GenomeNet

Database: Pfam
Entry: MCR_beta_N
LinkDB: MCR_beta_N
Original site: MCR_beta_N 
#=GF ID   MCR_beta_N
#=GF AC   PF02783.13
#=GF DE   Methyl-coenzyme M reductase beta subunit, N-terminal domain
#=GF AU   Mian N, Bateman A, Griffiths-Jones SR
#=GF SE   Pfam-B_2692 (release 5.2)
#=GF GA   20.90 20.90;
#=GF TC   239.70 239.00;
#=GF NC   19.60 18.50;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   9367957
#=GF RT   Crystal structure of methyl-coenzyme M reductase: the key enzyme
#=GF RT   of biological methane formation 
#=GF RA   Ermler U, Grabarse W, Shima S, Goubeaud M, Thauer RK; 
#=GF RL   Science 1997;278:1457-1462.
#=GF DR   INTERPRO; IPR022680;
#=GF DR   SCOP; 1mro; fa;
#=GF CC   Methyl-coenzyme M reductase (MCR) is the enzyme responsible for 
#=GF CC   microbial formation of methane. It is a hexamer composed of 2
#=GF CC   alpha (Pfam:PF02249), 2 beta (this family), and 2 gamma
#=GF CC   (Pfam:PF02240) subunits with two identical nickel porphinoid
#=GF CC   active sites [1]. The N-terminal domain has an alpha/beta
#=GF CC   ferredoxin-like fold.
#=GF SQ   56
#=GS D1YVW2_METPS/6-187      AC D1YVW2.1
#=GS L0HAZ8_METFS/6-185      AC L0HAZ8.1
#=GS MCRB_METTH/6-187        AC O27236.3
#=GS A6UWG8_META3/6-187      AC A6UWG8.1
#=GS A2SSC9_METLZ/6-186      AC A2SSC9.1
#=GS Q0W343_METAR/6-187      AC Q0W343.1
#=GS A2STS3_METLZ/6-186      AC A2STS3.1
#=GS D5VQV2_METIM/5-186      AC D5VQV2.1
#=GS J1L3J4_9EURY/6-187      AC J1L3J4.1
#=GS F0TCV2_METLA/6-187      AC F0TCV2.1
#=GS A3CT50_METMJ/6-185      AC A3CT50.1
#=GS U6EEC5_9EURY/6-187      AC U6EEC5.1
#=GS M4YU68_9EURY/6-186      AC M4YU68.1
#=GS J1L1E2_9EURY/6-186      AC J1L1E2.1
#=GS E1RDX8_METP4/6-185      AC E1RDX8.1
#=GS A5ULZ6_METS3/6-187      AC A5ULZ6.1
#=GS D5EAE0_METMS/3-184      AC D5EAE0.1
#=GS E3GZ55_METFV/6-187      AC E3GZ55.1
#=GS K4MLG8_9EURY/3-184      AC K4MLG8.1
#=GS B8GE89_METPE/6-187      AC B8GE89.1
#=GS F4BXY4_METCG/3-184      AC F4BXY4.1
#=GS Q12TF4_METBU/3-184      AC Q12TF4.1
#=GS A5ULN2_METS3/6-187      AC A5ULN2.1
#=GS A3CSF8_METMJ/6-185      AC A3CSF8.1
#=GS L0L0T9_METHD/3-184      AC L0L0T9.1
#=GS Q2NI03_METST/6-186      AC Q2NI03.1
#=GS MCRY_METJA/6-187        AC Q60390.2
#=GS U6ECJ3_9EURY/6-187      AC U6ECJ3.1
#=GS F1SVF3_METKA/7-188      AC F1SVF3.1
#=GS R9SMM9_9EURY/6-187      AC R9SMM9.1
#=GS L0HFT2_METFS/6-187      AC L0HFT2.1
#=GS A0B6N9_METTP/3-184      AC A0B6N9.1
#=GS H1YXI3_9EURY/6-185      AC H1YXI3.1
#=GS Q2FSD8_METHJ/6-185      AC Q2FSD8.1
#=GS Q8PXH4_METMA/3-184      AC Q8PXH4.1
#=GS E1RJD7_METP4/6-187      AC E1RJD7.1
#=GS G7WN21_METH6/3-184      AC G7WN21.1
#=GS A7I5U3_METB6/6-187      AC A7I5U3.1
#=GS A0A0E3SPU0_METMT/3-184  AC A0A0E3SPU0.1
#=GS Q8THG7_METAC/3-184      AC Q8THG7.1
#=GS M9S9U8_9EURY/6-185      AC M9S9U8.1
#=GS MCRB_METBF/3-184        AC P07955.3
#=GS MCRB_METBF/3-184        DR PDB; 1E6Y E; 5003-5184;
#=GS MCRB_METBF/3-184        DR PDB; 1E6Y B; 2003-2184;
#=GS A0A0E3S0F2_9EURY/3-184  AC A0A0E3S0F2.1
#=GS D7DUH1_METV3/6-187      AC D7DUH1.1
#=GS A0A0A7LAU1_9EURY/6-185  AC A0A0A7LAU1.1
#=GS MCRY_METFV/6-187        AC Q49171.1
#=GS MCRY_METTH/6-187        AC P21111.4
#=GS F0T8Q9_METLA/6-185      AC F0T8Q9.1
#=GS F6D2D7_METPW/6-187      AC F6D2D7.1
#=GS R9T893_9EURY/6-186      AC R9T893.1
#=GS A0A0E3NTF4_9EURY/3-184  AC A0A0E3NTF4.1
#=GS F7XL10_METZD/3-184      AC F7XL10.1
#=GS D7E8Y1_METEZ/3-184      AC D7E8Y1.1
#=GS D3E054_METRM/6-187      AC D3E054.1
#=GS MCRB_METJA/9-190        AC Q58252.2
#=GS Q6LWZ9_METMP/6-187      AC Q6LWZ9.1
D1YVW2_METPS/6-187                 .DKIDLYDDKGKLLEKDVPLEAISPVINPAIRKIVNLTKRTVAVSLEGIESALKTGKVGGKGRQVLGRSLDLSIVKDADKIAKVVADTVRI.NKSDDTAVKVIGGGKSLLVQVPTQRVEAGAEFVASLSCTASAVTEAIIDMYKVDMFDGPFVKNAVWGMYPQTMDLVGGNVKMILEIPQKDEG.
L0HAZ8_METFS/6-185                 e-TIDLYSDDGKLLKSNVQLHRISPLLNPAARTIVDLTKRTINVNLAGIEEALKTARLGK--GRIPGRELDLPIMEKKDELIAKIREMVQV.EEGDDTGIQQFNGGKLLLVRAPTLRLSGASTYDAAITAVASAVTYAIVDTFDIDAFNASTVKAAAWGSYPHTQDMEGALVTSILTIPQNNEG.
MCRB_METTH/6-187                   .DKVDLYDDRGNLVEEQVPLEALSPLRNPAIKSIVQGIKRTVAVNLEGIENALKTAKVGGPACKIMGRELDLDIVGNAESIAAAAKEMIQV.TEDDDTKVELLGGGKRALVQVPSARFDVAAEYSAAPLVTATAFVQAIINEFDVSMYDANMVKAAVLGRYPQSVEYMGANIATMLDIPQKLEG.
A6UWG8_META3/6-187                 .DKINLYDAKGNLAEENVPLEAISPLYNPVVKDMVKSIKRTVAVNLAGIEATLKAGTIGGKACRVPGRTLDLPIVDEAEAIMDKVEKILKI.SEDDDTNIRTINGGKQAVVQVPSKRLDIAAEYSVSMLSTGMALKEAIIDTFDVDMFDGSTVHAAIVGRYPQVMDYMGGNIASLLGAPSNMEG.
A2SSC9_METLZ/6-186                 .DVIDLYDDYGKLLRSNISLERISPLVNPAVKKIIDDTKRSVAVNLGGMQDGLKSGKIGK-HQQILGRELDLDILGNIDAIEAKIKEYVSV.ESGDDTEIKRFNGGKLLLVKVPSARIAAAATYDAALTSVAAATTYAVVEQFNVDMFNANTVKAAAFGTYPVTMDLAGGACSMIMSIPQNNE-s
Q0W343_METAR/6-187                 .DKIDLYDDKGKLLEKDVPLEAVSPIVNPAIRKIVNLTKRSVSVSLEGIENALKTGKVGGKGRQVLGKSLDLPLTKDADKIAKKIEELVRV.TKGDDTNVKVLGGGKSLLVQVPTQRIEAGAEFVAGISSTATATVESILELYKVDMFDGAFVKAAVWGMYPQTIDLEGGNVKSILDVPQKDEG.
A2STS3_METLZ/6-186                 .DVIDLYDDNGKLLKSNVALEKISPLVNPAIKKIIDDTKRTVAVNLGGMQDALKTGKIGK-HQQILGRELNLDIVGNIDAIEAKIKEYVSV.EAGDDTMIKRYNGGKLLLVKVPSARIAAAATYDAALTSVAAATTYAVVEQFNVDMFDANTVKAAAFGTYPVTMDLAGGACSMIMSIPQNNE-s
D5VQV2_METIM/5-186                 .DTIDLYDEKGKLVEENVPLEAISPLYNPTIQKLVKDVKRTVAVNLAGIENALRTGQVGGKGCKILGRELDLPIVENAETIAEYVEKTLRV.SEDDDTSIKLINDGKQMAVQVPSKRLDIAAEYTISTLVTAQALKEAIIRTFDVDLFDAPMIHAAILGGYPHDVTMKGANISALLGNPLTLE-c
J1L3J4_9EURY/6-187                 e-TIDLYSDDGKLLKSGVTLDKISPLVNPATSKIIDLTKRTINVNLGGIQNALKTGKLGKGKSKIRGRELDLAIMENKDAIVARIKEMVQV.EEGDDTEILEFNNGQLLLVQVPKKRLMNAATYDAAITAVASATTYAIVDQFNIDAFNASTVKAACWGGYPHTMDMEGALVSSILSIPQNNEG.
F0TCV2_METLA/6-187                 .DKIDLYGVNGKLLESDVPLEAVSPMVNPTIGKIVYDVKRSVAVNLAGIEKSLEKAAYGGKSNFIPGRELKLDLKGNVDVLSEKIEKIIKI.DEDDDFNLKLINGGDQMLVQMPAQRINRAADYTVSTLVAGGAVVQAIIDTFDVDKFDASAVKTAVLGRYPQSVDFMGANVSALLGPPVMLEG.
A3CT50_METMJ/6-185                 e-TIDLYDDAGKQLKSGVPLEKISPLVNPATRKLIDLTKRTIAVNLGGIQEGLKTGKVAK--GYVLGREMNLDIIGNKDAIIGKIKEMVQV.EEGDDTNIREFGGGKLILVEVPKTRLEAASTYDAAITSVASATTFSLVEQFDIGAFDAAMVKAAVWGGYPHTMDLTGANVTSILSIPQNNEG.
U6EEC5_9EURY/6-187                 .DKVDLYDDRGNLVEAEVPIEALSPLRNPAIKSIVQGIKRTVAVNLEGTENALKAAKVGGPACKILGRELDLDIVGNAEAIAAKAKEMIQV.EEGDTTNVELLGGGKRALVQIPHTRFDAAAEYSAAPLVTANAFIQAIIDVCDVSMYDANMVKAAILGRYPQSVEYLGGNIATMLDIPQKLEG.
M4YU68_9EURY/6-186                 .DVIDLYDDYGKRIAKGVPLEAISPLRNKAIQKIASLTKRTVVVSLAGIEKALKTGAVGG-NNWIAGKEIDAPIVADAEKLAKDIKAMVQV.TEDDGTQVIVKDGGKSLTVIVPEARTDAGIEYTTGFTTVAAATTEAIIDRYKVPMYKANMVKAAVWGRYPQTINFVGSNIKSILEVPQNNEG.
J1L1E2_9EURY/6-186                 .DTIDLYDDEGKLLKSGVALEKVSPVVNPAIKKMMDLTKRTVAVNLAGIENGVKTGAVGGKANVIPGRTLDLSVVKDSDAIIAKIKDMVSV.VEGDDTVIKNF-GGKLLLVEVPKARIEAAATYDAAITSVAAATTYALIDQYNIGPFDAGIIKSAVWGTYPQTMDMAGANVQSILSIPQNNEG.
E1RDX8_METP4/6-185                 e-TIDLYSDDGKVLKSNVNLGAISPLVNPATLKLIDLTKRSIAVNLGGIEAALKTGKLGK-GGMIMGRELDLPIMANKDAIVAKIKDMLDV.-EGEGTVINEYKGGNLLLVEAPKARLAAASTYDAAFTAVAAATTYAIVDQFDIDAFNASTVKAATFGGYPHTMDPEGALVTSVLSNPQNNEG.
A5ULZ6_METS3/6-187                 .DKVDLYDDRGSLVVSDVPIEALSPLRNTAIQNIVKGVKRTVAVNLEGLEKSVKTGSVGGDKSKILGRELDIDIVANAGAIAEKMKEMIQI.SEDDDTKVEPISGGKRLLVQVPSKRIDVAAEYSVAPLSTATSLVQAIIDVCDVSIYDANFVKAAVLGRCPQSVDYKGSNIATMLDIPQKLEG.
D5EAE0_METMS/3-184                 .DKIDIYDDRGKLLESGVAIEELAPTRNAAIQRIIGDTKRTVAVNLGGIQKSLATGKMGGKARHMPGREMELDIVENAGAIADSVKEFVQV.DSDDDTNIETLGGGKQLLVQLPTARLTAGADYSSALTVSAAATVQTIVDMFNIDMFNAPVVKGAVWGNYPQTMDMAGGNIASILNIPQKNEG.
E3GZ55_METFV/6-187                 .DKVDLYDDRGNLVEEQVPIEALSPLRNTAIKKIIHDIKRTVAVNLEGIENALRSAKVGGSGCHIPGRELDVDVIDNAEAIAEKAKEMIQV.EEGDDTVVELLHDGKRALVKVPSSRLESAAEYSVAPLVTASAFIQSIIDVCDISIYDANMVKAAVLGRYPQSVEYVGGNIATMLDIPQKLEG.
K4MLG8_9EURY/3-184                 .DKIDIYDDRGKLLESGVDLMDIAPTRNAAIQNIIKDTKRTVAVNLAGIEKALESGKMGGLGRKILGRELKYDVVANASAIQDAVKGFVMA.KEGDDTNVKVLAGGKQLLVQVPSVRALVGADYVSASTVTGAAVVQAIIDMYKTDMFDAPIVKSAVWGSYPQTMDMMGGNIASILSIPQNNEG.
B8GE89_METPE/6-187                 e-TIDLYDDEGKLLKSGVNLEKISPLVNPGIKKIIDLTKRTIAVNLNGIQEGLKSGKLGGKANQILGRSLNYDIVKDHEAITERIKKMIEV.EEGDDTTIRTIGNGKMLMIEVPSARLASASTYDAAITSVASATTLALLDQYNIGMFDASVVKAAVWGTYPQTMDMQGANVVSILSIPQNNEG.
F4BXY4_METCG/3-184                 .DKIDLYSDRGVLLKSDVDLSAVSPLKNAAMQRLISLTKRTVAVNLAGVEGALKTGKVAGGRRQIKGRELNYDVVANAGALAEKIKTLLQV.APGDDTNVQILGGGKQLLVQVPTARVNAASEFVVGLTGAASATVEALIQQFKVGIVEAPMVHASVWGEYPQTVGMNGGNVASVLNIPQNDEG.
Q12TF4_METBU/3-184                 .DKVDIYDDRGTLLESDVDILNLAPTTNTAIGKIIKDTKRTVAINLAGIEKGLATGKYGGKGRQILGRSLEYDIVGNADAIAESVANLVKV.SNDDDTVVKVIGGGKQLLVQVPSARTDAGADFVSGSTVSGAAVVETIINTFNTDMFDAPLVKGAVWGSYPQTMDMSGGNVASILSIPQQNEG.
A5ULN2_METS3/6-187                 .DKIDLYGQDGKLLKSEVSLDAISPLKNPAIAKMIFDIKRSCAVNLASIEKGLRTGAMGGKSVFIPGRELDLPIVENAELIADKIKRIVQV.NEDDATNVSLINNGQQLLIQLPNERLRVAADYSIASLLSGSATIQSIIDTFDINMFDASTIKTAVMGAYPQTVDLAGANISALLGPPVLLEG.
A3CSF8_METMJ/6-185                 e-TIDLYSDDGKLLKSGVALDRISPLVNPATGKIIDLTKRTISVNLGGIQDALKVGKLGK--GKIKGRELDLPIMENKDAIVAKIKEMIQV.EEGDDTEIMEFNGGKLLLVQVPTKRLVNASTYDAAITSVAAATTFSIVDQFNIDAFNASTVKAACWGSYPHTQDMEGALVTSILTIPQNNEG.
L0L0T9_METHD/3-184                 .DKIDIYDDKGKLLESGVDLMDIAPTRNAAIQKIVKDTKRTVAVNLAGIENALASGKMGGAGRRILGRELKYDIVANASAIQDSVAKLIQV.NKDDDTNVQVLAGGKQLRVQVPSLRTAIGADYVSASTVGAAAVVQTIIDMYKVDMFDAPIVKGAVWGSYPQTMDMMGSNVASILSIPQNNEG.
Q2NI03_METST/6-186                 .DKIDLYGVDGKLLEEQVPLEAISPVINPTIKNIIQEIKRSVAINLAGIEKSLANGAYGGKANFIPGRELELDIVDNADAIADKIEKMLKI.SDDDDFNLNLLNGGKQILVQVPSERLSIAGDYSVAPLATGSALIQAILDTFDINKYQASEIKTAAMGGYPHNVKL-GGALTTLLGQTTHLEG.
MCRY_METJA/6-187                   .DRIDLYDERGKLLEENVPLEAISPLKNPTIEKIVNDIKRSVAINLAGIENALKTGAVGGKACFCPGRELDLPIVENAEIIAEKIKRMVQI.EEDDDTVVKLINGGKQLLLQLPSKRLRVAADYTVSALIGGGATVQAIVDAFDVDMFDAPVVKTAVMGRYPQTVDFHGANIATLLGPPVLLEG.
U6ECJ3_9EURY/6-187                 .DKIDLYGADGKLLESDVPLEAVSPMLNPTIENIVQTVKRSVAVNLAGIEKSLEKAAYGGKANFIPGRELKLPIVDNVDTIAAKIEKMIRV.DEEDDFNLKLINKGQQLLVQLPSQRMKMAGDYTVSTMVTGSAVVQAIIDTFDVDKFDASAIKTAVLGQYPQTVDFSGANVSALLGPPQMLEG.
F1SVF3_METKA/7-188                 .DTVDLYDDRGNCVAEEVPIEVLSPMRNEAIQSIVNDIKRTVAIDLEGIENALQNATVGGKGMKIPGREMDVDIVDNAEAIADEIEKMIRV.YEDDDTNVEPMYDGKRLLVQLPSERVKVMADPYSGTLQAGMAVVHAIIDVCEVDMWDANMVKAAVFGRYPQTIDYFGGNVASMLDVPMKQEG.
R9SMM9_9EURY/6-187                 .DKVDLYDDRGTLIDSDVPIEALSPVRNPAIKEITAGIKRTVAVNLEGIENSLRNAAVGTKASKILGRELDLDIVANVDAIAASVKKMIQV.TEDDDTVVEPLSGGKRLLVQVPTRRIDVAAEYSVATLATSTALTQAIVETCDVSMYDANMVKAAILGMYPQTVSYDGSNIKTMLDVPQKLEG.
L0HFT2_METFS/6-187                 .DTIDLYDDEGKLLKSNVTIDKISPLVNKGTAGIIDLTKRTVAVNFAGIEEALKTGKFGGKSNQILGRSMSCSCVKDCDALAAKIKEYVQV.EAGDDTKITKVGGGKMILVEIPTARIRAAATYDCASTAVAAATTYALIEQYKVGMFDGAYVKGAVWGTYPQTMSMDGGNVVTIMSIPQNNEG.
A0B6N9_METTP/3-184                 .DKIDIYSDRGVLLKSDVDLSAISPLRNAAIQKLAKLTRRTVAVNLAGIENALKTGRVGGGRRQIKGRELNYDIVANASALAEKIKALLQV.TPGDDTNVQVLGGGKQLLVQIPSARAEIASEFVVGMTAAAAATVEAIIQHFKAGLFDAPMIHAAVWGEYPQTVGMNGGNVASVLNIPQNDEG.
H1YXI3_9EURY/6-185                 .DTIDLYSDDGKLLKSGVELNKISPLVNPATLKLIDLTKRSIAVNLGGIEAALKSGKLGK-GGKILGRELDLPIMANKDAVIAKIKEYVDV.-EGEETTIREFKGGNLLLVEVPKARLNAASTYDASITAVAAATTYAIVDEFGVDMFDASAVKAATFGAYPHTMDMEGALVSSVLANPQNNEG.
Q2FSD8_METHJ/6-185                 .DTIDLYDDQGKLLKSGVALDKVSPLTNAGIKKMISLTKRTVAVNLGGAEAFLKTGKAGK--NQIPGRELNLDLVANAGAIKEKMFKMLQV.TEGDDTEIKEFGGGKLLLCTVPTARIEAAATYDAAMTAVSAAATYAVIDQFNVDMFNGSTVKAAFWGTYPQTMDPSGSACASILSIPQNNEG.
Q8PXH4_METMA/3-184                 .DTVDIYDDRGKLLESNVDIMSLAPTRNAAIKKIILDTKRSVAVNLAGIQGALASGKMGGKGRQILGRGLNYDIVGNVDAIAANVKKLVQV.DEGDDTNVRVLKGGKSLLIQAPSSRMAAGADFMAATTVGAAAVTQTLIDMFKTDLYDAPIVKSAVWGSYPQTMDLMGGQVQGILSIPQNNEG.
E1RJD7_METP4/6-187                 .DTIDLYSDDGKLLKSDVNLRQISPMINPAAGKIIDLTKRTINVNLGGIETALKTGRLGKHKSRIRGRELDLPIMENKDALVEKIRSMIQI.EDDDDTEILEFNNGNLLLVQVPSKRLINAATYDAAITSVASATTYAIVDHFDIGAFDASVVKAACWGAYPQTMDMEASLVTSILSIPQNNEG.
G7WN21_METH6/3-184                 .DKIDLYSDRGVLLKSDVDLSAVSPLKNAAMKKLINLTKRTVAVNLAGIENALKTGKVGGQGRQIKGRELKYDVVANANALAAEIKKLLQV.EAGDDTNVQVLGGGKQLLVQIPTARVDAASEFVVGMTATAAATCEALVTQFKAGMFEAPMVHAAVWGQYPQTVPMAGGNIASVLNIPQNDEG.
A7I5U3_METB6/6-187                 .DTIDLYDDEGKLLKSNVTIDKISPLTNKGALELIDLTKRTVAVNLGGIEEALKTGKMGGKSNQILGRGLNYSIVKDADAISAKIKDMIQV.TDGDNTKITKIGGGKMLLVEVPSSRINASATYDATSTSVASATTYALIDQYKVNMFDGSYVKGAVWGTYPQTMDMQGGNVVSILSIPQNNEG.
A0A0E3SPU0_METMT/3-184             .DKVDIYDDRGTLLESGVDIMALAPTTNAAIGKIIKDTKRTVAVNLAGIEKGLATGKYGGKGRQILGRGLEYDIVGNADAIAESVANLVKT.SDDDDTNVKVIGGGKQLLVQVPSARTDAGADFVSGSTVSAAAVVQTIIDTYNTDMFDAPLVKGAVWGSYPQTMDMSGGNVASILSIPQQNEG.
Q8THG7_METAC/3-184                 .DTVDIYDDRGKLLESNVDIMSLAPTRNAAIKKIILDTKRSVAVSLAGIQGALASGKMGGKGRQILGRGLNYDLVGNADAIAENVKNLVQV.DEGDDTSVKVIKGGKSLLIQAPSSRIAAGADYMSATTVGAAAVTQTIIDMFGTDMYDAPIAKSAVWGSYPQTMDLMGGNVQGVLSIPQNNEG.
M9S9U8_9EURY/6-185                 .DVIDLYDDYGKRIAKDVPLEAISPLRNKAIQKIASLTKRTIAVNLAGIEKALATGQIGG--SKIAGKEIEVPLVKDAKKLADDIKAMVQV.TEGDDTVVEVKNDGKLIVVIVPEDRLNAGVEYTTGFTAVAAAITEAIIDRYKVPMYKANMVKGAVWGQYPQTVNFAGSNIKTILEVPQMNEG.
MCRB_METBF/3-184                   .DTVDIYDDRGKLLESNVDIMSLAPTRNAAIQSIIMDTKRSVAVNLAGIQGALASGKMGGKGRQILGRGLNYDIVGNADAIAENVKKLVQV.DEGDDTNVIKVKGGKSLLIQSPKSRIIAGADFMSATTVGAAAVTQTIMDMFGTDPYDAPIVKSAVWGSYPQTMDLMGGQVQGILSIPQNNEG.
#=GR MCRB_METBF/3-184        SS    .-EEEEE-TTS-EEEEEEEGGGGSTTT-HHHHHHHHHHHHEEEEEHHHHHHHHHH---SSTT---TT------TGGGHHHHHHHHHHHH-S.STTSS-EEEEECCCTEEEEE--HHHHHTSSSSTHHHHHHHHHHHHHHHHHTT--GGGHHHHHHHHHTTTTTSSS-TT-SEE-SS--GGG-SS.
A0A0E3S0F2_9EURY/3-184             .DTVDIYDDRGKLLESNVDIKNLAPTRNAAIKKIILDTKRSVAVNLAGIQGALASGKMGGKGRQILGRGLNYDIVGNVDAIAESVKKLIQV.DEGDDANVKIFKGGKSLLVQVPESRILSGADYMSATTVGAAAVTQTVLDMFKTDMYDAPIVKSAVWGSYPQTMDLMGGNVAGILNIPQNNEG.
D7DUH1_METV3/6-187                 .DKICLFDAKGNQVAEDVPLEAISPLNNPTIMGMVKNIKRTVAVNLAGVEDSLAKGKIGGKGCQVPGRAIELDVVSDAEAIADKVKSILQV.SAGDDTEVKLINGGKQMAVQVPTKRLDVAAEYSVSMLATGMALKEAIITNFNVDMFDGSTVHSAIMGQYPQDMDYAGGNIASLLGAPSKLEG.
A0A0A7LAU1_9EURY/6-185             .DVVDLYDDNGKRIAKDVPLEAISPLRNNAIKKIASLTKRTVAVSLAGIEKGLKSGAVGG--SMIKGKEIDIELVKNAKKIAAAVKDKVQV.TADDGTVVTIKGDGKSLVVIVPAARTDAGVEYTTGFTAVAAAVTEAIIDEFKVPMYKANMVKAAVWGRYPQTVGFDGANVKSILEIPQNNEG.
MCRY_METFV/6-187                   .DKIDLYDANGKLLDENVPLEAISPLKNPTIGKIVNDVKRSVAVNLAGIENSLKKAALGGKANFIPGRELDLDIVENAEIIAEKIKKMVQV.DENDDTNVKMINNGQQLLVQVPTIRIERAADYTVSTLVAGAATIQAIIDTFDVDMFDASTVKTAVLGRYPQTVDFTGANVAAMLSPPVLLEG.
MCRY_METTH/6-187                   .DRIDLYGADGKLLEEDVPLEAVSPLKNPTIANLVSDVKRSVAVNLAGIEGSLKKAALGGKSNFIPGREVELPIVENAEAIAEKVKRLVQT.SEDDDTNIRLINNGQQILVQVPTTRMGVAADYTVSALVTGAAVVQAIIDEFDVDMFDANAVKTAVMGRYPQTVDFTGANLSTLLGPPVLLEG.
F0T8Q9_METLA/6-185                 .DKIDLYDDRGNLVEEQVPLEALSPLRNSAIKAIVQGVKRTVAVNLEGVENALKTGKLGG--GKILGRELDLDIVANAEAIAAKAAEMIQV.EEGDNTNVELLVGGKRALVQIPQARFDAGAEYSAGPLVTASAFIQSIIDVCDVSMYDANMVKAAILGRYPQSVDYMGGNLATMLDVPQKLEG.
F6D2D7_METPW/6-187                 .DKIDLYDDRGNLVEEQVPLEALSPLRNPAIKGIIQGVKRTVAVNLEGTENTLRNATVGGKACKILGRELDLDLVGNAEAIAEKAKEIIQV.EETDNTNVKLLAGGKRVLVQIPTVRFDAAAEYSAAASVTASAFIQAIIDVCDVSMYDANMVKAAILGRYPQTVDYMGGNLATMLDVPQKLEG.
R9T893_9EURY/6-186                 .DKIDLYDERGKLIESGVPLDAISPLYNPAIQRTASLAKRTIAVNLAGIEKSLKSGRVGG--GYIKGKEIDAPVVANAEKVAAKVKEYVKVdSSDDDTDVRVFSEGKNMIVIVPSRRMDAGVEYTTGFTTTAAAVTQAIIDEFDVDMFHANMVKGAVWGRYPQTLNFVGSNLTSILDVPQVNEG.
A0A0E3NTF4_9EURY/3-184             .DTVDIYDDRGKLLESNVDIMSLAPTRNAAIQKIIMDTKRSVAVNLGGIQNALATGKMGGKGRQILGRELDYDIVGRADEIAEKVKALVQV.DEGDDTNVTVLNGGKNLRIQSPTSRILSGADYMSSTTVGAAAVTQTLIDMFGTDMYDAMIVKSAIWGSYPQTMDLMGGSVAGILNIPQNNEG.
F7XL10_METZD/3-184                 e-KIDIYDDRGKLLESGVDLVEIAPTRNKAIQKIVTETKRSVAINLAGIEKALSTGKMGGKGRQILGNELDYDIVGNAGAIQDEVQKLVQV.SEGDDTNIATLGGGKQLLVQVPTVRTTAGADYVSAVTVGAAAVVQSIMNQFNTDIFDAPYVKAAVWGSYPQTMDLAGGNVASILSIPQKNEG.
D7E8Y1_METEZ/3-184                 .DNIDLYNDRGKLLESNVDLMDIAPTKNDAIKKIIDDTKKSVAINLNGIQKALSTGKMGGKGRHIPGYELDYDLVGNADSIRDSVEELVRV.DPNDDTNVESLYGGKQLLIQVPDERLQAGADYASATTVGAAATVQSIIDKFNTDMFVAPIVKAAVWGSYPQTVDLSGGNIASILKIPQQNEG.
D3E054_METRM/6-187                 .DKVDLYDDRGSLVESDVPIEALSPLRNPAIKNIISGVKRTVAVNLEGIEKSLKTASVGGAKSKILGREMDLDIVAQADSINASLKEMLQV.TEDDDTKCEILSGGKRILVQIPTIRLDSSAEYSVATLATATALTQAIIKEFDVSMYDANMVKAAILGRYPQSVEYMGSNLKTMLDVPQKLEG.
MCRB_METJA/9-190                   .DTINLYDEKGKLVEENVPLEAISPLHNPTIQKLVKDVKRTVAVNLAGIENALRTGQVGGKGCMIKGRELDLPIVENAETIAEYVEKVVRV.SEDDDTSIKLINDGKQMAVQIPSKRLDVAAEYSVSVLVTAQALKEAIIRTFDVDIFDAPMVHAAVLGGYPHEVTMKGSNIAALLGSPLSLEG.
Q6LWZ9_METMP/6-187                 .DKISLYDAKGNLVAENVPLEAISPLYNPTIKSMVKNIKRTVAVNLAGIEGTLAAGKIGGKGCQVPGRTLDISAVSNAQAIADEVEKILKV.SEDDDTAVKIINGGKQLAVQVPTARLDVAAEYSVSMLSTAMALKEALIKTFNIDMFDGSTVHAAIVGNYPQVMDYAGGNIASLLGAPSMMEG.
#=GC SS_cons                       .-EEEEE-TTS-EEEEEEEGGGGSTTT-HHHHHHHHHHHHEEEEEHHHHHHHHHH---SSTT---TT------TGGGHHHHHHHHHHHH-S.STTSS-EEEEECCCTEEEEE--HHHHHTSSSSTHHHHHHHHHHHHHHHHHTT--GGGHHHHHHHHHTTTTTSSS-TT-SEE-SS--GGG-SS.
#=GC seq_cons                      .DpIDLYDDcGKLLcSsVsL-ulSPLpNsAIpKIlptTKRTVAVNLuGIEsuL+oG+lGGpuspIhGREL-l-IVsNA-AIAcclKchlQV.sEsDDTslchlsGGKpLLVQVPotRlsuAA-YssuhossAuAsspAIIDpFclDMFDAshVKuAVaGpYPQThDhtGuNluolLslPQpsEG.
//
DBGET integrated database retrieval system