIGHITKALPHKSVADFAKGWTSANFEQGMQNDIVAKTGL----.SGMEAKLQVSRLRAAWKAA-s
Q39910_LINPO/1-85             MASrgQLVQFLANEGKVDQKVIAYMTNQMKLTSVSDFANYFTSSEFEKGVQDDIVAQVSPFNADvSKPDAKIQTARLRAAWKAAQ.
O77206_LINPO/1-83             MAA..QLEQFLVNEGQVDQRAVTYMLKGLQLESLSDFASFWTSKDYENGVRDDIISKVAPFNSDlSLPAAKLQVARLRAAWRKAQ.
Q39909_LINPO/1-85             MASrgQLVQFLANEGKVDQKVIAYMTNQMKLTSVSDFANYFTSSEFEKGVQDDIVAQVSPFNADvSKPDAKIQTARLRAAWKAAQ.
Q5UAZ6_ALETA/1-79             MA-..ELVRFLTDEANIDASVAAYVTKQLQLESVADFANYWTRDEYERGMQDDIISQLELFR--.SKPAGKLQVARLRAAWQGAQ.
#=GC seq_cons                 MAt..pLspFLss-AKlDs+VluYMT+pLpL-SVSDFANaWTosEYE+GVQDDIlupVssFpss.ScssuKlQlARLRAAW+uAQ.
//
DBGET integrated database retrieval system