GenomeNet

Database: Pfam
Entry: MIF4G_like_2
LinkDB: MIF4G_like_2
Original site: MIF4G_like_2 
#=GF ID   MIF4G_like_2
#=GF AC   PF09090.9
#=GF DE   MIF4G like
#=GF AU   Sammut SJ
#=GF SE   pdb_1h6k
#=GF GA   21.00 21.00;
#=GF TC   21.30 22.30;
#=GF NC   20.90 20.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   11545740
#=GF RT   Crystal structure of the human nuclear cap binding complex. 
#=GF RA   Mazza C, Ohno M, Segref A, Mattaj IW, Cusack S; 
#=GF RL   Mol Cell. 2001;8:383-396.
#=GF DR   INTERPRO; IPR015174;
#=GF DR   SCOP; 1h6k; fa;
#=GF CC   Members of this family are involved in mediating U snRNA export
#=GF CC   from the nucleus. They adopt a highly helical structure, wherein
#=GF CC   the polypeptide chain forms a right-handed solenoid. At the
#=GF CC   tertiary level, the domain is composed of a superhelical
#=GF CC   arrangement of successive antiparallel pairs of helices [1].
#=GF SQ   579
#=GS C5X0L6_SORBI/483-829        AC C5X0L6.1
#=GS L8X8T5_THACA/522-802        AC L8X8T5.1
#=GS A0A094HC41_9PEZI/534-785    AC A0A094HC41.1
#=GS NCBP1_SCHPO/514-777         AC O14253.1
#=GS R0HWP4_9BRAS/478-814        AC R0HWP4.1
#=GS D7T129_VITVI/485-830        AC D7T129.1
#=GS B3L6S4_PLAKH/882-1086       AC B3L6S4.1
#=GS G3SXB3_LOXAF/485-760        AC G3SXB3.1
#=GS A0A0M8P211_9EURO/531-784    AC A0A0M8P211.1
#=GS J0E190_LOALO/497-757        AC J0E190.1
#=GS A5K2V0_PLAVS/891-1094       AC A5K2V0.1
#=GS B6QVA1_TALMQ/550-804        AC B6QVA1.1
#=GS L8FMN0_PSED2/534-785        AC L8FMN0.1
#=GS G0V679_NAUCC/573-742        AC G0V679.1
#=GS A7TKT7_VANPO/594-761        AC A7TKT7.1
#=GS A0A0J8CYG0_BETVU/500-765    AC A0A0J8CYG0.1
#=GS C1E0M0_MICSR/522-800        AC C1E0M0.1
#=GS G0VGQ5_NAUCC/583-831        AC G0VGQ5.1
#=GS A0A094CPK7_9PEZI/534-785    AC A0A094CPK7.1
#=GS A0A096R9N1_MAIZE/483-829    AC A0A096R9N1.1
#=GS A0A0L0P1Q3_9ASCO/657-925    AC A0A0L0P1Q3.1
#=GS A8Q346_MALGO/615-928        AC A8Q346.1
#=GS E1BMM0_BOVIN/485-760        AC E1BMM0.2
#=GS S6ENQ0_ZYGB2/750-829        AC S6ENQ0.1
#=GS J7S6P4_KAZNA/583-831        AC J7S6P4.1
#=GS A0A0D9LAA4_9EURO/531-784    AC A0A0D9LAA4.1
#=GS D2VH37_NAEGR/629-880        AC D2VH37.1
#=GS X1X825_ACYPI/407-512        AC X1X825.1
#=GS K7IKM6_CAEJA/1-205          AC K7IKM6.1
#=GS X1XHK1_ACYPI/1-135          AC X1XHK1.1
#=GS W2RVM6_9EURO/542-793        AC W2RVM6.1
#=GS A0A0E0NUZ5_ORYRU/483-829    AC A0A0E0NUZ5.1
#=GS E2LB17_MONPE/113-226        AC E2LB17.1
#=GS V5ENX7_PSEBG/658-969        AC V5ENX7.1
#=GS I1QET0_ORYGL/454-801        AC I1QET0.1
#=GS A5DCB1_PICGU/640-902        AC A5DCB1.2
#=GS C5MAR3_CANTT/620-797        AC C5MAR3.1
#=GS A0A0N4YY38_NIPBR/18-177     AC A0A0N4YY38.1
#=GS A4RZY8_OSTLU/213-450        AC A4RZY8.1
#=GS Q2GXY9_CHAGB/535-778        AC Q2GXY9.1
#=GS L5M790_MYODS/558-833        AC L5M790.1
#=GS M2YNE3_DOTSN/561-812        AC M2YNE3.1
#=GS W6UR31_ECHGR/541-866        AC W6UR31.1
#=GS S7QKB1_GLOTA/537-840        AC S7QKB1.1
#=GS H9G962_ANOCA/602-888        AC H9G962.2
#=GS M3AD00_PSEFD/560-811        AC M3AD00.1
#=GS NCBP1_XENTR/485-761         AC Q6DIE2.1
#=GS W7A6T6_9APIC/857-1069       AC W7A6T6.1
#=GS NCBP1_MOUSE/485-760         AC Q3UYV9.2
#=GS E3NEH5_CAERE/504-779        AC E3NEH5.1
#=GS A0A066X9Z7_COLSU/534-780    AC A0A066X9Z7.1
#=GS Q4WDL2_ASPFU/362-611        AC Q4WDL2.1
#=GS W6NQB7_HAECO/631-891        AC W6NQB7.1
#=GS G8ZLM5_TORDC/581-751        AC G8ZLM5.1
#=GS A0A086TBE1_ACRCH/534-792    AC A0A086TBE1.1
#=GS W4Y6T8_STRPU/494-770        AC W4Y6T8.1
#=GS A0A0K6FSW1_9HOMO/543-823    AC A0A0K6FSW1.1
#=GS A0A0G4IX35_PLABS/560-704    AC A0A0G4IX35.1
#=GS G8BVZ2_TETPH/580-828        AC G8BVZ2.1
#=GS M2P8U5_CERS8/532-836        AC M2P8U5.1
#=GS V4MF45_EUTSA/484-814        AC V4MF45.1
#=GS R0HJI6_9BRAS/370-706        AC R0HJI6.1
#=GS A0A074YS93_AURPU/536-787    AC A0A074YS93.1
#=GS F2PUZ7_TRIEC/541-794        AC F2PUZ7.1
#=GS A0A0K0DWY0_STRER/507-792    AC A0A0K0DWY0.1
#=GS H0EIC4_GLAL7/760-946        AC H0EIC4.1
#=GS F7AA70_XENTR/484-760        AC F7AA70.1
#=GS A0A0N5AUR6_9BILA/501-762    AC A0A0N5AUR6.1
#=GS U6LAT1_EIMTE/131-409        AC U6LAT1.1
#=GS F4P8H5_BATDJ/516-788        AC F4P8H5.1
#=GS Q6CH33_YARLI/537-742        AC Q6CH33.1
#=GS A0A0G4MMZ4_9PEZI/2521-2765  AC A0A0G4MMZ4.1
#=GS U6LS04_9EIME/792-994        AC U6LS04.1
#=GS H0YTB3_TAEGU/483-763        AC H0YTB3.1
#=GS Y827_ENCCU/285-386          AC Q8SUT4.1
#=GS F7DRW1_MACMU/486-761        AC F7DRW1.1
#=GS Q4Z3J7_PLABA/93-308         AC Q4Z3J7.1
#=GS H0XA17_OTOGA/487-762        AC H0XA17.1
#=GS A0A0B4GP33_9HYPO/534-779    AC A0A0B4GP33.1
#=GS F7DG19_HORSE/473-748        AC F7DG19.1
#=GS K4AKQ7_SETIT/483-829        AC K4AKQ7.1
#=GS B4NU09_DROSI/1-276          AC B4NU09.1
#=GS NCBP1_HUMAN/485-760         AC Q09161.1
#=GS NCBP1_HUMAN/485-760         DR PDB; 3FEY A; 485-760;
#=GS NCBP1_HUMAN/485-760         DR PDB; 3FEX A; 485-760;
#=GS NCBP1_HUMAN/485-760         DR PDB; 1H2V C; 485-760;
#=GS NCBP1_HUMAN/485-760         DR PDB; 1H6K C; 485-760;
#=GS NCBP1_HUMAN/485-760         DR PDB; 1H2U A; 485-760;
#=GS NCBP1_HUMAN/485-760         DR PDB; 1H2T C; 485-760;
#=GS NCBP1_HUMAN/485-760         DR PDB; 1N54 A; 485-760;
#=GS NCBP1_HUMAN/485-760         DR PDB; 1H2U B; 485-760;
#=GS NCBP1_HUMAN/485-760         DR PDB; 1H6K B; 485-760;
#=GS NCBP1_HUMAN/485-760         DR PDB; 1H6K A; 485-760;
#=GS NCBP1_HUMAN/485-760         DR PDB; 1N52 A; 485-760;
#=GS F9XIC9_ZYMTI/534-785        AC F9XIC9.1
#=GS A0A084FX57_9PEZI/537-776    AC A0A084FX57.1
#=GS B2VVN1_PYRTR/556-810        AC B2VVN1.1
#=GS A0A0N0V7F8_9HYPO/532-777    AC A0A0N0V7F8.1
#=GS G3BB60_CANTC/620-878        AC G3BB60.1
#=GS W3X2I8_9PEZI/541-785        AC W3X2I8.1
#=GS B8APF3_ORYSI/471-817        AC B8APF3.1
#=GS I1BQW9_RHIO9/543-807        AC I1BQW9.1
#=GS E2AC77_CAMFO/488-764        AC E2AC77.1
#=GS A0A0D2UPB5_CAPO3/632-939    AC A0A0D2UPB5.1
#=GS A0A074SNC0_HAMHA/836-1116   AC A0A074SNC0.1
#=GS A9RK96_PHYPA/504-849        AC A9RK96.1
#=GS I1H5J0_BRADI/483-829        AC I1H5J0.1
#=GS G8JUZ8_ERECY/578-824        AC G8JUZ8.1
#=GS C4V887_NOSCE/296-389        AC C4V887.1
#=GS A0A0J9XM00_BRUMA/1-165      AC A0A0J9XM00.1
#=GS E0VJH5_PEDHC/460-735        AC E0VJH5.1
#=GS E5SWE1_TRISP/494-764        AC E5SWE1.1
#=GS A0A0F7VEW1_9EURO/535-788    AC A0A0F7VEW1.1
#=GS W5GPJ9_WHEAT/9-322          AC W5GPJ9.1
#=GS V8NT05_OPHHA/422-695        AC V8NT05.1
#=GS B0X1G3_CULQU/17-311         AC B0X1G3.1
#=GS A0A0D3BDL2_BRAOL/484-811    AC A0A0D3BDL2.1
#=GS A0A067SWU0_9AGAR/537-857    AC A0A067SWU0.1
#=GS S0DTB1_GIBF5/531-776        AC S0DTB1.1
#=GS I1FKG5_AMPQE/60-328         AC I1FKG5.1
#=GS B4JE26_DROGR/498-712        AC B4JE26.1
#=GS Q4N8N4_THEPA/710-963        AC Q4N8N4.1
#=GS G8YCN1_PICSO/650-914        AC G8YCN1.1
#=GS A0A0K0IMQ6_BRUMA/1-137      AC A0A0K0IMQ6.1
#=GS M7NT24_PNEMU/460-716        AC M7NT24.1
#=GS F0VR04_NEOCL/895-1135       AC F0VR04.1
#=GS A0A0N4T883_BRUPA/217-329    AC A0A0N4T883.1
#=GS A0A094ECF2_9PEZI/534-785    AC A0A094ECF2.1
#=GS K0KXE4_WICCF/568-840        AC K0KXE4.1
#=GS A0A072PND4_9EURO/542-794    AC A0A072PND4.1
#=GS B0DK62_LACBS/550-863        AC B0DK62.1
#=GS NCBP1_DROGR/488-770         AC B4JM29.1
#=GS A0A094D5U6_9PEZI/549-800    AC A0A094D5U6.1
#=GS C1GGW1_PARBD/565-817        AC C1GGW1.1
#=GS G7PRW1_MACFA/475-750        AC G7PRW1.1
#=GS A0A096P136_PAPAN/487-762    AC A0A096P136.1
#=GS H3B1S7_LATCH/487-774        AC H3B1S7.1
#=GS A0A0D1DTA6_USTMA/651-975    AC A0A0D1DTA6.1
#=GS A7TKT7_VANPO/763-842        AC A7TKT7.1
#=GS A7EUS0_SCLS1/1-149          AC A7EUS0.1
#=GS Q0UGB2_PHANO/647-900        AC Q0UGB2.2
#=GS A0A0K0DHJ6_ANGCA/491-660    AC A0A0K0DHJ6.1
#=GS M5GC50_DACSP/570-871        AC M5GC50.1
#=GS G9NFI7_HYPAI/533-778        AC G9NFI7.1
#=GS W1PP24_AMBTC/486-817        AC W1PP24.1
#=GS NCBP1_CAEEL/489-768         AC O01763.3
#=GS W7UBY3_9STRA/647-895        AC W7UBY3.1
#=GS A0A0D9REV2_CHLSB/485-760    AC A0A0D9REV2.1
#=GS L0PFW0_PNEJ8/1-115          AC L0PFW0.1
#=GS E9J6J3_SOLIN/475-751        AC E9J6J3.1
#=GS A0A0B2UV61_TOXCA/5-175      AC A0A0B2UV61.1
#=GS D8QLP8_SCHCM/488-803        AC D8QLP8.1
#=GS R9ALM1_WALI9/528-818        AC R9ALM1.1
#=GS A0A0E0KDN3_ORYPU/464-810    AC A0A0E0KDN3.1
#=GS NCBP1_ASHGO/582-827         AC Q754H6.2
#=GS I3IZ41_ORENI/483-765        AC I3IZ41.1
#=GS G4NH07_MAGO7/543-787        AC G4NH07.1
#=GS N1J947_BLUG1/530-769        AC N1J947.1
#=GS W5LAI3_ASTMX/483-767        AC W5LAI3.1
#=GS A0A0M3IY46_ANISI/456-735    AC A0A0M3IY46.1
#=GS A0A075B041_9FUNG/473-612    AC A0A075B041.1
#=GS M7WDI9_RHOT1/709-986        AC M7WDI9.1
#=GS Q6FN07_CANGA/580-828        AC Q6FN07.2
#=GS M3Y4U2_MUSPF/485-760        AC M3Y4U2.1
#=GS B9HP11_POPTR/485-830        AC B9HP11.2
#=GS R1EFH6_BOTPV/627-881        AC R1EFH6.1
#=GS R0MH35_NOSB1/38-153         AC R0MH35.1
#=GS W5PNL4_SHEEP/485-760        AC W5PNL4.1
#=GS F6ZI49_XENTR/488-764        AC F6ZI49.1
#=GS A0A0L7LUP8_9NEOP/7-204      AC A0A0L7LUP8.1
#=GS J4W7Z6_BEAB2/534-789        AC J4W7Z6.1
#=GS G7KX77_MEDTR/493-829        AC G7KX77.2
#=GS A0A0N5DLP0_TRIMR/524-780    AC A0A0N5DLP0.1
#=GS B4R0Z6_DROSI/496-718        AC B4R0Z6.1
#=GS R0KSP6_NOSB1/298-432        AC R0KSP6.1
#=GS I0Z3N8_9CHLO/528-857        AC I0Z3N8.1
#=GS I7M7J6_TETTS/614-871        AC I7M7J6.1
#=GS H9IWE9_BOMMO/2-278          AC H9IWE9.1
#=GS R8BBG4_TOGMI/542-796        AC R8BBG4.1
#=GS T1JMW3_STRMM/488-758        AC T1JMW3.1
#=GS A0A0K0F7J2_9BILA/489-774    AC A0A0K0F7J2.1
#=GS Q6BLJ6_DEBHA/674-939        AC Q6BLJ6.1
#=GS A0A0H5C952_CYBJA/584-823    AC A0A0H5C952.1
#=GS F4RMF2_MELLP/640-988        AC F4RMF2.1
#=GS M4AV18_XIPMA/485-766        AC M4AV18.1
#=GS A0A067LWN8_9HOMO/535-823    AC A0A067LWN8.1
#=GS E7QJB4_YEASZ/578-825        AC E7QJB4.1
#=GS A0A084W0C9_ANOSI/488-776    AC A0A084W0C9.1
#=GS N1QI61_SPHMS/567-818        AC N1QI61.1
#=GS K2QJ30_MACPH/499-753        AC K2QJ30.1
#=GS E2BW56_HARSA/488-760        AC E2BW56.1
#=GS Q6CJM2_KLULA/577-822        AC Q6CJM2.2
#=GS A0A0L6UA42_9BASI/648-1012   AC A0A0L6UA42.1
#=GS C3Y2C6_BRAFL/549-659        AC C3Y2C6.1
#=GS S9X512_SCHCR/515-731        AC S9X512.1
#=GS A0A060SP03_PYCCI/543-845    AC A0A060SP03.1
#=GS G4TF65_PIRID/529-819        AC G4TF65.1
#=GS A0A0L7LTZ4_9NEOP/6-95       AC A0A0L7LTZ4.1
#=GS U9UVG0_RHIID/571-831        AC U9UVG0.1
#=GS M7SBY9_EUTLA/537-793        AC M7SBY9.1
#=GS A0A093X5E1_9PEZI/534-785    AC A0A093X5E1.1
#=GS E5ABN2_LEPMJ/742-995        AC E5ABN2.1
#=GS W9X406_9EURO/538-790        AC W9X406.1
#=GS A0A024TDB5_9STRA/640-840    AC A0A024TDB5.1
#=GS A0A094FNT1_9PEZI/275-526    AC A0A094FNT1.1
#=GS E3S7J3_PYRTT/731-984        AC E3S7J3.1
#=GS G1T696_RABIT/486-761        AC G1T696.1
#=GS T1GNS6_MEGSC/18-236         AC T1GNS6.1
#=GS E4UYW2_ARTGP/547-800        AC E4UYW2.1
#=GS G3QGA9_GORGO/487-762        AC G3QGA9.1
#=GS J9EFK0_WUCBA/483-676        AC J9EFK0.1
#=GS F0ZKI8_DICPU/494-724        AC F0ZKI8.1
#=GS NCBP1_ANOGA/488-777         AC Q7PX35.4
#=GS B8ND12_ASPFN/529-782        AC B8ND12.1
#=GS E3KEG4_PUCGT/487-821        AC E3KEG4.2
#=GS V5G4F2_BYSSN/534-787        AC V5G4F2.1
#=GS A0A015LJ81_9GLOM/314-574    AC A0A015LJ81.1
#=GS W5EC97_WHEAT/370-652        AC W5EC97.1
#=GS A0A0B1NXU2_UNCNE/535-780    AC A0A0B1NXU2.1
#=GS B3MVZ8_DROAN/524-753        AC B3MVZ8.1
#=GS A0A022QJ29_ERYGU/485-802    AC A0A022QJ29.1
#=GS F0YDT9_AURAN/1513-1687      AC F0YDT9.1
#=GS J9J348_9SPIT/488-775        AC J9J348.1
#=GS A0A0L7LU78_9NEOP/1-42       AC A0A0L7LU78.1
#=GS F8PPT7_SERL3/540-853        AC F8PPT7.1
#=GS A0A067CB45_SAPPC/616-817    AC A0A067CB45.1
#=GS A0A095CIX4_CRYGA/593-871    AC A0A095CIX4.1
#=GS E2QD75_DROME/488-770        AC E2QD75.1
#=GS W7IGH9_9PEZI/535-781        AC W7IGH9.1
#=GS E9F5L4_METRA/538-783        AC E9F5L4.1
#=GS B4LSE0_DROVI/496-710        AC B4LSE0.1
#=GS G4VPN1_SCHMA/530-885        AC G4VPN1.1
#=GS N1RS65_FUSC4/531-775        AC N1RS65.1
#=GS F7HCL0_CALJA/418-693        AC F7HCL0.1
#=GS A0CRM1_PARTE/469-689        AC A0CRM1.1
#=GS W5J8I3_ANODA/6-291          AC W5J8I3.1
#=GS G3H7F1_CRIGR/276-551        AC G3H7F1.1
#=GS Q1K7E2_NEUCR/533-786        AC Q1K7E2.1
#=GS A0A074SCM4_9HOMO/536-816    AC A0A074SCM4.1
#=GS M0SWM8_MUSAM/81-421         AC M0SWM8.1
#=GS A0A066WJ86_9BASI/636-951    AC A0A066WJ86.1
#=GS NCBP1_ORYSJ/483-829         AC Q10LJ0.1
#=GS G0SE05_CHATD/536-786        AC G0SE05.1
#=GS G2XE50_VERDV/537-781        AC G2XE50.1
#=GS M0YQX5_HORVD/83-429         AC M0YQX5.1
#=GS W5MTK1_LEPOC/491-771        AC W5MTK1.1
#=GS H2YUE8_CIOSA/1-163          AC H2YUE8.1
#=GS E1Z775_CHLVA/534-793        AC E1Z775.1
#=GS X6R941_HUMAN/1-124          AC X6R941.1
#=GS C6HGR2_AJECH/477-712        AC C6HGR2.1
#=GS Q2U9I0_ASPOR/529-782        AC Q2U9I0.1
#=GS M2ML26_BAUCO/552-803        AC M2ML26.1
#=GS A0A0M0TWC4_9PEZI/535-790    AC A0A0M0TWC4.1
#=GS H3DUI8_PRIPA/67-343         AC H3DUI8.1
#=GS C5FRD0_ARTOC/547-798        AC C5FRD0.1
#=GS A0A0L0CL87_LUCCU/488-771    AC A0A0L0CL87.1
#=GS Q59QD1_CANAL/619-796        AC Q59QD1.1
#=GS G6CZS3_DANPL/487-767        AC G6CZS3.1
#=GS NCBP1_DICDI/524-754         AC Q55D17.1
#=GS M1VV04_CLAP2/553-807        AC M1VV04.1
#=GS L1IJA4_GUITH/524-768        AC L1IJA4.1
#=GS E6ZW71_SPORE/641-959        AC E6ZW71.1
#=GS A8PGT3_COPC7/535-854        AC A8PGT3.1
#=GS C9S8W0_VERA1/460-704        AC C9S8W0.1
#=GS H2SJV6_TAKRU/485-765        AC H2SJV6.1
#=GS A0A0B2UWP0_TOXCA/547-823    AC A0A0B2UWP0.1
#=GS B8MTN8_TALSN/547-801        AC B8MTN8.1
#=GS A0A085NGJ1_9BILA/2175-2430  AC A0A085NGJ1.1
#=GS A0A0M8MQP6_9BASI/617-925    AC A0A0M8MQP6.1
#=GS A0A0F8X6W2_9EURO/534-787    AC A0A0F8X6W2.1
#=GS W6QLA4_PENRO/531-784        AC W6QLA4.1
#=GS A0A087XF49_POEFO/485-769    AC A0A087XF49.1
#=GS V4U5T8_9ROSI/271-616        AC V4U5T8.1
#=GS NCBP1_ARATH/484-814         AC Q9SIU2.2
#=GS NCBP1_DROSE/488-770         AC B4I0W6.1
#=GS G3XXC7_ASPNA/548-801        AC G3XXC7.1
#=GS X6MHP4_RETFI/46-337         AC X6MHP4.1
#=GS A0A0B2UIA8_9MICR/305-411    AC A0A0B2UIA8.1
#=GS G1X9L4_ARTOA/544-790        AC G1X9L4.1
#=GS E9E5T2_METAQ/604-848        AC E9E5T2.1
#=GS G1S4W7_NOMLE/485-760        AC G1S4W7.1
#=GS K3WAB2_PYTUL/691-934        AC K3WAB2.1
#=GS A7AR12_BABBO/735-958        AC A7AR12.1
#=GS A0A084QBE8_9HYPO/545-790    AC A0A084QBE8.1
#=GS J9ETZ7_WUCBA/3-75           AC J9ETZ7.1
#=GS X0K335_FUSOX/531-775        AC X0K335.1
#=GS B4I3F9_DROSE/496-720        AC B4I3F9.1
#=GS A0A044SD50_ONCVO/526-809    AC A0A044SD50.1
#=GS NCBP1_DROVI/551-753         AC B4M7T6.1
#=GS A0A068RLR1_9FUNG/535-804    AC A0A068RLR1.1
#=GS W1QCA3_OGAPD/671-916        AC W1QCA3.1
#=GS A0A0D9Z790_9ORYZ/516-862    AC A0A0D9Z790.1
#=GS A0A0N5B8K9_STREA/489-776    AC A0A0N5B8K9.1
#=GS S9XU20_9CETA/244-493        AC S9XU20.1
#=GS A0A061GUF2_THECC/484-829    AC A0A061GUF2.1
#=GS U3JEQ1_FICAL/473-756        AC U3JEQ1.1
#=GS I1PB96_ORYGL/483-830        AC I1PB96.1
#=GS J3KLQ5_COCIM/532-785        AC J3KLQ5.2
#=GS H2YUE9_CIOSA/492-771        AC H2YUE9.1
#=GS G4VPN2_SCHMA/542-896        AC G4VPN2.1
#=GS A0A0N4ZFL0_PARTI/492-768    AC A0A0N4ZFL0.1
#=GS A0A094A8W6_9PEZI/534-785    AC A0A094A8W6.1
#=GS G3PX26_GASAC/498-780        AC G3PX26.1
#=GS NCBP1_DROAN/488-770         AC B3MS75.1
#=GS Q4V551_DROME/498-719        AC Q4V551.1
#=GS X1WQ84_ACYPI/491-791        AC X1WQ84.1
#=GS B4KJA1_DROMO/497-712        AC B4KJA1.1
#=GS A0A0F9Y2U7_TRIHA/533-778    AC A0A0F9Y2U7.1
#=GS F7VZ09_SORMK/533-786        AC F7VZ09.1
#=GS C4R1D3_PICPG/635-804        AC C4R1D3.1
#=GS A0A024TE12_9STRA/640-769    AC A0A024TE12.1
#=GS U6NYV9_HAECO/687-947        AC U6NYV9.1
#=GS E4XB39_OIKDI/505-584        AC E4XB39.1
#=GS N4VJM2_COLOR/521-766        AC N4VJM2.1
#=GS V4AG41_LOTGI/488-760        AC V4AG41.1
#=GS C4XYV4_CLAL4/259-527        AC C4XYV4.1
#=GS E9HSG0_DAPPU/486-779        AC E9HSG0.1
#=GS A0A099P1G9_PICKU/793-990    AC A0A099P1G9.1
#=GS F7H7F0_CALJA/487-762        AC F7H7F0.1
#=GS M7TI29_BOTF1/577-824        AC M7TI29.1
#=GS S2JP86_MUCC1/537-805        AC S2JP86.1
#=GS V2XHE6_MONRO/531-843        AC V2XHE6.1
#=GS D6W9J4_TRICA/1-255          AC D6W9J4.1
#=GS D8SFU6_SELML/513-831        AC D8SFU6.1
#=GS A0C585_PARTE/472-686        AC A0C585.1
#=GS J9EBN4_WUCBA/332-503        AC J9EBN4.1
#=GS G0R794_HYPJQ/533-778        AC G0R794.1
#=GS W9CCH7_9HELO/603-851        AC W9CCH7.1
#=GS R0KNI0_SETT2/564-817        AC R0KNI0.1
#=GS D8TCU0_SELML/476-804        AC D8TCU0.1
#=GS W4WRZ8_ATTCE/488-762        AC W4WRZ8.1
#=GS W9XJL5_9EURO/548-800        AC W9XJL5.1
#=GS H3GMP6_PHYRM/615-861        AC H3GMP6.1
#=GS A1CM21_ASPCL/541-794        AC A1CM21.1
#=GS V8NB45_OPHHA/410-682        AC V8NB45.1
#=GS A0A0F8BJB3_CERFI/535-804    AC A0A0F8BJB3.1
#=GS A6R994_AJECN/500-752        AC A6R994.1
#=GS C3Y2C6_BRAFL/442-544        AC C3Y2C6.1
#=GS L5KQH9_PTEAL/808-1083       AC L5KQH9.1
#=GS H2QXJ3_PANTR/485-760        AC H2QXJ3.1
#=GS W5EKC6_WHEAT/36-180         AC W5EKC6.1
#=GS T1FTY1_HELRO/364-635        AC T1FTY1.1
#=GS A0A074WCR7_9PEZI/537-788    AC A0A074WCR7.1
#=GS W4Y6T9_STRPU/44-126         AC W4Y6T9.1
#=GS K7IVH0_NASVI/488-761        AC K7IVH0.1
#=GS F0UQX4_AJEC8/556-808        AC F0UQX4.1
#=GS G0SWX6_RHOG2/1107-1384      AC G0SWX6.1
#=GS A0A0K0IMQ5_BRUMA/28-297     AC A0A0K0IMQ5.1
#=GS F7H2J1_MACMU/1-110          AC F7H2J1.1
#=GS D5GA59_TUBMM/542-790        AC D5GA59.1
#=GS K5X9H4_PHACS/528-832        AC K5X9H4.1
#=GS A0A078DUW3_BRANA/484-811    AC A0A078DUW3.1
#=GS H6BYI9_EXODN/537-789        AC H6BYI9.1
#=GS A0A0A1SKZ6_9HYPO/535-774    AC A0A0A1SKZ6.1
#=GS A0A0A8LD62_9SACH/577-822    AC A0A0A8LD62.1
#=GS A3LQD0_PICST/647-909        AC A3LQD0.2
#=GS NCBP1_CHICK/487-763         AC Q5ZJZ6.1
#=GS NCBP1_AEDAE/488-783         AC Q16UN6.1
#=GS W6MLD3_9ASCO/663-882        AC W6MLD3.1
#=GS G1PRS5_MYOLU/474-749        AC G1PRS5.1
#=GS W5DXB9_WHEAT/5-126          AC W5DXB9.1
#=GS S3C9N4_OPHP1/649-983        AC S3C9N4.1
#=GS A0A0E0KDN4_ORYPU/444-790    AC A0A0E0KDN4.1
#=GS G4UD99_NEUT9/533-786        AC G4UD99.1
#=GS A0A0C4E5K4_MAGP6/541-787    AC A0A0C4E5K4.1
#=GS G0WB81_NAUDC/580-826        AC G0WB81.1
#=GS A0A0L9SR40_9HYPO/536-778    AC A0A0L9SR40.1
#=GS F7GRU0_CALJA/485-760        AC F7GRU0.1
#=GS A0A068XIS9_HYMMI/572-890    AC A0A068XIS9.2
#=GS A0A016PN93_GIBZA/532-777    AC A0A016PN93.1
#=GS F1PUP7_CANLF/485-760        AC F1PUP7.2
#=GS A0A091CMF8_FUKDA/413-542    AC A0A091CMF8.1
#=GS A0A0N5CYW2_THECL/527-792    AC A0A0N5CYW2.1
#=GS I4YFG6_WALMC/517-808        AC I4YFG6.1
#=GS W9XQM4_9EURO/539-791        AC W9XQM4.1
#=GS A0A067QQW6_9HOMO/541-846    AC A0A067QQW6.1
#=GS H2AU78_KAZAF/579-755        AC H2AU78.1
#=GS U1MDT0_ASCSU/530-812        AC U1MDT0.1
#=GS S7Z6B7_PENO1/534-787        AC S7Z6B7.1
#=GS B2B7F2_PODAN/518-764        AC B2B7F2.1
#=GS F6PKJ4_CIOIN/486-765        AC F6PKJ4.2
#=GS A0A0N1P1T4_9EURO/543-789    AC A0A0N1P1T4.1
#=GS U6G7J2_9EIME/829-983        AC U6G7J2.1
#=GS D7L031_ARALL/484-814        AC D7L031.1
#=GS J9DTD6_WUCBA/2-85           AC J9DTD6.1
#=GS A0A0F4Z9T5_9PEZI/534-803    AC A0A0F4Z9T5.1
#=GS A0A0N4WSI7_HAEPC/468-732    AC A0A0N4WSI7.1
#=GS A0A017SKH2_9EURO/532-785    AC A0A017SKH2.1
#=GS K1Y1E7_MARBU/538-779        AC K1Y1E7.1
#=GS A0A094DN20_9PEZI/549-800    AC A0A094DN20.1
#=GS M5BLJ3_THACB/522-724        AC M5BLJ3.1
#=GS B6K6M4_SCHJY/513-722        AC B6K6M4.1
#=GS J5PTH5_SACK1/578-825        AC J5PTH5.1
#=GS A0A067E938_CITSI/419-764    AC A0A067E938.1
#=GS W5PNL6_SHEEP/487-762        AC W5PNL6.1
#=GS A0A0D2XCF3_FUSO4/531-776    AC A0A0D2XCF3.1
#=GS M3HQQ7_CANMX/613-791        AC M3HQQ7.1
#=GS A0A0D9Z791_9ORYZ/483-829    AC A0A0D9Z791.1
#=GS A0A0A2VE17_BEABA/534-788    AC A0A0A2VE17.1
#=GS NCBP1_DROPS/488-770         AC Q29G82.1
#=GS B6GXX9_PENRW/531-784        AC B6GXX9.1
#=GS A0A0D3FIE9_9ORYZ/483-829    AC A0A0D3FIE9.1
#=GS A0A090N3S9_OSTTA/512-742    AC A0A090N3S9.1
#=GS M9M7J7_PSEA3/633-929        AC M9M7J7.1
#=GS C7YU08_NECH7/533-778        AC C7YU08.1
#=GS G3JGQ9_CORMM/555-803        AC G3JGQ9.1
#=GS Q5KMU1_CRYNJ/587-885        AC Q5KMU1.1
#=GS T1JFR4_STRMM/1-270          AC T1JFR4.1
#=GS U3J9Q4_ANAPL/448-727        AC U3J9Q4.1
#=GS G8YF32_PICSO/650-914        AC G8YF32.1
#=GS H1V5N6_COLHI/541-787        AC H1V5N6.1
#=GS A0A067NZ14_PLEOS/550-856    AC A0A067NZ14.1
#=GS A0A0G4MMZ4_9PEZI/1971-2215  AC A0A0G4MMZ4.1
#=GS A2R4E7_ASPNC/548-801        AC A2R4E7.1
#=GS A0A0C4F0J7_PUCT1/370-692    AC A0A0C4F0J7.1
#=GS A0A0F4GTG5_9PEZI/559-810    AC A0A0F4GTG5.1
#=GS U4TQ91_DENPD/16-284         AC U4TQ91.1
#=GS M4BIG7_HYAAE/207-459        AC M4BIG7.1
#=GS E3QAL0_COLGM/535-781        AC E3QAL0.1
#=GS G1N980_MELGA/39-270         AC G1N980.2
#=GS Q7RSR4_PLAYO/828-987        AC Q7RSR4.1
#=GS W7AJD6_PLAVN/816-1026       AC W7AJD6.1
#=GS G7XZ90_ASPKW/542-795        AC G7XZ90.1
#=GS Q0CKX2_ASPTN/541-794        AC Q0CKX2.1
#=GS M3VW75_FELCA/485-760        AC M3VW75.1
#=GS A9S1J0_PHYPA/495-842        AC A9S1J0.1
#=GS K1Q4J3_CRAGI/488-760        AC K1Q4J3.1
#=GS A0A059D9L3_EUCGR/68-412     AC A0A059D9L3.1
#=GS R4X9M8_TAPDE/503-766        AC R4X9M8.1
#=GS A0A0G2GV22_9PEZI/613-867    AC A0A0G2GV22.1
#=GS A1DM04_NEOFI/529-782        AC A1DM04.1
#=GS W2QF76_PHYPN/604-857        AC W2QF76.1
#=GS E9CS92_COCPS/532-785        AC E9CS92.1
#=GS A0A067JRI3_JATCU/485-830    AC A0A067JRI3.1
#=GS F0XRE3_GROCL/583-838        AC F0XRE3.1
#=GS E1G006_LOALO/528-796        AC E1G006.1
#=GS A0A0D3E2U7_BRAOL/301-596    AC A0A0D3E2U7.1
#=GS K4CX85_SOLLC/485-827        AC K4CX85.1
#=GS U5HA64_USTV1/693-970        AC U5HA64.1
#=GS W7MK74_GIBM7/531-776        AC W7MK74.1
#=GS A0A0B0NP59_GOSAR/483-829    AC A0A0B0NP59.1
#=GS M7BPB3_CHEMY/114-291        AC M7BPB3.1
#=GS A0A0G2FZI4_9PEZI/575-841    AC A0A0G2FZI4.1
#=GS L8GQR7_ACACA/416-673        AC L8GQR7.1
#=GS A0A074XXI9_9PEZI/537-788    AC A0A074XXI9.1
#=GS A0A094F7J6_9PEZI/549-800    AC A0A094F7J6.1
#=GS A0A0P7WT97_9TELE/450-693    AC A0A0P7WT97.1
#=GS G0WF93_NAUDC/582-835        AC G0WF93.1
#=GS M1URS2_CYAME/726-1017       AC M1URS2.1
#=GS W4KGI1_9HOMO/537-838        AC W4KGI1.1
#=GS NCBP1_DROME/488-770         AC Q7K4N3.1
#=GS F6VFW6_MONDO/484-756        AC F6VFW6.2
#=GS K1VU75_TRIAC/513-813        AC K1VU75.1
#=GS A0A067R587_ZOONE/487-775    AC A0A067R587.1
#=GS G3WTF4_SARHA/477-708        AC G3WTF4.1
#=GS F6ZXS3_ORNAN/474-623        AC F6ZXS3.1
#=GS T1HND5_RHOPR/491-769        AC T1HND5.1
#=GS A0A0G2IYJ0_9EURO/566-823    AC A0A0G2IYJ0.1
#=GS A0A0K8L8H3_9EURO/529-791    AC A0A0K8L8H3.1
#=GS A0A087HCT4_ARAAL/484-815    AC A0A087HCT4.1
#=GS W9R4S8_9ROSA/127-468        AC W9R4S8.1
#=GS M8A6M1_TRIUA/684-1030       AC M8A6M1.1
#=GS G8BCS6_CANPC/643-904        AC G8BCS6.1
#=GS U6N3Z9_9EIME/129-344        AC U6N3Z9.1
#=GS A0A0L0NHN1_9HYPO/531-776    AC A0A0L0NHN1.1
#=GS A0A0A2JUZ3_PENEN/531-784    AC A0A0A2JUZ3.1
#=GS S3E6W8_GLAL2/538-786        AC S3E6W8.1
#=GS T1GNS5_MEGSC/1-42           AC T1GNS5.1
#=GS G4YES6_PHYSP/618-871        AC G4YES6.1
#=GS C5DI24_LACTC/581-829        AC C5DI24.1
#=GS S6ENQ0_ZYGB2/585-755        AC S6ENQ0.1
#=GS I1MLB1_SOYBN/485-828        AC I1MLB1.2
#=GS A0A094CF23_9PEZI/534-785    AC A0A094CF23.1
#=GS I2FPC6_USTH4/662-980        AC I2FPC6.1
#=GS A0A0D2W9D3_GOSRA/483-829    AC A0A0D2W9D3.1
#=GS A7ST09_NEMVE/485-774        AC A7ST09.1
#=GS G9MDX5_HYPVG/533-778        AC G9MDX5.1
#=GS A0A0F0I9Q9_ASPPA/529-782    AC A0A0F0I9Q9.1
#=GS B7Q634_IXOSC/481-749        AC B7Q634.1
#=GS A0A010Q1H3_9PEZI/545-791    AC A0A010Q1H3.1
#=GS G7YES0_CLOSI/524-852        AC G7YES0.1
#=GS U7PJE0_SPOS1/607-939        AC U7PJE0.1
#=GS D4AJ42_ARTBC/547-800        AC D4AJ42.1
#=GS A0A078A463_STYLE/472-727    AC A0A078A463.1
#=GS A0A061GTR0_THECC/484-830    AC A0A061GTR0.1
#=GS J3P394_GAGT3/538-792        AC J3P394.1
#=GS A0A0C2N1X6_THEKT/490-731    AC A0A0C2N1X6.1
#=GS T1KXW2_TETUR/489-765        AC T1KXW2.1
#=GS A0A0B2WQP4_9HYPO/534-780    AC A0A0B2WQP4.1
#=GS W5DXU4_WHEAT/1-200          AC W5DXU4.1
#=GS G2YWH9_BOTF4/338-585        AC G2YWH9.1
#=GS M2T3B7_COCH5/564-819        AC M2T3B7.1
#=GS D0MS56_PHYIT/605-857        AC D0MS56.1
#=GS A0A0J9Y663_BRUMA/496-755    AC A0A0J9Y663.1
#=GS S8FY88_FOMPI/543-854        AC S8FY88.1
#=GS M5WNM4_PRUPE/485-830        AC M5WNM4.1
#=GS A0A068YAH4_ECHMU/628-946    AC A0A068YAH4.1
#=GS C5DQ64_ZYGRC/755-834        AC C5DQ64.1
#=GS A0A0F2M4P4_SPOSC/607-939    AC A0A0F2M4P4.1
#=GS G8BW33_TETPH/542-781        AC G8BW33.1
#=GS A0A0F9ZCP9_9MICR/296-389    AC A0A0F9ZCP9.1
#=GS A0A0E0KDN5_ORYPU/442-788    AC A0A0E0KDN5.1
#=GS A0A074W1V9_9PEZI/537-788    AC A0A074W1V9.1
#=GS F2TS60_AJEDA/559-818        AC F2TS60.1
#=GS I2K0B9_DEKBR/369-652        AC I2K0B9.2
#=GS A0A0K0JCB8_BRUMA/501-770    AC A0A0K0JCB8.1
#=GS M2SZS5_COCSN/564-817        AC M2SZS5.1
#=GS A0A0A0M082_CUCSA/485-828    AC A0A0A0M082.1
#=GS NCBP1_CAEBR/487-763         AC A8XG63.3
#=GS NCBP1_DROWI/488-770         AC B4NC41.1
#=GS A0A0E0KDN6_ORYPU/422-768    AC A0A0E0KDN6.1
#=GS S8ADJ2_DACHA/535-781        AC S8ADJ2.1
#=GS Q4UGZ6_THEAN/708-947        AC Q4UGZ6.1
#=GS G3UGQ0_LOXAF/485-760        AC G3UGQ0.1
#=GS I1N7Z9_SOYBN/490-828        AC I1N7Z9.1
#=GS K9GB08_PEND2/520-773        AC K9GB08.1
#=GS E7NLK7_YEASO/578-825        AC E7NLK7.2
#=GS B8PDA0_POSPM/533-842        AC B8PDA0.1
#=GS A0A090LDE9_STRRB/494-768    AC A0A090LDE9.1
#=GS K5WYN1_AGABU/531-842        AC K5WYN1.1
#=GS NCBP1_RAT/485-760           AC Q56A27.1
#=GS X0CZL2_FUSOX/531-776        AC X0CZL2.1
#=GS L2GAU7_COLGN/554-798        AC L2GAU7.1
#=GS A0A091CMF8_FUKDA/333-417    AC A0A091CMF8.1
#=GS H2M5S5_ORYLA/497-777        AC H2M5S5.1
#=GS Q5AYX3_EMENI/530-783        AC Q5AYX3.1
#=GS C5GXV3_AJEDR/530-789        AC C5GXV3.1
#=GS A0A0A2KK18_PENIT/534-787    AC A0A0A2KK18.1
#=GS A0A093XLE1_9PEZI/534-785    AC A0A093XLE1.1
#=GS G8ZLM5_TORDC/745-825        AC G8ZLM5.1
#=GS A0A0N4TG51_BRUPA/1-160      AC A0A0N4TG51.1
#=GS C0P170_AJECG/349-601        AC C0P170.1
#=GS A0A094IIM4_9PEZI/549-800    AC A0A094IIM4.1
#=GS G1LDU0_AILME/487-762        AC G1LDU0.1
#=GS M4D9I5_BRARP/484-811        AC M4D9I5.1
#=GS A0A0E9NFN8_9ASCO/514-758    AC A0A0E9NFN8.1
#=GS W9WCJ0_9EURO/542-794        AC W9WCJ0.1
#=GS F9FRW4_FUSOF/531-776        AC F9FRW4.1
#=GS H2AM81_KAZAF/590-839        AC H2AM81.1
#=GS G3ATF2_SPAPN/671-853        AC G3ATF2.1
#=GS NCBP1_YEAST/581-828         AC P34160.2
#=GS F1ST49_PIG/424-699          AC F1ST49.2
#=GS T5A852_OPHSC/537-782        AC T5A852.1
#=GS K3VL31_FUSPC/532-777        AC K3VL31.1
#=GS A0A080WN96_TRIRC/1-237      AC A0A080WN96.1
#=GS C5DQ64_ZYGRC/585-760        AC C5DQ64.1
#=GS U4L4H6_PYROM/539-791        AC U4L4H6.1
#=GS A0A0J7NBX7_LASNI/408-640    AC A0A0J7NBX7.1
#=GS C1GXS9_PARBA/567-819        AC C1GXS9.2
#=GS A0A088A145_APIME/488-764    AC A0A088A145.1
#=GS M2XU86_GALSU/503-777        AC M2XU86.1
#=GS V9FGR1_PHYPR/604-857        AC V9FGR1.1
#=GS T0KME7_COLGC/556-801        AC T0KME7.1
#=GS A0A0K9PAN6_ZOSMR/452-784    AC A0A0K9PAN6.1
#=GS D3BF03_POLPA/465-692        AC D3BF03.1
#=GS H2PSU5_PONAB/485-760        AC H2PSU5.1
#=GS U6GML4_EIMAC/804-1033       AC U6GML4.1
#=GS A0A044V1Z9_ONCVO/492-766    AC A0A044V1Z9.1
#=GS B9QCY2_TOXGO/839-1115       AC B9QCY2.1
#=GS G5C1C6_HETGA/252-527        AC G5C1C6.1
#=GS A0A063BR68_9HYPO/534-785    AC A0A063BR68.1
#=GS A0A0A1NA79_9FUNG/153-420    AC A0A0A1NA79.1
#=GS A0A093YR42_9PEZI/534-785    AC A0A093YR42.1
#=GS W4GQH0_9STRA/654-868        AC W4GQH0.1
#=GS A5DTG5_LODEL/728-916        AC A5DTG5.1
#=GS G7E5Q5_MIXOS/591-844        AC G7E5Q5.1
#=GS A0A077ZBZ7_TRITR/409-664    AC A0A077ZBZ7.1
#=GS T0QV77_9STRA/621-838        AC T0QV77.1
#=GS H0VLR0_CAVPO/444-719        AC H0VLR0.1
#=GS S8D3A0_9LAMI/496-821        AC S8D3A0.1
#=GS NCBP1_DROPE/488-770         AC B4GW22.1
#=GS R1EHV8_EMIHU/521-759        AC R1EHV8.1
#=GS G2Q7P7_MYCTT/533-786        AC G2Q7P7.1
#=GS B1N4Y9_ENTHI/2-83           AC B1N4Y9.1
#=GS V7CU42_PHAVU/487-827        AC V7CU42.1
#=GS B9RIH1_RICCO/444-789        AC B9RIH1.1
#=GS R7YXK7_CONA1/626-880        AC R7YXK7.1
#=GS I3M0Y3_ICTTR/485-760        AC I3M0Y3.1
#=GS A8J5P0_CHLRE/707-851        AC A8J5P0.1
#=GS G2QS19_THITE/535-793        AC G2QS19.1
#=GS NCBP1_DROMO/488-770         AC B4L2J8.1
#=GS C4JPG9_UNCRE/529-782        AC C4JPG9.1
#=GS F4W7L2_ACREC/18-291         AC F4W7L2.1
#=GS I2H7H4_TETBL/583-827        AC I2H7H4.1
#=GS D8LFZ4_ECTSI/632-865        AC D8LFZ4.1
#=GS A0A0D9VTY5_9ORYZ/464-811    AC A0A0D9VTY5.1
#=GS A0A0L1J250_ASPNO/554-805    AC A0A0L1J250.1
#=GS R9P1P9_PSEHS/526-840        AC R9P1P9.1
#=GS B3RS52_TRIAD/483-748        AC B3RS52.1
#=GS J3LNQ4_ORYBR/483-828        AC J3LNQ4.1
C5X0L6_SORBI/483-829                   ..............................................................FKFHsd.esNENTDGQKLSKELVGLI.RG.KKT.......VHDIILWVEE.---QI.IPTN.G--....---TE.............FALDVVSQTLL...DMGSKSFTHLI.T.VLE.R..YNKI..ISKL............CPN......................................................EEMQLL...L....MNGVSAYWK.NST...Q...MTAIAIDR.MMGYRLVSNLAIVKWVFS................................PAN..IEQ.F.H.V.SdR.P.WEILRN.AVSKTYNR.......ISDLRKEIQSLKKGLLVA.........kE-Asa..kaiKEleeaksvleivegqpaiae..........................................rpgrirrleshvknaedkeRTIE..ESLE.VKGALLAR.A.LE...ESKDLLKLLF.........K....SFVDVLTERlppvsv......dgkipnL---.--..--.-----RTGDqdvnfapqdpeaatmeidneng.adndsepngrstkngynvgeleQWCL-C..TL..GY..LKSFSRQYASE--i............................................................................................
L8X8T5_THACA/522-802                   ..............................................................YAYE.....SPDHPHYQDAADLLAMV.KD.RAK.......ADEVTAHCLK.LSRSV.----.---....-----.............PVQHMVMQSLL...HVGSRSFSHFL.N.AVE.R..YLPL..LRGE............AGSsaat..............................................neknREKARV...I....LCAAGEYWE.RNQ...Q...MVGVVFDK.LMQYQIIEPSDVIEYAFEl.............................gtKTG..ETP.G.L.S.C.E.R.WLLVEA.ALNKANGR.......VVSAKRKVVTLNKDEEER..........RARa....iaNAggigmdvd...............................................................gdaqpaepdMPTS..QSLV.SAQKALET.L.TK...DQKKAFQCAI.........T....GFVNTLTKA.................gVPAL.AP..AG.AWGRV----.............................................EWNAWE..TW..CW..YRQFCRAYVPQL-r............................................................................................
A0A094HC41_9PEZI/534-785               ..............................................................FKYN.....DEDTPFAAEGREIHSLL.KR.KAP.......EPEIQTVIDQ.IHTQA.TTIA.--I....HEPLL.............SSTDAYVTSIC...YIGSKSLSHVL.S.CIE.R..CKER..LLSI...........gNTS......................................................ETARRQ...I....ITSVMAYWV.DQP...G...IGVNIVDK.LLNYTILTPLSVVEWALLd..............................dTKA..GDK.L.A.E.P.F.V.FEMVAG.TVQKVTNR.......---LRQIV----ASRNAP..........---.......--................................................................................GLEH..EQRL.LLDETLLR.E.RV...AMKDMFKVME.........D....ALFSWASGS..................KDQA.IE..AG.LGETT--DE.............................................AFIRRW..GE..KW..LRVFRRKMAVEE-a............................................................................................
NCBP1_SCHPO/514-777                    ..............................................................FVYE.....NETHPLYQQSSQIIEAL.RL.HKP.......LEELDIILQS.EEIQN.SET-.---....-----.............SAVRLVMSCAY...SLGSRSFSHAL.N.VFE.K..HLNT..LKHF...........sRKS......................................................LDSEIE...V....VDELFSFWK.LQP...F...NAVMWLDK.MLNYSIISITSIIEWLIK................................Q-D..VTI.W.S.R.S.Y.T.WSLVNT.TFNKLAAR.......---LRRSVSNKEDSSLIN..........EAN.......EEkeivtnlllsalralisena.......................................eniwvshwlnlmlkyvesnflSVKK..DTIE.EANEPVQE.N.TS...EEQ-------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------edtkmqpvdavdeqpsennqtaadatn..................................................................
R0HWP4_9BRAS/478-814                   ...............................................akagqnfmysleegk----.....-EKTEEQKLSAELSKKV.KE.KQT.......ARDMMVWIDE.MIHPV.HGF-.---....----E.............VTLSVVVQTLL...DIGSKSFTHLV.T.VLE.R..YGQV..FAKL............CPD......................................................SDKQVM...L....LSQVSTYWK.DNV...Q...MTAVAIDR.MMGYRLVSNQAIVRWVFS................................PEN..VDQ.F.HvS.D.Q.Q.WEILGN.ALNKTYNR.......ISDLRKEITNITKNVLVA.........eKASan...arVEleaaesklslvegepvlgd..........................................npakmkrlkstvektgeaeLSLR..ESLE.AKEALLNR.A.LS...ETEVLLLLLF.........Q....SFLGVLKERlpdstk......vrsvqdL---.KS..IG.--------Aeddnssamevdte..................ngnpkksceigereQWCLST..L-..GY..LTAFTRQYA----nei..........................................................................................
D7T129_VITVI/485-830                   ..............................................................FKYSte.dgKERNEQHALSMELSSMV.KG.RQV.......SREVISWIEE.SVIPV.--HG.S--....----E.............VALSVVVQTLL...DIGSKSFTHLI.T.VLE.R..YGQV..IAKL............CHD......................................................QDKQVV...L....IDEVSSYWK.NSA...Q...MTAIAIDR.MMGYRLISNFAIVKWVFS................................SEN..IEQ.FhT.S.D.H.P.WEILRN.AVSKTYNR.......ISDLRKEISSLKKSLALAegd...avtrK--.......-Aeleaaeskltlvdgepvlg.........................................enpgrlkrlksyaekakeeeVSVR..DSLE.AKEALLAR.A.LD...ENEALFLSLY.........K....NFSNVLMER..................LPDT.S-..--.---------.............................................------..--..--..-------------qagtlrglktiqademavdleesstmdvdnengrpqksqtnggkanngynvgekeqwclsilgyvkafsrqyasei.................
B3L6S4_PLAKH/882-1086                  ..........nsysililffkaliffdssnvsslkknfknhavifsnyknsgvftsdeerlq----.....-----------------.--.---.......----------.-----.----.---....-----.............-----------...-----------.-.---.-..----..----............---......................................................--FEIE...L....LSIVYAYFN.-NS...I...LLNAVVAI.LLENEIVQELSVMHFIFA................................KLE..DTS.L.D.E.Y.Y.V.LKLIYE.SIDNLIIR.......-----KECMDVEKSKLKR..........---.......--................................................................................KQTK..NENE.MLMKELED.K.KN...ELIQKVFLLT.........N....KTIFMLSEK..................MIKL.KN..EN.NAYMS----.............................................------..--..--..-------------kellkeslvflrtyadyid..........................................................................
G3SXB3_LOXAF/485-760                   ..............................................................YKYGd..esSNSLPGHSVALCLSVAF.KS.KAT.......NDEIFSILKD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.T.R.L.F.V.WEILHS.TIRKMSKH.......VLKIQKELEEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGALE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TNVLT----.............................................PWYKNC..IE..RL..QQIFLQHHL----iiqq.........................................................................................
A0A0M8P211_9EURO/531-784               ..............................................................FKYS.....SEMAPYSKEGQELMQLI.RK.KAS.......DEEIQPVITA.IEDQA.KSQG.VN-....-DPKI.............PSTDAFVTSLC...FVGSKSLSHVL.S.CIE.R..SKDR..LLAI...........gAES......................................................QHARCQ...I....ITSVMDYWV.DQP...G...IAINIIDK.LLNYTILSPLSVLEWALSe..............................sVAA..GTI.L.S.K.P.H.V.FEMISA.TVGKVTNR.......---MRQIV----AARTQP..........---.......--................................................................................GLYE..PQLT.VIDETLAR.E.RT...DMQALFKYIE.........D....SIVSIAAGSnd..............eqI---.-E..RG.DGSGTLPED.............................................AIIRQW..GR..RW..LRVFRRKAAVEE-s............................................................................................
J0E190_LOALO/497-757                   ..........................................................eeke----.....--------MVAEIEKAF.RN.KAQ.......PKEVTEMLRG.FDQKS.NSS-.---....-----.............ATLSTFFAVML...NAAQKSFSHNF.A.ALA.R..YHET..LKEL...........sGVD......................................................DESSTA...L....LQTLYDVWK.HNR...Q...MMVVLITK.MLRMTLLNANAVVSWLLS................................SCA..GQE.L.H.R.F.W.L.WEALFM.VVKHSCEH.......MNRCKIKLQQMQEKRARMe........rNDR.......-Nayqrfcy.................................................................needdglgIILD..DDIE.MKKKELKE.I.QE...MLKNLFLNVL.........H....KLVVFLSEH..................VVKY.ET..TG.RNYDT----.............................................YWYRYM..MG..RY..KEILLRYWHE---lfe..........................................................................................
A5K2V0_PLAVS/891-1094                  .............sysililffkaliffdstnvsslkktfknhavifsnyknsgvltseeer----.....-----------------.--.---.......----------.-----.----.---....-----.............-----------...-----------.-.---.-..----..----............---......................................................LQFEME...L....LSIVYAYFN.-NS...I...LLNAVVAI.LLENEIVQELSVMHFIFA................................KLE..DSS.L.D.E.Y.Y.V.LRLIYE.SIDNLIIR.......-----KECTDVEKSKLKR..........---.......--................................................................................KQTK..NENE.MLIKELED.K.KN...ELIQKVFLLT.........N....KTIFMLSEK..................MMKL.KN..EN.NAYMS----.............................................------..--..--..-------------kellkeslvflrtyadyvd..........................................................................
B6QVA1_TALMQ/550-804                   ..............................................................FKYT.....LETTPYSKQGLELMQLI.RK.KAS.......DEEIEPVIAE.IETQA.KEHG.--I....EDPIV.............PSTDAFVTSIC...YVGSKSLSHVL.S.CIE.R..NKER..LLAI...........gPRS......................................................APGRRQ...I....ITSVMEYWV.DQP...G...IAINIIDK.LLNYTILTPLSVIEWALLd..............................hIDA..GRI.L.A.K.A.H.I.YEMLSS.TVGKVTNR.......---IRQIVAARTQR----..........---.......--................................................................................GLYE..PQLS.VLDETLNR.E.KA...DMQTLFTLIE.........D....SIAPVAAGS.................nDELM.ER..SE.DDPSTRDEN.............................................EIIRRW..AV..RW..RRVFQRKAAVE--aa...........................................................................................
L8FMN0_PSED2/534-785                   ..............................................................FKYN.....DEDTPFAAEGREIHTLL.KR.KAP.......EPEIQTVIDQ.IHTQA.TTIA.--I....HEPLL.............SSTDVYVTSIC...YIGSKSLSHVL.S.CIE.R..CKER..LLSI...........gNTS......................................................ETARRQ...I....ITSVMAYWV.DQP...G...IGVNIVDK.LLNYTILTPLSVVEWALLd..............................dTKA..GDK.L.A.E.P.F.V.YEMVAG.TVQKVTNR.......---IRQIV----ASRNAP..........---.......--................................................................................GLEH..EQRL.LLDETLLR.E.RV...AMKDMFKVME.........D....ALFSWASGS..................KDQA.IE..AG.LGETT--DE.............................................AFIQRW..GE..KW..LRVFRRKMAVEE-a............................................................................................
G0V679_NAUCC/573-742                   .............................................................l-YFR.....NSMVPMNEAVNWMKEYI.QK.HPT.......SPSLPVLENA.LTKIK.NNFN.SII....SKFDH.............FSIVLLIHMTL...YCGKKALSLTS.N.YIL.G..MHHI..LKGI............FDKin.................................................ipqIEKEFM...I....VEAILRFWN.SNP...H...IGFLVTEM.FLFHGFVSIQVILQFIFNd..............................yNGK..VYG.L.V.D.E.S.T.ILFTFR.ILD-----.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------yhtlp........................................................................................
A7TKT7_VANPO/594-761                   .............................................................l-YFK.....QDSLPFAELTRRLIDFM.HK.NGE.......EKKIEELESI.VEEFK.ENYG.TMF....TNFDK.............FIVTIIVQCLA...HSGSRSLSHAN.K.YIN.D..LADD..IKHI............FNKle.................................................iedDIKQFT...A....IEAIVRFWN.SNS...Q...TGFLITDA.FKYAEIISSKSIFEFCFFe..............................kDNR..NYG.L.V.D.S.T.V.IEAIFR.NLSQ----.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------dp...........................................................................................
A0A0J8CYG0_BETVU/500-765               .......................................alseelnglvrgrqtvreiiswv----.....-----------------.--.---.......--------EE.-----.---N.VIP....VHGLE.............VTIQVVIQTLL...NIGAKSFTHLM.T.VLE.R..YGQV..IAKV............CPD......................................................EDRQVM...L....INEVSTFWR.NST...Q...MTAIAIDR.MMGYRLISNLAIVRWVFS................................SEN..VDQ.F.H.T.SdR.P.WEILRN.AVSKTYNR.......ICDLRKEISSLKQRLQSAee.....ataN--.......-Akaeletaeskltlmngepiv.......................................gdnpiklkrlisssekaeeeeVALR..ESLE.AKEALLFR.A.LG...ENEALFLSLY.........K....NFSIVLLDR..................----.--..--.---------.............................................------..--..--..-------------lpkgsaigtsrslras.............................................................................
C1E0M0_MICSR/522-800                   ................................................yiletlngssgalr----.....-----------DLQAFM.KE.KKP.......AAEVMEWLKT.SGKLD.ALGR.A--....-----.............GAAKVLTVAAL...QHGQKCITHHN.V.LLK.R..YEGA..LTEL...........tQES......................................................SEEQGCadvM....VAAAAGIWAgTHP...H...MAVTAVSR.LLELGLVKPADVARWLETsisdeta..................agtdedgASR..GVA.W.G.T.A.D.A.WDIACL.AVETVAAD.......--RVNREWKASAARRKVEa........aEAQaa..ratADadraas...................................................................qgrhvdaGRAK..EAAG.RIEGKIAR.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------lraelddaslpvehagaqladaagalclalvkalapkladaaadaagp.............................................
G0VGQ5_NAUCC/583-831                   ............................................................lf--FK.....LSSIPMDESVRTLLDYV.HK.QNE.......QRDVNDLKTI.ISDIK.EQYG.STV....TDFNR.............FIIVLLIQCVV...HSGSRSLSHAN.K.YIS.D..LKDE..LNEVfg.......aleISQ......................................................EEKEYT...I....IDAVMKYWN.KNS...Q...NGFLIADA.LKFAGLISAKSLYNFCFTe..............................iNGK..NYG.I.V.D.G.T.A.IEAIFR.NLSQQGIS.......------------------..........---.......--................................................................................----..----.--------.-.NP...ENVEDFEFVF.........E....KLCIIVNGV..................VQEL.GV..QT.TEEIPAQILdpememdl............................etegprlnsLWKYST..TV..SF..IKSILRRYSKEYR.............................................................................................
A0A094CPK7_9PEZI/534-785               ..............................................................FKYN.....DEDTPFAAEGREIHTLL.KR.KAP.......EPEIQTVIDQ.IHTQA.TTIA.--I....HEPLL.............SSTDAYVTSIC...YIGSKSLSHVL.S.CIE.R..CKER..LLSI...........gNTS......................................................ETARRQ...I....ITSVMAYWV.EQP...G...IGVNIVDK.LLNYTILTPLSVVEWALLd..............................dTKA..GDK.L.A.E.P.F.V.FEMVAG.TVQKVTNR.......---LRQIV----ASRNAP..........---.......--................................................................................GLEH..EQRL.LLDETLLR.E.RV...AMKDMFKVME.........D....ALFSWAAGS..................KDQT.ME..GG.NGDT--SDE.............................................AFIRRW..GE..KW..LRVFRRKMAVEE-a............................................................................................
A0A096R9N1_MAIZE/483-829               .............................................................f-KFHsd.esNESTDGLKLSKELIGLI.RG.KKS.......TYDIILWVEE.QIIPK.--NG.---....---TE.............FALDVVSQTLL...DMGSKSFTHLV.T.ILE.R..YNKI..ISKL............CPN......................................................EEMQLL...L....MNGVSAYWK.NST...Q...MTAIAIDR.MMGYRLISNLAIVKWVFS................................PAN..VEQ.F.H.V.SdR.P.WEILRN.AVSKTYNR.......ISDLRKEIQSLKKGLQVA.........kE-Asa..knrKEleeaksvleivegqpapae..........................................rpgrirrleshvknaedeeRTLE..ESLE.AKGVLLAR.A.HE...ESKDLLKLLF.........K....SFVDVLTERlppvsvdgeipnlrsgdqN---.--..--.--------Vnfaaqnseaatmeidnenga....dnnsepnerntknaynvgeleQWCL-C..TL..GY..LKSFSRQYASE--i............................................................................................
A0A0L0P1Q3_9ASCO/657-925               ..............................................................YEFS.....NPQLPLHEIANKLYDFIiAN.WRS.......NEQFYDMIKE.TIEAI.KSS-.VVH....VDADR.............ILINLLFQTYA...YIGSRSIYSVV.S.ILN.R..DIAK..LKFI............SGQtvteedykasgtd............................fsfpdmelndeqfQERQKW...I....VDSILRIWV.HQP...Q...VAFLILEY.LIEFGILNANFLIKKALD................................FDH..NLI.I.S.N.V.S.C.MESINR.VLSNSSQG.......------------------..........---.......--................................................................................----..----.--------.-.-D...QFKEVILTLF.........G....RIVENLNLT..................VMKL.EV..TD.PANDEI--Eiikqisedqk........................sdeqlmakidlQWLFYE..YR..GL..LKTYLRKFNVEH-a............................................................................................
A8Q346_MALGO/615-928                   .............................................................a-RYT.....QASSPHRAMAEQLFQSI.KA.KAN.......VHVVQADLQS.FQQSI.LAPA.TDV....PDTDDearfvdspaeaerLVLDMAIQTLL...YAGSRSFSHLL.N.VIE.R..YHEL..LRSL............SQT......................................................PEARVA...I....LQSTAAFWT.HSP...Q...WILIVCDK.LLQYRIVEPVDVVTFVFAddaqrdtdrsdeeesaapsspfdvaatrvpewGGT..HRD.W.S.S.F.H.W.WAMLRL.TMDKVMGR.......VNQLTRRVQDLRRRADDN.........qA-Aaa...saTSte...........................................................................larHPAS..SSME.EAQVHLDA.V.LL...EQRKVLVTIL.........S....RLVLFLQDK..................A-HV.SI..QD.EPDSC----.............................................AWQVWW..VR..EW..YRAFMAVYYVV--va...........................................................................................
E1BMM0_BOVIN/485-760                   ..............................................................YKYGd..esSNSLPGHSVALCLAVAF.KS.KAT.......NDEIFSILKD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.T.R.L.F.V.WEILHS.TIRKMNKH.......VLKIQKELEEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGALE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TSVLT----.............................................PWYKNC..IE..RL..QQIFLQHHQII--qq...........................................................................................
S6ENQ0_ZYGB2/750-829                   ...........................................................qhl----.....-----------------.--.---.......----------.-----.----.---....-----.............-----------...-----------.-.---.-..----..----............---......................................................------...-....---------.---...-...--------.------------------................................---..---.-.-.-.-.-.-.------.--------.......------------------..........---.......--................................................................................----..----.--------.-.--...DNHDCFAFVS.........E....RLVNIVNQC..................ISDL.GL..QV.DEEIN-IPDvsanpetni...........................gtdlpqwdlLWKYET..TM..GF..LKSILRKYVDEYR.............................................................................................
J7S6P4_KAZNA/583-831                   .............................................................l-YFK.....QENVPFAEITVELLDYI.HK.QND.......ARTYTELEEI.INKLK.EGHQ.SII....PDFDR.............FVVILVTQAVV...HSGSRSLSHAN.K.YIS.D..LQED..LKTL............FNSlq.................................................ideSVKETA...I....IEAVMSYWN.SNS...Q...NGFLIVDA.FKFGGMVSSNSIYSFCLAd..............................lEGN..IHG.L.T.D.V.T.A.IDTIFR.TLSQQLDT.......------------------..........---.......--................................................................................----..----.--------.-.DA...ADTADFELVF.........E....KLCLIVNKT..................VEEL.EI..QP.EDQI-VIPEieddtpvdp...........................vtevprldlMWKYSS..AV..SF..TKSLVRKYSDQFK.............................................................................................
A0A0D9LAA4_9EURO/531-784               ..............................................................FKYS.....SEMAPYSKEGQELMQLI.RK.KAS.......DEEIQPVITA.IEDQA.KSQG.VD-....-DPKI.............PSTDAFVTSLC...FVGSKSLSHVL.S.CIE.R..SKDR..LLAI...........gAES......................................................QHARCQ...I....ITSVMDYWV.DQP...G...IAINIIDK.LLNYTILSPLSVLEWALSe..............................fIAA..GTI.L.S.K.P.H.V.FEMVSA.TVGKVTNR.......---MRQIV----AARAQP..........---.......--................................................................................GLYE..PQLT.VIDETLAR.E.RT...DMQALFRYIE.........D....SIVSIAAGSnd..............eqMERG.DG..SG.TLPED----.............................................AIIRQW..GR..RW..LRVFRRKAAVEE-s............................................................................................
D2VH37_NAEGR/629-880                   ..............................................................FKYT.....-PDSPYHADATKLLDAIkGK.KKD.......NTEVIELFST.LDCKD.DKI-.---....-----.............LLLDIFISCIL...S-NQKNLTEFS.D.LLT.Y..YKEA..ISQLm..........dFDV......................................................LPQRVN...I....IRCLWRYWH.KSP...Q...RIILLMKKlLLQHDIISCQSLANYLFT................................D-N..ELL.F.S.Y.G.Y.S.WDILKS.CLDTQITR.......ALRAFEYGDDSTSTSDTVp.......kiKKD.......NQps...........................................................................dhfDLDK..AVKG.LDSMFFKM.L.LG...EIRETVYIIT.........R....LLTEKLLTY..................D---.--..--.--NVK----.............................................SWEFNH..LY..GL..LKEVARLYQVYV-k............................................................................................
X1X825_ACYPI/407-512                   ..............................................................FKYAi...eKSSLPGQFLSNTLLTKI.RN.KTT.......PEDIIEILKE.---PL.MSEN.GEI....LEPADigi.......snpTKVDAFVQTLL...FIASKSFSHAF.A.AIT.K..FISI..FKAL............GET......................................................DDG---...-....---------.---...-...--------.------------------................................---..---.-.-.-.-.-.-.------.--------.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------pianikk......................................................................................
K7IKM6_CAEJA/1-205                     .............................................mfqerqpadafvselki----.....-----------------.--.---.......----------.GDNEE.LPYS.---....----A.............HDFGVFVAVML...KMAAKTYSHNF.S.ALS.R..YQIT..LKTV...........cDAS......................................................DQYQEK...L....LDTLYNCWK.TNQ...Q...MMMILIDK.LLKMQVLDCSVVVAWLFD................................EKM..WQE.H.D.R.Q.W.L.FEVLNQ.ALEKLTRQ.......IVIVEKDIKELAENIENEdk.....qeeN--.......-Eadekmt....................................................................ddeskpQKQQ..EDLE.AHKQKLEA.M.VQ...FQKGLFID--.........-....---------..................----.--..--.---------.............................................------..--..--..-------------fll..........................................................................................
X1XHK1_ACYPI/1-135                     .............................................................m----.....-----------------.--.---.......----------.-----.----.---....-----.............-----------...-----------.-.---.-..----..----............---......................................................------...-....---------.---...-...--------.------------------................................---..IPE.F.T.K.L.Y.I.WEILSL.TINKMSRH.......VDRLTRELNEAREKLRTTaai...snssD--.......-Dsdtetekaeakprqs.................................................ttttfggqgvpmdvddNVTE..EMVE.RMEEKLEM.A.QA...DQKNLFLIVF.........Q....HH-------..................----.--..--.---------.............................................------..--..--..-------------eqvqkysstlegllftqdldi........................................................................
W2RVM6_9EURO/542-793                   ..............................................................-KFE.....KEGVPFGDKAKEIVQLI.RK.RAS.......VDEMEPILEQ.VEAEA.KAGG.SND....LQARA.............IAIDVLATSIT...WVGSKSLSHVL.A.IVD.R..SKSV..LAKLm..........aIDN......................................................VAMQSQ...I....ISSIFEYWQ.FQP...G...TASIITLK.LVNYQVLTPEGVIAWTFGt..............................gIDG..GRC.L.S.R.V.H.S.WEIVTG.VLGKVAMK.......---VKEVVHLARTP----..........---.......--................................................................................GLDE..EKRT.ELSGVLET.E.MT...GHRALFAQMK.........R....GLQTVQTGQ..................MA--.-A..NG.DRMLTEEEE.............................................ALVKVW..VA..KW..S------------wcmdrkekvme..................................................................................
A0A0E0NUZ5_ORYRU/483-829               ......................................................fryhsdeg----.....KESTDGHRLSKELVAMV.RG.RKT.......QGDIISWVDE.KIIPV.--NG.---....---AK.............FALDVVSQTLL...DIGSKSFTHLI.T.VLE.R..YGQI..ISKL............CPN......................................................EEMQLL...L....MDEVSAYWK.NST...Q...MIAIAIDR.MMGYRLLSNLAIVKWVFS................................PAN..VDQ.F.H.V.SdR.P.WEILRN.AVSKTYNR.......IFDLRKEIQTLRKGLQAAke......asE--.......-Kaareleeaksiieivdgqpvp......................................senpgrlrrlqaradkakegeVTTE..ESLE.AKEALLAR.G.LE...ESKELLRLLF.........K....SFVEVLTERlppisad...gdvpnlraG---.--..--.--------Dpnvnssardpeattmeidneng.gdndsqlngqnkkishnvgeleQWCL-C..TL..GY..LKSFSRQYATE--i............................................................................................
E2LB17_MONPE/113-226                   ..............................................................FEYN.....DPAKPHHDAAQSILNLF.RG.RAQ.......AGDVIAHLDT.LKSNL.ESES.SDSg.qlVNVDA.............VMRSIAIQSLL...HIGSRSFSHLL.N.AIE.R..YLSL..LRFI............ASGgvsea............................................pgggiPEAKSD...I....LNA------.---...-...--------.------------------................................---..---.-.-.-.-.-.-.------.--------.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------.............................................................................................
V5ENX7_PSEBG/658-969                   ..............................................................FTYA.....DEAHPYAAQAGRLINSI.KA.KAS.......AEVILADFET.FKSSI.IETT.TSL....PTETSagmvpn.atqadvVVRDLTIQCIL...SVGSRSFSHFL.N.IVE.R..YHAL..LRQL............SRS......................................................GRMRAA...I....LAGAVRFWN.ASQ...Q...WVHIVVDK.LLQYRIVEPADVVEFIFSppvde.....................pgairtGGE..REG.W.A.G.F.N.T.WTLLRL.TLEKVNGR.......VDQLQKRLEEIQRKEGEEae......rkE--.......-Aaaaaglpfsdepeaape.............................................kaeplfptsatlpirpeeKSAE..PSST.EALANLDA.I.KS...EQRKVLILSV.........T....GFKNLLLSA..................D---.--..--.-GSQ----D.............................................EWTQWW..IS..SW..YKQFVRCFNRQ--ll...........................................................................................
I1QET0_ORYGL/454-801                   ......................................................fryhsdeg----.....KESTDGHRLSKELVAMV.RG.RKT.......QGDIISWVDE.KIIPV.--NG.---....---AK.............FALDVVSQTLL...DIGSKSFTHLI.T.VLE.R..YGQI..ISKL............CPN......................................................EEMQLL...L....MDEVSAYWK.NST...Q...MIAIAIDR.MMGYRLLSNLAIVKWVFS................................PAN..VDQ.F.H.V.SdR.P.WEILRN.AVSKTYNR.......IFDLRKEIQTLRKGLQAAke......asE--.......-Kaareleeaksiieivdgqpvp......................................senpgrlrrlqaradkakegeVTTE..ESLE.AKEALLAR.G.LE...ESKELLRLLF.........K....SFVEVLTERlppisad...gdvpnlraG---.--..--.--------DpnvnssardpeattmeidnenggdndssqlngqnkkishnvgeleQWCL-C..TL..GY..LKSFSRQYATE--i............................................................................................
A5DCB1_PICGU/640-902                   ..............................................................FYFG.....NNRLPLHEISNKVYEFLvAQ.WKP.......NEDLLDIYQE.LQDNL.SSHP.AID....AET--.............FTVNVFLQTYA...YLGSRSIYSVV.S.LIS.R..DKLK..LKYLlg.......apiD-Dkdyvpgstfr.................................feernltqeqiDKRQNL...A....IDSIFRLWV.NQS...Q...MAFLLLEY.LIEYKILQPIYLVGKCLS................................LET..NLV.I.D.N.V.A.C.MESINR.ILESSYTT.......------------------..........---.......--................................................................................----..----.--------.D.RD...EFNVLYQYLL.........E....RIIQNLSSLae..............gnN---.--..--.-DEIKITTEfsdeeadd............................lekmnvidkQWLFYE..YT..GL..LKSYLRKYYEES-t............................................................................................
C5MAR3_CANTT/620-797                   ..............................................................FNFT.....NNELPFHEVGSKVYDFIlTH.FKS.......NTDFNELYKS.VISEV.E---.--V....PNPER.............FVVNMILQTYA...YIGSRSIYSVV.S.ILS.R..DINK..LKFL............SGAaidyvgeeaq.................................fqdlhlteeqkQDRQIW...I....IDAIFRIWI.HQP...Q...VVFLILEY.LIEFGIIKPKYLLQKALE................................S--..NLI.I.D.N.V.S.C.MESINR.VLANSK--.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------sk...........................................................................................
A0A0N4YY38_NIPBR/18-177                ...........................................................arr----.....-----------------.--.---.......----------.-----.----.---....-----.............-----------...-----------.-.---.-..----..----............---......................................................------...-....---------.---...-...-IIILVDK.MLKMQILDCGVVISWIFS................................ESI..RSE.T.D.R.Q.W.V.WDVLNT.ALERLSRH.......IHKVAHDVHILQKRVERQ..........RAEt.....gEEmed.........................................................................gdakTREQ..EELE.QQQEKLDN.L.KD...FQKSLFLDVL.........H....KFTVLITEY..................IVHC.ET..EG.TDFRT----.............................................PYFSWI..NG..RF..KQIFLMHGS----dlh..........................................................................................
A4RZY8_OSTLU/213-450                   ......................................................galkemla----.....-----------------.--.--S.......KKEGHEVLGW.IQSQA.ASA-.---....-SPDV.............LLRALAVATLE...R-GQKCITHHD.V.LLK.R..YALP..IRDL............VEK......................................................AGGEV-...L....VDAAAGVWR.GHP...Q...MGPIAIER.LLALDLVTPAAVVNWLLQraa..........................afgEDD..TYE.I.A.N.-.V.V.CEFVCA.SKEQAIGK.......REALLRKLREAEAEAAAA.........gQAAt....elTEqgrvfeaqqa...........................................................qaaeasaveeiS---..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------iheaalasadapvdrcaaitreiclnlcgglvkaasggasaavad................................................
Q2GXY9_CHAGB/535-778                   .........................................................pkltk----.....-IDTPFAAEGREIAGLL.KR.KAD.......DEEIDAVIQR.IQSQA.IDRE.---....IDALV.............ASTDVFVTCVL...HVGSKSLSHVL.A.AIE.R..TKDR..LADA...........gAAS......................................................DAARSQ...I....ISATMAYWS.AHP...G...VALSIIEK.LLNYSILTPETVITWALVsr............................agNTR..GEA.L.S.V.S.H.V.YEMVFN.TVIKVTGR.......---VRQLVAKPAL-----..........---.......--................................................................................----..----.--AAEDED.E.IK...AMRALFAAIE.........D....ALASWASGS..................KDEM.IE..SS.ETEANSEGE.............................................KLVRSW..GA..RW..LRVFRRRAAIEE-a............................................................................................
L5M790_MYODS/558-833                   ..............................................................YKYGd..esSNSLPGHSVALCLAVAF.KS.KAT.......SDEIFSILKD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.I.R.L.F.V.WEILHS.TIRKMNKH.......VLKIQKELDEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGALE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TSILT----.............................................PWYKNC..IE..RL..QQIFLQHHQII--qq...........................................................................................
M2YNE3_DOTSN/561-812                   ..............................................................FKYN.....SDATPFAKEGREVLAAL.KK.KAP.......EEEVQRILDS.VHEQA.TAM-.-SF....ADPLV.............PSTDIYTTSIL...SIGSKSLSHVL.S.TID.R..CKDR..LLSI...........gQQS......................................................EAARRQ...I....IASVIDFWA.EHP...G...TAVNIIDK.LLNYMIITPMAVIQYALHd..............................rMDR..GRA.L.A.S.S.Q.I.YEMVSI.TMFKVTNR.......---VRQVL----RERNNM..........---.......--................................................................................SLPF..DQRK.QIDEALPR.E.RE...GMRELFAAIE.........D....AVSAVANGA..................QDEM.IE..RY.--DGDSAER.............................................DMIILW..GN..RW..TRVWRRKAAVEE-a............................................................................................
W6UR31_ECHGR/541-866                   ..................................................ssasatseksrp----.....-----------------.--.---.......---VKNELTS.SKRAR.NKEK.MED....N---EddfdnclvpgvtnRELELFMTALL...YRAHKTISHTC.S.LLN.R..YSEA..FKTL............AST......................................................VELQVE...A....LHILQAVWC.NQS...Q...MVVAISDY.MSRQGMLDPESVVGWAFSpfmsafcg................plapppstVHV..CPR.M.L.Q.S.H.V.WECLMH.TLVRVGQR.......IAQITPRLEAVKDQAGVHh........rK-Sas...gsRSdgsssdldndygdgdlrtkivr....................................vrrrhqrhcrvgshgsssggggGTSP..DRLA.RLKEERGE.A.VR...SQCAVITLLL.........H....RHVRLVATVea..............kaTEEM.GA..PD.NPSDLVDLA.............................................SVAYWL..KG..RL..MQTVLEHQD----qll..........................................................................................
S7QKB1_GLOTA/537-840                   ..............................................................FEYD.....EPSNPYHNAAQSVLNLL.KG.RAK.......ADDVLAHLET.LKTTI.GETA.EGD....VNVDS.............VIRSVAVQSLL...NIGSRSFSHFL.N.AIE.R..YLAV..LRSL...........sTGG......................................................IDARTD...I....LTAVSLFWK.RNR...Q...MISIVFDK.LMQYQIVDPTDVVAWTFTngvg........................nergDTE..GPS.A.I.N.A.H.D.WDLLKG.ALDKANGR.......VLVARKRVSALRKEEDDTra......rvKAS......gGDvasmevd..................................................................aeakpdePPES..AALT.TAVKAFTS.L.TT...QQKNALARAL.........D....GFIACLAPL..................SS--.DR..RA.NPYAREVLTekawhn................................ranwtddDWNAWE..TW..GW..YRHFCRAYSPYL-r............................................................................................
H9G962_ANOCA/602-888                   ..............................................................YKYGd..esNKSLPGYNVALCLNIAI.KN.KAS.......NDEIFTILKD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFVQTVL...HLAAKSFSHSF.S.ALG.K..FREV..FKTL............AES......................................................DEGKLH...V....LRVMYEVWK.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..AHD.F.T.R.F.Y.I.WEILHS.TIRKMNKH.......VVTIQKELEETKARLAKQ.........hKRRd....sdDDddddddddd..............................................................ddhsidredGPLE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..GG.IDVMT----.............................................PWYKNC..IE..RL..EQIFLQHHQII--hq...........................................................................................
M3AD00_PSEFD/560-811                   ..............................................................FKFA.....NDQTPYAKEGREVLTLL.KK.KAP.......EDEIQKVLDS.VHEQA.TALG.--H....ADPLA.............PSTDIYMTSIL...SIGSKSLSHVL.S.TID.R..CKDR..LLSV...........gQRS......................................................ELARRQ...I....IESVVQFWS.DHP...G...TAINIVDK.LLNYTIVTPMSVIQWALQd..............................rMDS..GRA.L.A.S.S.Q.V.YEMVSI.TMFKVTNR.......---VRQVL----RERNNL..........---.......--................................................................................SLPY..ESRQ.QIDEALPN.E.RQ...AMRDLFAAIE.........D....AVAAVANGSqd..............gmIERF.--..NG.AIA-----E............................................rDLIVLW..GK..RW..ERVWQRKAAVEE-a............................................................................................
NCBP1_XENTR/485-761                    ..............................................................FKYGd..esNSALPGYSVAVALTNAI.KN.KAS.......DKEIFNILKD.IPNPN.QDDD.DDE...gISFNP.............LKIEVFVQTLL...SLASKSFSHSF.S.ALA.K..FHDI..FKAL............SES......................................................DEGKLH...I....LRVVYDIWK.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................PEL..SRD.F.P.R.F.Y.I.WEILHS.TIRKMNKH.......VQKIQKELEDMKLRLAKQ.........hKHRds...ddNDeds.........................................................................grkdGPLE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..GG.IDVNT----.............................................AWYKNC..RE..RL..QQIFLQHHQII--qq...........................................................................................
W7A6T6_9APIC/857-1069                  ....ftesaecwnsysililffkaliffdssnvsslkktfknhavifsnyknsgvltseekt----.....-----------------.--.---.......----------.-----.----.---....-----.............-----------...-----------.-.---.-..----..----............---......................................................LQFEIE...L....LSIVYAYFN.-NS...I...LLNTVVAI.LLENEIVQELSVMHFIFA................................KLE..DSS.L.D.E.Y.Y.V.LRLIYE.SIDNLIIR.......-----KECMDVEKSKLKR..........---.......--................................................................................KQTK..NENE.MLIKELED.K.KN...ELIQKVFLLT.........N....KTIFMLSEK..................MIKL.KN..EN.NT-------.............................................------..--..--..-------------cmskellkeslvflrtyadyvd.......................................................................
NCBP1_MOUSE/485-760                    ..............................................................YKYGd..esSNSLPGHSVALCLSVAF.KS.KAT.......NDEIFSILKD.VPNPN.QVDD.DDE....-GFRFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DKGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.T.R.L.F.V.WEILHS.TIRKMNKH.......VLKIQKELEEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGALE..EQIE.RLQEKVEA.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TSILT----.............................................PWYKNC..IE..RL..QQIFLQHHQTIQ-q............................................................................................
E3NEH5_CAERE/504-779                   ...........................................................yli---D.....EEDTALVQRAETFTQMF.QE.RQP.......AEAFLNELKS.AEGSE.ELPY.---....---NI.............NEFGLFVMVML...KMASKTFSHNF.S.ALF.R..YQAT..LKTV...........cDAS......................................................EQYQEK...L....LETLFSCWK.SNQ...Q...MLMILTDK.LLKMQVIDCSAVVAWLFD................................EKM..WAE.H.N.R.Q.W.L.FEVLNQ.ALEKLTRQ.......INVVEKDIKELTERVENKgtd....dvkE-E.......-Emeaee.....................................................................ekneklKQDV..DDLE.NHKEKLER.M.VT...FQKGLFNDFL.........I....AFVEEIKIAg...............anTSEM.DG..SG.DTAGR--QS.............................................PKFQWL..KG..RF..CHVLLAHAETL--lk...........................................................................................
A0A066X9Z7_COLSU/534-780               ..............................................................FKFN.....DDSTPFAAEGREIAALL.RR.KAP.......DEEFQPIIER.IHSLA.IERS.---....LDPLV.............TSTDVFVTAVC...WVGSKSLSHVL.A.CIE.R..TKDR..LLDV...........gVAS......................................................EVAKAQ...I....ITAVMSYWA.AQP...G...VAISIVEK.LLNYSIILPITVIEWALSgss.........................hvkgQSS..GDA.L.A.Q.P.H.V.FELVFG.TVAKVTGR.......---VRQLL----T-----..........---.......--................................................................................----..KEAE.ADEEAKER.E.TK...AMRDLFKAMD.........D....ALVSWASGS..................KDEM.ME..EM.DGA--GQRD.............................................ALLRRW..GE..RW..LRVFRRRSAIEE-a............................................................................................
Q4WDL2_ASPFU/362-611                   ............................................................pt----.....--ATPYAKEGREIMQLI.RR.KAG.......DEEIQPLITA.IEEQA.KALG.V--....DDPML.............PSTDAFVTSIC...FVGSKSLSHVL.S.CIE.R..NKER..LLAI...........gPKS......................................................ARARCQ...I....ITSVMEYWV.DQP...G...VAINIIDK.LLNYTILTPLSVIEWALVe..............................rLQA..GTI.L.S.R.T.H.I.FEMISA.TVGKVTNR.......---LRQIV----AARTQP..........---.......--................................................................................GLYE..PQLS.VLDETLSR.E.KA...DMQALFRVIE.........D....SVVSVAGGSnd..............glMERG.DG..SG.NLPED----.............................................EIIRQW..GR..RW..LRVFRRKAGVEE-s............................................................................................
W6NQB7_HAECO/631-891                   .............................................................c-KFD.....DENQPGYEAASKFLALI.QS.RSD.......DNAIMAEIRD.EENR-.--YD.---....P----.............DLFGIFFAVLL...KTSAKSFSHTF.V.ALS.R..YSTT..LKTI...........aDTS......................................................DEMQEV...L....LCCLFQCWR.NNH...L...RIIILVDK.MLKMQILDCGVVISWIFS................................ESL..KSE.T.D.R.Q.W.V.WEVLNT.ALERLSRH.......IHKVAHDVDILQKRVERQr........iEAGe.....eMEds...........................................................................dvkTREQ..EELE.QQQEKLEN.L.KD...FQKSLFLDVL.........H....KFTVLLTEF..................IVNC.ET..EG.TDFRT----.............................................PYYAWI..NG..RF..KQIFLMHGAD---lhe..........................................................................................
G8ZLM5_TORDC/581-751                   .............................................................l-YFN.....QESVPFSEEVRQVLDYI.HK.SND.......VREVSELETI.LESIK.EKYG.ALI....SDFDR.............FTIVLLVQTVV...HSGSRSLSHAN.K.YIG.D..LRDD..LNVI............FEKlq.................................................isnESKEFI...I....VEAVVRFWN.SNS...Q...NGFLIADA.FKHAGLIKPQAILSFSFTe..............................yDNK..NYG.L.V.D.G.T.S.IESTFR.SLSQE---.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------addn.........................................................................................
A0A086TBE1_ACRCH/534-792               ..............................................................FKFA.....NPDTPFSAEGQEIAALL.RK.KAP.......DDDFQPIIDR.IQAQA.SEQG.---....LDPLV.............ASTDVFMTAVC...WVGAKSLSHVL.A.CID.R..TKVR..LLDV...........gGAS......................................................EVARSQ...I....VASVMSYWS.AHP...G...VALAIVEK.LLNYSILTPLAVIDWAVVgst.........................psngTNG..GES.L.V.Q.A.H.V.FEIVSN.TVAKVTGR.......---VRQLY----N-----..........---.......--................................................................................--TP..AGGE.ADLEARSK.A.AR...DMRDMFRSLN.........D....ALSSWAGGSkdel.........megggG-GG.GG..GG.GDDGSDERE.............................................GLIRRW..GQ..RW..LRVYQRKVALEE-a............................................................................................
W4Y6T8_STRPU/494-770                   ..............................................................YKYGe..egAESLPGYAIAQTLCDLI.KK.KGS.......IEVVLEVLKD.APNPK.DVDG.MED...eTSFNA.............LKIDVFVQVLL...YLGSKSFSHSF.G.ALA.K..FLPV..LKEL............AVN......................................................EESQIY...I....LRVIKDLWR.NHS...Q...RIAVLVDK.LLRTRVISCPAVANWLFS................................SFM..SSS.F.T.R.M.F.V.WEILHS.TINTMNKH.......VKGCETELEEARQSAKRPdd.....vdmE--.......-Sdeedr......................................................................yditkAASE..SKIE.QLQEKLEG.A.QS...EEKKLFLIIF.........Q....RFVMVLGEH..................MVSC.EN..KG.EEFRT----.............................................PWFIHA..IQ..RL..QQIFLVHYHQVV-k............................................................................................
A0A0K6FSW1_9HOMO/543-823               ..............................................................YAYD.....DPDHPHYQEAADLLVMV.KE.RAK.......ADEVAAHCLK.LPRSV.----.---....-----.............PVQHMVMQSLL...HVGSRSFSHFL.N.AVE.R..YLPL..LRGE............AGSgslt..............................................gdkdKEKARP...I....LCAAGEYWQ.KNQ...Q...MIGIVFDK.LMQYQIIDPSDVIEYAFEs.............................gvKEG..ETF.G.L.S.S.E.R.WLLVEA.ALNKANGR.......VVGAKRKVATLNKDEDER..........RARa.....mAKgggigmdvd..............................................................gdgqlaepdMPAS..QSLV.SAQKALDT.L.TK...DQKKVFQSAI.........T....GFINALTKA.................gVPAL.AS..AG.TWGQA----.............................................EWSAWE..TW..CW..YRQFCRAYVPQL-r............................................................................................
A0A0G4IX35_PLABS/560-704               ........................................................degkre----.....-----------------.--.---.......-----ELCQK.IHSRA.PFDD.--L....LEVAQ.............NDVELIVNCIL...WHGQKSYSHFF.S.RFV.L..YETE..IADR............FK-......................................................-ENPGS...L....IGVVGKFWA.QSP...Q...RIAVIVDK.MMRHAVVPYEGVVDWLLGsy............................yrETA..QDV.Q.A.R.S.Y.V.FCILHN.AID-----.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------cakldgadvagr.................................................................................
G8BVZ2_TETPH/580-828                   .............................................................l-YFI.....QENVPISATVRKLLDYM.HK.QGE.......NKVVTELDEI.IKEFK.EDYG.NII....VDFDR.............FIVALMIQCVA...HSGSRSLSHAN.K.YIS.D..LTED..IKHA............FSSle.................................................ideAKKEYT...I....VEAMLRFWN.SNS...Q...TGFLNTDA.LRYAGFITTKSLFSFCFEe..............................sNGR..NLG.L.T.D.A.T.A.VESVLR.NLSQDSAL.......------------------..........---.......--................................................................................----..----.--------.-.TS...GNTENFENIF.........E....KLCLILNDC..................VSKL.GA..TV.TEAI-VLPMldesatsfd...........................pallqqldlIWKYQT..AL..SF..IKSILRKYSKEYK.............................................................................................
M2P8U5_CERS8/532-836                   ..............................................................FEYD.....DPARPYHDSAQSVLNML.RG.RAK.......ADDVVAHVQS.LKNTL.AEGA.EGD....VNVDA.............VVCSIAVQSLL...HIGSRSFSHFL.N.AIE.R..YLPL..LRSLa.........ggA-Gtgagg............................................gaaahHDARMD...I....LGAVYAFWK.RSR...H...MVAIVFDK.LMQYQIVDPTDVIAWTFAh.............................ggGRG..ARG.T.F.D.A.F.Q.WALLKG.ALDKANGR.......VMIARRKVAALRKEADDNa.......arA-K......aSEtmevdae..................................................................akpdvipAAET..PALN.TALKAFAT.L.TR...EQKAALARAL.........D....GFVDYLVLE..................-GTA.AA..KT.REVIT---Ekawhar.................................aswdegEWEAWE..TW..CW..FRHFVRAYSPYL-r............................................................................................
V4MF45_EUTSA/484-814                   ....................................................ymysleegke----.....--KTEEQQLSAELNKKV.KE.KQS.......ARDMMSWIEE.TIYPV.HGF-.---....----E.............ITLTVVVQSLL...DIGSKSFTHLV.T.VLE.R..YGQV..FAKL............CPD......................................................NDKQVM...L....LSQVSTYWK.NNV...Q...MTAVAIDR.MMGYRLVSNLAIVRWVFS................................PEN..VDQ.F.H.V.S.D.QpWEILGN.ALNKTYNR.......LSDLRKEISNITKNLLVA.........eKAS.......SNarieleaaesklslvdgvpvl......................................genpakmkrlkstvektgeaeVSLR..ESLE.AKEALLNR.A.LS...ETEVLLLSLF.........Q....SFLAVLKERlpestk......arslqdL---.KS..--.--------Igaedenssamevds................engnpkkkceigereQWCLST..L-..GY..LTAFTRQYA----nei..........................................................................................
R0HJI6_9BRAS/370-706                   ...............................................akagqnfmysleegk----.....-EKTEEQKLSAELSKKV.KE.KQT.......ARDMMVWIDE.MIHPV.HGF-.---....----E.............VTLSVVVQTLL...DIGSKSFTHLV.T.VLE.R..YGQV..FAKL............CPD......................................................SDKQVM...L....LSQVSTYWK.DNV...Q...MTAVAIDR.MMGYRLVSNQAIVRWVFS................................PEN..VDQ.F.HvS.D.Q.Q.WEILGN.ALNKTYNR.......ISDLRKEITNITKNVLVA.........eKASan...arVEleaaesklslvegepvlgd..........................................npakmkrlkstvektgeaeLSLR..ESLE.AKEALLNR.A.LS...ETEVLLLLLF.........Q....SFLGVLKERlpdstk......vrsvqdL---.KS..IG.--------Aeddnssamevdte..................ngnpkksceigereQWCLST..L-..GY..LTAFTRQYA----nei..........................................................................................
A0A074YS93_AURPU/536-787               ..............................................................FKYL.....NEQTPYSQQGNAMHALI.RR.KAP.......EEEIEVVINE.IQALA.SEHG.V--....EDVLV.............PSTDAYMTSIC...SVGSKSLSHVL.S.CIE.R..CKER..LLAI...........gPQS......................................................ELARRQ...I....ITSVIDYWA.DHP...G...TAVNIIDK.LLNYTIITPMSVIEWALHd..............................hMQH..GRA.L.A.Q.T.H.I.YEMISA.TMFKVSNR.......---MRQIV----RARAEA..........---.......--................................................................................DLSE..EQKA.LLDETLVR.E.RQ...TMRDLFNAII.........E....AVSTVASAAqd..............dmIERF.--..DG.DS----AEQ.............................................TLLQQW..GA..RW..ARVWRRKMAVEE-a............................................................................................
F2PUZ7_TRIEC/541-794                   ..............................................................FKFS.....QETTPYSKEGQELMKLI.RQ.KSS.......DEEIEAVITS.IEEQA.KTHG.--L....TDPLI.............ASTDVYMTSIC...YVGSKSLSHFL.S.CIE.R..CKER..LLAI...........gPKS......................................................DAARCQ...I....INSVMEYWV.DQP...G...IGINIIDK.LLNYTILTPLSVLEWALVd..............................nLAA..GST.L.A.K.P.H.I.FEMISA.TMRKVTNR.......---MRQIVAARTQP----..........---.......--................................................................................TLYE..PQLS.ILDETLKK.E.KA...DMLSMFQLIE.........D....TLVPVAGGY..................SDAM.ME..RT.EDDS-LQPE............................................nVMIQQW..GS..RW..LNVFRRKVAVE--ra...........................................................................................
A0A0K0DWY0_STRER/507-792               .......................................................kdvdddt----.....------YKISHDLAESL.SK.RIT.......NDEVLKYLTK.SSDDD.ENMD.GRQ....--FNVmtv.......ydkEKIKIFMATLL...DLAQNAYTHSV.T.FFL.R..YRPA..FLEL...........vKQD......................................................RSIREI...I....LESIFTAWK.YNP...Q...LIELLTDK.LLKMQILDTYSIVKYILE...............................sQDL..VEY.V.N.K.K.Y.F.YQVLYQ.SVNRLSTH.......VNNLTNDYEKLQSQIKSVer.....klvK--.......-Tegdanmdeddts........................................................sisneididsieNPEEwiNSQK.AILKDKEG.C.LS...EHSSVLRNIL.........E....EIITYYSSN..................IISI.NK..--.--END----.............................................AIFYSF..IS..--..-------------grfkqfiivnlkt................................................................................
H0EIC4_GLAL7/760-946                   ............................................................dd----.....-----------------.--.---.......----------.-----.----.---....-----.............-----------...--GSKSLSHVL.S.SIE.R..CRER..LLAI...........gPRS......................................................SDARKQ...I....IDSVMDYWK.DQP...G...IGVNIVDK.LLNYTILSPGSVIEWAVS................................Q-H..GNR.L.S.M.S.Y.V.YEMVSL.TIGKVTGR.......---TRQVV----RSSKVP..........---.......--................................................................................GLTA..EQRT.LVVQSMQA.E.RK...SMKDLFALME.........D....SLVSWATGS..................KDQV.MQ..SG.D--GTSDEE.............................................AVIRQW..GE..RW..LRVFRRKYAVEE-a............................................................................................
F7AA70_XENTR/484-760                   ..............................................................FKYGd..esNSALPGYSVAVALTNAI.KN.KAS.......DKEIFNILKD.IPNPN.QDDD.DDE...gISFNP.............LKIEVFVQTLL...SLASKSFSHSF.S.ALA.K..FHDI..FKAL............SES......................................................DEGKLH...I....LRVVYDIWK.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................PEL..SRD.F.P.R.F.Y.I.WEILHS.TIRKMNKH.......VQKIQKELEDMKLRLAKQ.........hKHRds...ddNDeds.........................................................................grkdGPLE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..GG.IDVNT----.............................................AWYKNC..RE..RL..QQIFLQHHQII--qq...........................................................................................
A0A0N5AUR6_9BILA/501-762               ......................................................dnensdtn----.....-----------------.--.---.......-EMIMRFETI.IREKK.PPDE.VIP....----Llg........nngEYLATFLSVLL...NSAKTTFSHSF.A.ALT.K..YYQV..LKQV...........iGEK......................................................DDLQMV...V....LVTIYDLWK.YHH...Q...MVVLLVRK.LLVMSLVEAHTVVKWIFS................................SEM..KNE.F.E.R.L.W.V.YELLSF.TLQHIDGH.......VRRAAENVKTLKNESSVK.........kE-Tn....nnEEngdveman...............................................................sgngeaeseNTAS..ADVS.AKEEELSK.L.KA...FFKDLLIAVL.........H....EFAVLLNEH..................IVSS.EA..SG.TSFDT----.............................................DWYRLI..VG..RF..EGIFLQFW-----eil..........................................................................................
U6LAT1_EIMTE/131-409                   .............aaaaaaeddtvmeeesekgeqrgpprvvdtsiletccrdtsgapwtpee----.....-----------------.--.---.......----------.-----.----.---....-----.............-ALKLFVFCLL...SFGSKTQTHLN.R.ILS.N..YLQT..FICF............ANQsedpa...........................................earepeVDIHPA...V....LQAVQKFWS.TSQ...Q...RTALTLHA.FLKSGILQRARVLQELCA................................A-D..ANI.R.D.S.W.G.Q.LELVET.VLRGALDE.......CENAREEAAAASAPMPTN..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------teaeqllhflmvhliedliketsparsrflflrciffgrkyaefinlqklkeevemvlsgiedrrvsnllivigqvqkhycstykewqmktns
F4P8H5_BATDJ/516-788                   ...........................................ykyetaekcgdeglfllad----.....-----------LLNKSI.SV.RAD.......AATVEQILVK.VEKYA.SGQT.VE-....VEGKSitpgmt.tgfsenAAREMLITCVM...LQGSKSFSHIL.N.VIE.R..YLPL..LQKC............NET......................................................MEDRAH...T....LHVTAEFWK.DNT...Q...FTEIVIDK.LTNYRIIDPQTVILWMFR...............................pEFL..DTQ.Y.S.R.F.Y.M.WGILRN.TLIKVNLK.......AEQISRKLEDAKSNATSF..........---.......-S................................................................................EISG..DGIQ.ALENAMEA.S.LR...EKKETFVMVF.........Q....KYVELTSSK..................IRNC.AA..EG.TDATS---T.............................................SWWRWV..-V..GF..FREVSRAFK----edve.........................................................................................
Q6CH33_YARLI/537-742                   ..............................................................YEYI.....ESENQYREVADQLLDVF.KD.KYDq....gvSETYLEVIDS.IKEAV.PDNR.---....----E.............LLLDIVIGAAI...FVGSRSLSLSQ.D.WIN.R..LAQQ..LQHV............IES......................................................AEDESA...A....VTTVMQFYR.NQP...H...VGTVVLHF.LLLENVISPAAIITWLFE................................SPG..DVV.F.T.E.N.H.G.WECLIR.TLDEVAQE.......-G----------------..........---.......--................................................................................----..----.--------.E.VQ...DHV-------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------gpfksvfeylavkdsdseqlgwwkrqvtkslirkyvdyik.....................................................
A0A0G4MMZ4_9PEZI/2521-2765             ..............................................................FKFS.....DETTPFSAEGRELAALL.KR.KVP.......DEDFQPVLDR.IHAAA.TEHS.---....LDALV.............TSTDVFVTAVC...WVGSKSLSHVL.A.CIE.R..VKDR..LLDI...........gAAS......................................................EAARAQ...I....ITAVMAYWR.AQP...G...VAISIIEK.LLNYSILTPLSVIEWSLVyn............................hsERE..GDA.L.A.E.A.H.V.FELVSN.TVTKVTGR.......---VRQIMTAPELD----..........---.......--................................................................................----..---A.DAEASKEL.D.KK...AMRDLFSSLK.........D....ALSSWKAGI.................kDEML.DE..PD.SEERK----.............................................AHLQRW..GA..RW..LRVFERKSAIEE-a............................................................................................
U6LS04_9EIME/792-994                   ...................................gkqqfaaalsalercstdtegapwapd----.....-----------------.--.---.......----------.-----.----.---....-----.............DLIKLFVFCLL...SVGSKTQTHLH.R.VLS.N..YAQT..FQLY............AAQteeqqq.........................................qqelqqqQQQQLD...IhpavLQAVQKYWT.TSQ...Q...RTALTLHA.FLKIGILKRARVLQLLCLa..............................eAEA..RDS.W.S.Y.L.E.L.IETVFR.--------.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------gavdecetareaaaesgspfptgteaeegtadvkvgendariqnlltiieqvqrh......................................
H0YTB3_TAEGU/483-763                   ..............................................................YKYGd..esNRSLPGYTVALCLTIAI.KN.KAS.......NDEIFSILKD.VPNPN.QDDD.DGE....G-FTFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVVYEVWK.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..AHD.F.T.R.F.Y.I.WEILHS.TIRKMNKH.......VLKIHKELEETKARLARQ.........hKRRd....sdDDdddddr....................................................................stdredGPLE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMLLTEH..................LVRC.ET..GG.IDVFT----.............................................PWYKSC..IE..RL..QQIFLQHHQII--qq...........................................................................................
Y827_ENCCU/285-386                     ...................................heeeaaagkevlrisreefektdfgdk----.....-----------------.--.---.......----------.-----.----.---....-----.............---KMFFRNFC...LLGSPSISHFL.T.YLE.I..YKEH..FV--............-LD......................................................KEDQKA...F....LSIFFEVFG.GFE...S...FCRIVVGK.MVQFKIIDPELVTDF---................................---..---.-.-.-.-.-.-.------.--------.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------.............................................................................................
F7DRW1_MACMU/486-761                   ..............................................................YKYGd..esSNSLPGHSVALCLAVAF.KS.KAT.......NDEIFSILKD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.T.R.L.F.V.WEILHS.TIRKMNKH.......VLKIQKELEEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGVLE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TSVLT----.............................................PWYKNC..IE..RL..QQIFLQHHQII--qq...........................................................................................
Q4Z3J7_PLABA/93-308                    .........dnysililffkslmffdssnvsslkrvfknhaviflsyknsgifktedeqiqf----.....-----------------.--.---.......----------.-----.----.---....-----.............-----------...-----------.-.---.-..----..----............---......................................................---EVE...L....LNIVYTYFN.-NC...A...LLNVIVNI.LIENKIVKEMSVINFIFH................................KLS..DYS.L.D.E.Y.Y.I.VQLLYD.GVNNLIIK.......RENNENERN---------..........--K......fRR................................................................................RKTE..SENE.NLIKELED.E.KN...EIVNKIFHLT.........N....QTIIMISEK..................MMKL.KN..DN.NSYMS----.............................................------..--..--..-------------kellkeslvflrtyieyididqflqqchek...............................................................
H0XA17_OTOGA/487-762                   ..............................................................YKYGd..esSNSLPGHSVALCLAVAF.KS.KAT.......NDEIFSILKD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.T.R.L.F.V.WEILHS.TIRKMNKH.......VLKIQKELEEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGALE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TSVLT----.............................................PWYKNC..IE..RL..QQIFLQHHQII--qq...........................................................................................
A0A0B4GP33_9HYPO/534-779               ..............................................................FKYT.....NPDTPFAKEGQEISALL.RR.KAP.......DEEIQPLIDS.IQAQA.KEQA.---....LDPVV.............ASTDVFMTAVC...WVGSKSLSHVL.A.CID.R..TKGR..LIDV...........gTAH......................................................PAARSQ...I....ISSIMNYWA.AHP...G...VAITIIEK.LLNYSILTPFSIVDWTLVass.........................psngTQG..GEA.L.G.R.S.H.I.FELVAN.TVAKVSGR.......---VRQLLTSPDA-----..........---.......--................................................................................----..----.-DADTRDK.E.VS...SMRDLFAAIN.........D....ALASWASGS..................KDQL.ME..DG.DGSS--ERE.............................................AMIRRW..GQ..RW..LRVFQRLAAIEE-t............................................................................................
F7DG19_HORSE/473-748                   ..............................................................YKYGd..esSNSLPGHSVALCLAVAF.KS.KAT.......NDEIFSILKD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVATWIFS................................SEL..SRD.F.T.R.L.F.V.WEILHS.TIRKMNKH.......VLKIQKELEEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGALE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ES..DG.TSVLT----.............................................PWYKNC..VE..RL..QQIFLQHHQII--qq...........................................................................................
K4AKQ7_SETIT/483-829                   ......................................................fkflsdes----.....NEKTDGHKLSKELVGMV.RG.KKN.......TRDIILWVEE.QIIPT.--NG.---....---AE.............FALDVVIQTLL...DIGSKSFTHLI.T.VLE.R..YGQI..ISKL............CPN......................................................EEMQLL...L....MDEVSAYWK.NST...Q...MTAIAIDR.MMGYRMISNLAIVKWVFS................................PAN..VEQ.F.H.V.SdR.P.WEILRN.AVSKTYNR.......ISDLRKEIQSLKKGLQVA.........kE-Asa..naiREleeaksvleivegqpapae..........................................rpgrlrrlqayadkakqeeVSME..ESLE.AKGALLAR.A.LE...ESKELLKLLF.........K....SFVDVLTERlptvsa......dgeipnL---.--..--.-----RAGDqnvnfaardletatmeidneng.adknsepngqntkdgynvgeleQWCL-C..TL..GY..LKSFSRQYATE--i............................................................................................
B4NU09_DROSI/1-276                     .............................................................m----.....-PSLPGTTVAHQLVVAI.RQ.KCT.......PEEVVNILKD.IPNSG.YSGE.EMS...dGSFNA.............LKIDVFVQTLL...NLGSKSFSHSF.A.AIS.K..FHSV..FRAL............AET......................................................EEAQIC...I....LHNIFELWS.SHQ...Q...MMVVLIDK.LLKLQIVDCSAVATWIFS................................KEM..TGE.F.T.K.L.Y.L.WEILHL.TIKKMNKH.......VIKLNSELSEAKDKLAKAds......ssS--.......-Dseddsshk...............................................................rkkpithadKPSE..EVVE.RMEEKLEA.A.NV...NQKRLFLIVF.........Q....RFIMILSEH..................LLRS.DT..DG.RDPDT----.............................................DWYRWT..IG..RL..QQVFLMHHEQVQK.............................................................................................
NCBP1_HUMAN/485-760                    ..............................................................YKYGd..esSNSLPGHSVALCLAVAF.KS.KAT.......NDEIFSILKD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.T.R.L.F.V.WEILHS.TIRKMNKH.......VLKIQKELEEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGVLE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TSVLT----.............................................PWYKNC..IE..RL..QQIFLQHHQII--qq...........................................................................................
#=GR NCBP1_HUMAN/485-760         SS    ..............................................................-TTSS..TS-TTSTTHHHHHHHHHHH.HT.T--.......HHHHHHHHTT.S----.----.---....------...........HHHHHHHHHHHH...HHTTTSHHHHH.H.HHH.H..THHH..HHHH............TSS......................................................HHHHHH...H....HHHHHHHHT.T-H...H...HHHHHHHH.HHHTTSS-HHHHHHHHTS................................GGG..TTT.T.T.S.H.H.H.HHHHHH.HHHHHHHH.......HHHHHHHHHHHHHC----.........-----.....-------........................................................................--HHHHHH..HHHH.HHHHHHHH.H.HH...HHHHHHHHHH.........H....HHHHHHHHH..................HHHH.HH..HT.--SS-----.............................................HHHHHH..HH..HH..HHHHHHTHHHH--GG...........................................................................................
F9XIC9_ZYMTI/534-785                   ..............................................................FKFN.....NDQTPYAKEGREVLALL.KK.KAA.......EEEIQKVLDS.VHAQA.SERG.V--....EDPLV.............PSTDIYMTSIL...SIGSKSLSHVL.S.TID.R..CKER..LLEI...........gGRS......................................................EAARRQ...I....VASVLDFWC.DHP...G...TAVNIVDK.LLNYTIITPMAVVQLAVQd..............................rIDR..GRA.L.A.S.S.Q.V.YEMVSI.TMFKVTNR.......---VRQVLRERNNI----..........---.......--................................................................................KLPF..EQRQ.QIDEALPR.E.RQ...GMRDLFAAIE.........D....AVSSVAAGAnd..............emIERY.--..DG.D----SEEQ.............................................QLIQLW..GS..RW..ARVWRRKAAVEE-a............................................................................................
A0A084FX57_9PEZI/537-776               ..............................................................FKFN.....NPDTPFSAEGQEIATLL.KR.KSP.......DEDFQPIIER.IHSTA.LDNG.---....VDPLV.............ASTDVFMTAVC...WVGSKSLSHVL.A.CID.R..TKGR..LVDV...........gAAS......................................................EGARAQ...I....ITSVMNYWQ.AHP...G...VAVSIIEK.LLNYSILTPLSVIHWALIgts.........................haggKRT..GDV.L.A.K.W.H.I.FELVFN.TVAKVTGR.......VRDVARGNP---------..........---.......--................................................................................----..----.-DAETQSD.E.VK...AMRELFRALE.........D....ALIGWSTGT..................N--G.EA..TD.GDSQ-----.............................................TYVRDW..AE..RW..LRVFRRKSAIEE-s............................................................................................
B2VVN1_PYRTR/556-810                   ..............................................................FKYD....nQVDTPYAAEGQMLLTQL.RK.KAT.......SEEIQATIDS.IHEKA.LEQG.--I....TEVLV.............PSTDAFVTAIC...RLGAKSLSHVL.S.CIE.R..GKDR..LLEI............SQN......................................................EVARRQ...I....VASVVEYWK.DQP...G...VAVRIIDI.LLNYTILAPMTVVQWVFGs..............................hMGA..GEA.L.T.E.S.W.V.FEMVSN.TVAKVTNR.......---NRQIA----SARLQK..........---.......--................................................................................GLQQ..EQTE.MVEATLAK.D.RD...NARELFKYIE.........D....SMRGVAEGS..................ADTL.VE..KS.SNGELTD-Ee...........................................vQLIKAW..GK..RW..HTVFIRKAQVEE-s............................................................................................
A0A0N0V7F8_9HYPO/532-777               ..............................................................FKFK.....NPDTPFSKEGMEIAGLL.RR.KAA.......DEEFQPLIDS.IQSQA.SEQS.---....LDPLV.............ASTDVFMTAIC...WVGSKSLSHVL.A.CID.R..AKGR..LLEA...........gNAS......................................................EAARAQ...I....ISALMSYWH.AHP...G...IALSITEK.LLNYSILTPMTVVDWALVast.........................pangANG..GES.L.A.E.P.H.I.FELVSN.TLTKVATR.......---SRQVI----SSP---..........---.......--................................................................................----..---D.TDEETRAK.E.VK...SIHDLFRATN.........D....ALVSWAGGS..................KDEL.ME..EG.DGS--SDRE.............................................AMIQRW..GQ..RW..LRVFNRMGAVEE-a............................................................................................
G3BB60_CANTC/620-878                   ..............................................................FVFG.....NDQLPYHHVCDKFHKFLlSN.SKS.......KREFAEMIEE.LKSDI.TSD-.TI-....-NKSK.............FIINLVLQTYC...SIGSRSIYSTI.S.ILT.R..DLVK..LKWL............TGNtlseedyvgnsedy..........................kfpelslqneheqtAELQNY...V....VDAVFRIWI.YRP...Q...FIFLILEY.LVDVKLLDFEVFVGRCFD................................LEH..NLV.V.D.R.I.D.C.FEALAR.LLAASSKA.......HDLAR-------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------itvvtskiienlgqvldklevsddaivpidnytaetaakndlqwlyydyldlfkwvarkygtste............................
W3X2I8_9PEZI/541-785                   ..............................................................FKFN.....DDHTPFSAEGKELASLL.KK.KSP.......DEEVQPVIDR.IHSGA.LEHA.---....IDPLV.............TSTDVFVTAVC...WVGSKSLSHVL.A.AIE.R..TKDR..LLDI...........gAAS......................................................EAARQQ...I....ITSVMEYWS.AHP...G...IAISIVEK.LLNYSIITPAAVIDWALVsg............................kaGSG..GDA.L.A.K.S.W.V.FELVFQ.TVIKVTGR.......---IHQLA----SAEA--..........---.......--................................................................................----..----.-ENGAAES.E.TT...AMRELFKAME.........D....ALVSWAQGS.................kDQML.DP..AE.PMDGVENRE.............................................KTIQRW..GQ..RW..LRVFRRRSAIEE-a............................................................................................
B8APF3_ORYSI/471-817                   ......................................................fryhsdeg----.....KESTDGHRLSKELVAMV.RG.RKT.......QGDIISWVDE.KIIPV.--NG.---....---AK.............FALDVVSQTLL...DIGSKSFTHLI.T.VLE.R..YGQI..ISKL............CPN......................................................EEMQLL...L....MDEVSAYWK.NST...Q...MIAIAIDR.MMGYRLLSNLAIVKWVFS................................PAN..VDQ.F.H.V.SdR.P.WEILRN.AVSKTYNR.......IFDLRKEIQTLRKGLQAAke......asE--.......-Kaareleeaksiieivdgqpvp......................................senpgrlrrlqaradkakegeVTTE..ESLE.AKEALLAR.G.LE...ESKELLRLLF.........K....SFVEVLTERlppisad...gdvpnlraG---.--..--.--------Dpnvnssardpeattmeidneng.gdndsqlngqnkkishnvgeleQWCL-C..TL..GY..LKSFSRQYATE--i............................................................................................
I1BQW9_RHIO9/543-807                   ..............................................................FKFS.....DTSDPLNAKSKEIIDSL.RT.KKS.......VEEIRDLLAK.YKDEL.ASQG.VNE....GEQQS.............LVRELFIQCLL...LVGSKSFSHVL.N.VVE.R..YLEV..LRFL............NSA......................................................PEGRLH...T....VQILASFWK.NNT...Q...FLGILLDK.LLNYRVIDPTCVITWVFE................................EEQ..FKH.A.G.R.A.F.V.WEILKN.TLGKVNSR.......VAQVKSKLDNLQSIHEMN..........KAKrle.tevTEmse..........................................................................aeeQQEL..DSIR.IVENSLAT.V.TR...ERKEVFLLVC.........Q....KFAQVLSAI..................DS--.--..--.------VSQ.............................................QWIYWW..IS..GW..YKEILRVNYKEC-k............................................................................................
E2AC77_CAMFO/488-764                   ..............................................................YKYSs..egASSLPGTAAAHELVVSI.RR.KCT.......PEEVLNVLNT.LPGPR.ENEE.TNN....YNP--.............LKIDVFVQTLL...NLGSKSFSHSF.A.AIV.K..FHYV..FKVL............AET......................................................EEAQIC...I....LRNMYALWK.NHY...Q...MMVVLTDK.FLKTGIIECSAIANWIFS................................KEM..TSE.F.T.K.L.Y.I.WEILHL.TIRKMNKH.......VTKLSTELSEAREKLRRAes.....rsgS--.......-Ssddedn...................................................................nkeknreRPSE..DVVE.RMEEKLEA.A.QA...DQKNLFLIIF.........Q....RFIMILSEH..................LVRC.DT..DG.IDYNT----.............................................HWYKWT..IG..RL..QQVFLSHQEQVQK.............................................................................................
A0A0D2UPB5_CAPO3/632-939               .............................................................y-PFE....eTEATQDASVAKALVTSY.LN.KES.......KANVLNVLNM.VEESS.NPEL.TLA....----Q.............ARFRLFLFSLL...QAGSKSLSHIS.T.LLE.R..YIEA..FDDFtqmy....ggddSAA......................................................ESLRFD...T....IKILTEFWK.DNE...Q...MLIILIDK.LITLRLLTPSTVVEWLFL................................SEN..VVN.F.H.R.F.Y.Y.WEIVIN.SLSKLQFK.......SQQARQAYNKARLDLDDTmr.....krnE--.......-Erallneqlqeltgmgstlsd........................................satmvvsklqtrlrgimseeSQED..ERLQ.ALESHLDT.V.QT...DFRAVFLQLF.........T....RFQVVISDH..................LSNA.RQ..ND.TAYNT----.............................................PWFHHT..VA..RL..LDVGRKYHEEI--sa...........................................................................................
A0A074SNC0_HAMHA/836-1116              ............kkrerrefsesaedaidasskrglneesheegtkasgdeceansdpyedd----.....-----------------.--.---.......----------.-----.----.---....----Eeghv.....wtltDLSQVLVFALL...ARGLKTLTHSE.R.LVE.N..YFPV..LQFLk.........kgA-Shkaflemrpatleaagddedard.......gddsdtemedeadedgltkterraQEVEEA...F....LKAIFDFWK.HSR...Q...KTVLTVRH.FQRFGVVSKEGVVRFVFD................................SLT..STD.R.D.D.S.R.V.MELFDL.LLQLSMQD.......-------F---ESKKETAl.......qlS-Eg.....cSD...............................................................................aAERN..ERAK.AVSAAVEA.L.ED...VQ--------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------mllhfivvgfmrellreeqaarrv.....................................................................
A9RK96_PHYPA/504-849                   ......................................................svpeaett----.....--------LATEFTNLV.RG.KKT.......VREIQVWIDE.RILPT.QGQ-.---....----Q.............ASIQIVAQTLL...YIGSKSFTHTV.T.VLE.K..YGQI..FRKI............APD......................................................QTSQIL...M....IDTVSQLWR.NSA...Q...MTAIVIDR.MMGYRMVSNLSIVAWVFS................................PQN.vQQF.H.T.S.D.Q.V.WEIIRN.AINKTNNR.......TVDLRKEIAAAEKALKLAta.....gtaK--.......-Aytkweaavaalkaaeaksedn.....................................rnalsakvdwaktvadkaqdeeTSAQ..DSLE.SKEALLAR.A.LR...EQEALFMAVY.........Q....SFADLLTDR..................LSKS.--..--.---------.............................................------..--..--..-------------vpeshgapnpmedtkgedadaqapvamepdeenieedgtkqknqedvingtttlfadaqeeeqwrkctlgylraisrqycdev..........
I1H5J0_BRADI/483-829                   ......................................................fryhtdds----.....KESTEGHRLSKELVGMV.RG.RKT.......TRDIISWVEE.QIVPA.NGA-.---....----K.............FAIDVVSQTLL...DIGSKSFTHLI.T.VLE.R..YGQI..ISKL............CPD......................................................EEMQLL...L....MDEVSAYWK.NST...Q...MTAIAIDR.MMGYRLISNLAIVKWVFS................................PAN..VDQ.F.H.V.SdR.P.WEILRN.TVSKTYNR.......VSDLRKEIQTLRKSIQVA.........kE-Asa..kasREleeaksvleivegqpapse..........................................tpgrlrrlqgfadrakeeeVATE..ESLE.AKEALLAR.G.LE...EGKELLRLLF.........K....SFVDVLTERlppis.......angdvpN---.--..--.----LRAGDqdvtfaaadpevatmeidneng.adndsqlngkktkvgysigeleQWCL-C..TL..GY..LKSFSRQYATE--i............................................................................................
G8JUZ8_ERECY/578-824                   ............................................................ll--FK.....NEAFPFHDKVQLILDYF.HK.QQL.......EKNVSELESL.LEDIR.TTCS.AQI....PDFDR.............FTVTLLIQALV...YSGNRSLSHAN.K.YIS.D..AKND..LVMIlg.......kiaLSD......................................................VVKEQW...I....IEAVIRYWN.CNS...Q...NGFLIVDS.FKHSELVTAKSILAFSFSd..............................lNGQ..NLG.L.V.E.A.T.S.IESTFR.TLTQLALQ.......------------------..........---.......--................................................................................----..----.--------.-.QT...SDISVFEFVF.........E....RLVTIANET..................ISQL.GM..PD.EEIVA--PLvdnesmld............................ddelsrldlMWKYES..TM..GF..IKSILRKYSDEY-s............................................................................................
C4V887_NOSCE/296-389                   ...................................yevgsinsikkedldfnknkkdfyrdf----.....-----------------.--.---.......----------.-----.----.---....-----.............----------C...LLGSPSVSHFL.S.YLE.I..YKNE..MK--............-MD......................................................EEQQKI...F....LEIFCEIFS.NRT...S...FKKIVIDK.MVKFNFIKSE--------................................---..---.-.-.-.-.-.-.------.--------.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------lllk.........................................................................................
A0A0J9XM00_BRUMA/1-165                 ..............................................................----.....-----------------.--.---.......----------.-----.----.---....-----.............-----------...-----------.-.---.-..----..----............---......................................................------...-....---------.---...-...MIIVLVTK.LLKMSLVDASAVVAWLFS................................DEM..KPE.F.E.R.L.W.I.WEILNI.ALEHVSGH.......VRRNRQAIENAKLKKEEKe.......lnD-Ekd..dfdMEtneh........................................................................ddmaDPNA..VESF.VKESEFAD.L.HE...CLKNLLLDVL.........H....KFTVTLTEH..................IVNS.ES..NG.NDFQN----.............................................NWYLYV..TG..RF..KNVFLKYWRD---lfe..........................................................................................
E0VJH5_PEDHC/460-735                   ..............................................................YKYTl..deAGHLPGSNVANQIIAKI.RA.KCA.......PEEIIGLLKE.LPNPD.TEDE.SGD....TRFNP.............LKIEVFVQTLF...FLGSKSFSHSF.A.AIS.K..FHHV..FKIL............GES......................................................EEAQIC...I....LRNLYEVWH.QHP...Q...MICVLVEK.MLKTQIIECSAVANWIFS................................KEM..SKE.F.T.R.M.Y.L.WEILHL.TIKKMNKH.......VTRVSRELSDARERLGRGesd...sdsdN--.......-Enknn........................................................................dekeKPTE..EMVD.RMEEKLEA.A.QA...DQKNLFLIIF.........Q....VNYLNLSEH..................LVRC.DT..DG.KDFDT----.............................................HWYRWT..IG..RL..QQVFMMHHEQVQK.............................................................................................
E5SWE1_TRISP/494-764                   .......................................................nkfsgsg----.....ADRLPGASIAQHLTQAL.KE.KCT.......PEDVHAILMD.CPYPD.DGNV.ELD....HQL-NnplsnnmdmpfnpLKIEVLTTAVL...VSGSRSISHTV.A.ILI.K..YMSV..FKEF...........aADS......................................................KEAQIH...L....LQTLHE---.---...-...RIMIVVDK.MLKMQIIQSLAVIEWIFS................................EKM..RGN.L.M.R.H.Y.V.WQIVYS.MTTRLSRS.......IKQIQEELDKKQAEEGTM.........sSAS.......SD................................................................................GERS..SEVS.AIQLKLSA.A.QE...LQKAVIFTLL.........Q....KVIILLSEH..................LLQS.DA..ED.RDSHT----.............................................GWFKAI..QG..RM..IQIFNIEHKS---iin..........................................................................................
A0A0F7VEW1_9EURO/535-788               ..............................................................FKYS.....SEATPYFKEGQELMQLI.RK.KAN.......DDELEPIIAS.IEEQA.QSLG.V--....EDPKV.............PSTDALVTSIC...FVGSKSLSHVL.S.CIE.R..NKDR..LLAV...........gAAS......................................................EKARLQ...I....ITSVMEYWA.DQP...G...IAINIVDK.LLNYTIISPLSVLEWALHe..............................hIAA..GSI.L.S.K.P.H.I.YEMISA.TVGKVTNR.......---MRQIVAARTQK----..........---.......--................................................................................NLYE..PQLS.ILDETLSR.E.RV...EMKNLFKFIE.........D....AIVSVAAGSnd..............elMERG.DG..SG.DMPED----.............................................AILRQW..GR..RW..LRVFRRKAAVE--da...........................................................................................
W5GPJ9_WHEAT/9-322                     .................................................rdiilwaeeqivp----.....-----------------.--.---.......----------.-----.----.---....ANGAK.............FAVDVVSQTLL...DIGSKSFTHLI.T.VLE.R..YGQI..ISKL............CPD......................................................EEMQLL...L....MDEVSAYWK.NST...Q...MTAIAIDR.MMGYRLISNLAIVKWVFS...............................pANV..NQF.H.V.S.D.R.P.WEILRN.TVSKTYNR.......ISDLRKEIQTLRKSIQVA.........kE-Asa..kaiKEleeaksileivegqpvsse..........................................rpgrlrrlqgfadkakeeeVTIE..ESLE.AKQALLAR.G.LE...EGKELLRLLF.........K....SFVDVLTER..................LPPV.S-..--.---------.............................................------..--..--..-------------adgdvpnlrtgdpnvtfpasdpeaatmeiddengadnnsqvngentevgytigeleqwclctlgylksfsrqfgl..................
V8NT05_OPHHA/422-695                   ..............................................................YKYGd..enNKSLPGYNVALCLSIAI.KN.KAS.......NDEIFTILKD.VPNLN.QEED.DDE....GFS-Yn...........pLKIEVFVQTLL...HLASKSFSHSF.S.ALG.K..FREV..LRTL............AES......................................................DEGKLH...V....LRVMYDVWK.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................PEL..SHD.F.T.R.F.Y.I.WEILHS.TIRKMNKH.......VMMIQKELEEAKERLTKQ.........qK-Rr.....dDSrrn.........................................................................erenWPLE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..GG.IDVIT----.............................................PWYKNC..IE..RL..QQIFLQHHQII--qq...........................................................................................
B0X1G3_CULQU/17-311                    ......................................................yatttarh----.....-ASLPGTSAAHKLVVAI.RQ.KCT.......PEDVLNELKD.LPNPR.ETSE.NDM....VESTFn...........pLKIDVFVQTLL...NLGSKSFSHTF.A.AIS.K..FHLV..FKAL............AET......................................................EEAQIC...I....LHNVFELWT.DHQ...Q...MLVVIVDK.LLKTQIVECSAVATWVFS................................KEM..VGE.F.T.K.M.Y.L.WEILHL.TIKKMNQH.......VTKLSKELSDAKDRLDRN.........aE-Ss.....sSEseaeagaegaggp.....................................................aprrrkkttgddadKPTE..EQVE.RMEEKLEA.A.YV...DQKRLFLIIF.........Q....RFIMILSEH..................LVKC.DT..DG.RDYDT----.............................................DWYRWT..VG..RL..QQVFMLHHEQVQK.............................................................................................
A0A0D3BDL2_BRAOL/484-811               ......................................................yrysleeg----.....KEKTEEHQLSAELNRKV.KE.KQS.......ARDMMSWIEE.TIYPV.HGF-.---....----E.............VTLTVVVQTLL...EIGSKSFTHMV.T.VLE.R..YGQV..FGKL............CPD......................................................NDKQVM...L....LSQVSAYWK.NNA...Q...MTAVAMDR.MMGYRLVSNQAIVRWVFS................................PEN..VDQ.F.HmS.D.Q.T.WEILGN.ALNKTYNR.......ISDLRKDISNITKNVLVA.........eKASan...arAEleaaesklslvegepvlge..........................................npgkmkrlkstvektgeaeVSLR..ESLE.AKEALLNR.A.LS...ETEALLLLLF.........Q....SFSAVLKERlpep.........akarsLEDL.--..KS.EDENSSAMEvdtengnpk...........................krseigdreQWCLST..V-..GY..LTAFTRQYANE--i............................................................................................
A0A067SWU0_9AGAR/537-857               ..............................................................YEYD.....DPINPHHDAAQAVLNLF.RG.RAK.......AEDVIAHLDS.LKNNL.ETSD.DGQ....VNVDS.............LIRSIVVQSLL...HIGSRSFSHFL.N.AIE.R..YLPL..LRNL............ASGgtsgs............................................sgtgnPEAKAD...V....LTAAASFWK.HNR...Q...MVAIVFDK.LMQYQIVDPTDVVAWTFLngva.......................vgqlaELG..GPM.N.L.S.A.F.E.WDLLRG.ALDKANGR.......VTIARRKVATLRKEDDDArg......rvKARa.....dETmevdadakee............................................................teetaakeapQVDS..PTLI.TALKAFSS.L.TK...EQKTALSRTL.........E....GFVACLAPS..................S--T.DP..HA.NPHARTVITeeawdn................................ranwgrdEWNAWE..TW..GW..YRQFCRAYSPYL-r............................................................................................
S0DTB1_GIBF5/531-776                   ..............................................................FKFQ.....NPETPFSKEGQEIASLL.RR.KAP.......DEEFQPLFDS.IRTQA.SEQS.---....LDPIV.............ASTDVFMTAVC...WVGSKSLSHVL.A.CIE.R..TKGR..LLEA...........gNSS......................................................DAARAQ...I....ISAVMSYWH.AHP...G...VALSIIEK.LVNYSILTPFTVVDWALVast.........................pangTDG..GDS.L.T.E.P.H.L.FELVFN.TIFKVTRR.......---SRDVV-AA-------..........---.......--................................................................................----..--PE.TDEETRIK.E.IK...STQDLFRAMN.........D....ALVSWAGGS..................KDEL.ME..GG.DGS--SDRE.............................................AMIRRW..GQ..RW..LRVFKRMGAIEE-a............................................................................................
I1FKG5_AMPQE/60-328                    ......................................................ylyaevgv----.....ADGVQGFEVAKQLVESM.KA.KVP.......LERLKEVLDG.TDIGN.NSEE.QL-....---LE.............LKVSILTHCIL...HIGDKTISHCF.T.ALH.K..FRSL..LLEL............LET......................................................ENAKLY...C....LSAVGEFFE.ENT...Q...LHCLVIDR.LVRQELIDNGSIIKWCFT................................SSN..HPD.F.T.S.R.L.F.WDILRS.SFSRVNKS.......LLQCEKELEEIKEKLQKTt........gLDElv...dgTEd..............................................................................kQELE..WKIQ.ELEEKVEE.R.ST...EQKEVFLSTC.........R....YLIESLCSH..................LSTC.DE..EG.TDYET----.............................................TWYTCI..TD..NT..RQLLIQYHTVY--rq...........................................................................................
B4JE26_DROGR/498-712                   ..............................................................YKYL.....NELLPGSMLAKALLEVI.RA.KCT.......PEQLGGLMEA.TTELD.-D--.---....----E.............LKVNVLMQTFL...HLGCKTFTHIN.S.MFS.K..FNSV..LKML............ASS......................................................DANQLS...M....LRALFEVWA.NNE...Q...YKVVLADK.LMKMQVVSTKVIVNWIFD................................AAL..KQE.L.A.K.M.Y.M.WELLNL.TVRFTKTH.......-------LRTC-------..........---.......--................................................................................----..----.-----KED.R.EA...SMQNLLVHIV.........V....SCVRVLSEH..................Q--A.TV..QD.VDTD-----.............................................YWYNWV..QG..RF..QALLFK-------yiddvr.......................................................................................
Q4N8N4_THEPA/710-963                   ............tqatntnltnsqldlntnltsiqvdlnsnltntqtanlvsagnvevwkrd----.....-----------------.--.---.......----------.-----.----.---....-----.............DLILLFWDTLL...IFGSKSMTHLY.R.LLE.F..HSDV..LKMFe..........tPESp...................................................feESLPYK...V....MWQTVVTFE.RDH...K...RLELSFDF.FIRNNVFTCPMILKFLFT................................L-P..ANV.L.M.S.N.F.F.FYAVNS.VFSEVHSR.......LVNFRESYKVALRELAGTv.......amE--.......--................................................................................----..----.AKKQELDT.V.E-...---LDYFNFF.........E....QFVRLVSDR..................LSTS.--..--.---------.............................................------..--..--..-------------danirkvleellvrklvkyslqekvniklynsvtnvh........................................................
G8YCN1_PICSO/650-914                   ..............................................................YVFS.....NSGLPLNEISKTVYDFIiAS.WKP.......NDEFKNLYDQ.ILESV.SEHP.DIN....TDK--.............FLINLIFQTYA...YIGSRSIYSVV.S.LFE.R..DIVK..LQFLsgv......einE-Ekysgtdfkf...................................tklelsetqiANRQRW...I....VDSIFRIWI.RQP...Q...VAFLILEY.LIEFGILQPQYLIEKALD................................VNH..NLI.V.D.N.I.S.C.MESINR.VLSNQIKK.......-EGSDKLIL---------..........---.......--................................................................................NLFD..SIVK.NINQTLNS.L.RE...AEVDNPLKIV.........T....EFSE-----..................----.--..--.--------Eeiened................................vmeridnQWLLFE..YK..GL..LKSYLRKFG----efna.........................................................................................
A0A0K0IMQ6_BRUMA/1-137                 ..............................................................----.....-----------------.--.---.......----------.-----.----.---....-----.............-----------...-----------.-.---.-..----..----............---......................................................------...-....---------.---...-...--------.------------------................................--M..KPE.F.E.R.L.W.I.WEILNI.ALEHVSGH.......VRRNRQAIEKAKLKKEEKe.......lnD-Ekd..dfdMEtneh........................................................................ddmaDPNA..MESF.VKESEFAD.L.HE...CLKNLLLDVL.........H....KFTVTLTEH..................IVNS.ES..NG.NDFQN----.............................................NWYLFV..TG..RF..KNVFLKYWRD---lfe..........................................................................................
M7NT24_PNEMU/460-716                   ..............................................................FDYE.....LPNSKYYAEVGTLLETM.KV.NTE.......QSETDVALEI.IEKTA.IENN.EN-....-DPPY.............EALKALVQCVL...HLGAKSFSHAL.N.TIE.R..NLPG..LQAR...........cNAN......................................................EKTRRQ...T....IDIIIRFWK.DQP...T...IGTTLINK.FLNYSVIDAVSIIEWIIL................................DAD..IEY.V.G.R.S.F.T.WELMKI.ALNKVNST.......PVQIKDRINMETSHNEP-..........---.......--................................................................................----..GSLS.NYRKVYDE.V.YM...KREAVFVTIF.........E....KFPKLFDRA.................kVSQK.KS..NG.VEKNKTL-Dn..........................................qiEWQLWW..AK..GL..FKEIARRYYYEI-s............................................................................................
F0VR04_NEOCL/895-1135                  ...............................................pyeddddghvwsltd----.....-----------------.--.---.......----------.-----.----.---....-----.............-LAQVLVFALL...ARGLKTLTHSE.R.LVE.N..YFPV..FRFL............KEGatqkalremqpaalkargdtreecgeesdvemddeeededpadeegltkaerraQEVEEA...F....LKAVFDFWK.HSR...Q...KTVLTVRH.FERFGVVSKEGVIRFVFE................................SLS..PGD.R.D.D.S.R.V.MEL-FD.LLAQLSIQ.......DFDVKKET-ALQL-----..........KDAc.....gED................................................................................AEKI..AEAA.QAATAAAE.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------alegvhtllhfiligfmrellreeqdarr................................................................
A0A0N4T883_BRUPA/217-329               ............................................................sy-DLN.....DDEHPDRDFAIVLEKAF.RE.KIS.......ADGMIDLLRN.QSENQ.MDIN.---....-----.............FRLSIFFKVLL...YLARKTFSHNF.V.ALT.R..YYST..LKEL...........iGGR......................................................EDVQLT...I....LRTLYETWK.LHG...Q...VYFLV---.------------------................................---..---.-.-.-.-.-.-.------.--------.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------kfa..........................................................................................
A0A094ECF2_9PEZI/534-785               ..............................................................FKYN.....DEDTPFAAEGREIHTLL.KR.KAP.......EPEIQTVIDQ.IHTQA.TTIA.--I....HEPLL.............SSTDAYVTSIC...YIGSKSLSHVL.S.CIE.R..CKER..LLSI...........gNTS......................................................ETARRQ...I....ITSVMAYWV.DQP...G...IGVNIVDK.LLNYTILTPLSVVEWALLd..............................dTKA..GDK.L.A.E.P.F.V.FEMVAG.TVQKVTNR.......---LRQIV----ASRNAP..........---.......--................................................................................GLEH..EQRL.LLDETLLR.E.RV...AMKDMFKVME.........D....ALFSWASGS..................KDQA.IE..AG.LGETT--DE.............................................AFIRRW..GE..KW..LRVFRRKMAVEE-a............................................................................................
K0KXE4_WICCF/568-840                   ............................................................lf--FL.....SDNVSLKEDTEKLIEIL.HR.EAT.......NEEYTSLIKS.IKEKI.KDYK.S--....--PDA.............LLITFVFQVIA...FVGNRSISHAG.K.YVG.N..TFNF..LRTLl.........gkE-Ssvskekgssssegeiidskn.............ssgdaeeeegrlvevespnvvAQRELW...A....VDAIIKYWN.SAP...E...NGYLVLDV.LESYDVISSESLIRYSLNd..............................dNKY..NLG.L.V.N.V.S.A.TESIFR.LLSSAAIS.......------------------..........---.......--................................................................................----..----.--------.-.-G...NSSNLLKVIY.........G....ELTSILEVT..................TFRI.EQ..PG.EIEVP---Dvndev..................................nekaelIWKYHT..TL..GF..LKAIIRKYSGE--fl...........................................................................................
A0A072PND4_9EURO/542-794               ..............................................................FKYN.....DDATPFAAHGREIAQLI.RK.KAA.......SEDFAPFLES.IEQEA.SAAG.--L....ADPVL.............ASTDALVTSIC...WVGSKSMSHVL.A.CIE.R..SKDR..LLET...........gNAS......................................................PTARKQ...I....ITSVMEYWK.FQQ...G...IGGVIVDK.LLNYQILTPASVVEWALId..............................hVER..GTV.L.A.S.T.W.A.YELVDN.TTRKVANR.......---VKSLVDAIRQP----..........---.......--................................................................................GLDD..EQKT.QLQHALSQ.E.QE...GTKGLFAIIE.........D....AVVSIRDGN..................QDQM.-M..ES.SDSLREEEE.............................................ALLKSW..GG..KW..ARVFQRRFAVDE-s............................................................................................
B0DK62_LACBS/550-863                   ..............................................................FGYD.....DPGKAHHDAAQAVLNLF.RG.RAK.......AEDVISHLDT.LKSTL.ESSD.EGH....VNVDA.............VVRSIAVQSLL...HIGSRSFSHLL.N.AIE.R..YLPL..LRNL............ASSgvssv............................................ggggnAEAKAD...I....LSAAAAFWK.HNR...Q...MVGIVFDK.LMQYQIVDPTDVVGWTFLngav.......................igqfsELA..GPM.N.L.S.T.F.E.WDLLKG.ALDKANGR.......VMIARRKVTALRKEDDDTra......rvKAS.......-Tdadtmevd................................................................aeekpedtTSDN..PALV.TALKAFSS.L.TK...EQKAALSKTL.........E....GFVSCLAPS..................L--T.DP..SP.NPHARTVISeeawen................................ranwgrdEWSAWE..TW..GW..YRQFCRAYSPYL-r............................................................................................
NCBP1_DROGR/488-770                    ..............................................................YKYTs..eeAANLPGTTVALQLVGAI.RQ.KCT.......PEEVVNILKE.IPSSG.YSGE.EMS...dGSFNA.............LKIDVFVQTLL...NLGSKSFSHSF.A.AIS.K..FHVV..FRAL............AET......................................................EEAQIC...I....LHNIFELWS.SHQ...Q...MMVVLIDK.LLKLQIVDCSAVATWIFS................................KEM..TGE.F.T.K.M.Y.L.WEILHL.TIKKMNKH.......VIKLNVELSDAKEKLSKAds......ssS--.......-Dtdedtphk...............................................................rkkpithadKPSE..EVVE.RMEEKLEA.A.NV...NQKRLFLIVF.........Q....RFIMILSEH..................LLRS.DT..DG.RDPDT----.............................................DWYRWT..IG..RL..QQVFLMHHEQVQK.............................................................................................
A0A094D5U6_9PEZI/549-800               ........................................................ikltkl----.....--DTPFAAEGREIHTLL.KR.KAP.......EPEIQTVIDQ.IHTQA.TTIA.--I....HEPLL.............SSTDAYVTSIC...YIGSKSLSHVL.S.CIE.R..CKER..LLSI...........gNTS......................................................ETARRQ...I....ITSVMAYWV.DQP...G...IGVNIVDK.LLNYTILTPLSVVEWALLd..............................dTKA..GDK.L.A.E.P.F.V.FEMVAG.TVQKVTHR.......---LRQIV----ASRNAP..........---.......--................................................................................GLDH..EQRL.LLDETLLR.E.RV...AMKDMFKVME.........D....ALFSWASGS..................KDQA.IE..AG.LGETT--DE.............................................AFIRRW..GE..KW..LRVFRRKMAVEE-a............................................................................................
C1GGW1_PARBD/565-817                   ..............................................................FKYS.....LETTPYATEAQEIMQLI.RK.KAT.......DADLQPHIQA.IEQQA.AASG.V--....TDPLI.............PSTDAFVTSIC...YVGSKSLSHVL.S.CIE.R..SKER..LLSI...........gPQS......................................................PAARRQ...I....ITSVLEYWA.DQP...G...IGVNIIDK.LLNYAILTPLSVIEWALVd..............................hIDG..GAA.L.A.K.A.H.V.YEMVAA.TMGKVTNR.......---IRQIVAARVQL----..........---.......--................................................................................GLVE..PQLS.VIDETLRK.E.RG...DVGVMFDVIE.........G....ALVGVVGGAg...............agD---.GM..QG.NGA----MEg..........................................egGIIPEW..GR..RW..LRVFRRMKAVEE-a............................................................................................
G7PRW1_MACFA/475-750                   ..............................................................YKYGd..esSNSLPGHSVALCLAVAF.KS.KAT.......NDEIFSILKD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.T.R.L.F.V.WEILHS.TIRKMNKH.......VLKIQKELEEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGVLE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TSVLT----.............................................PWYKNC..IE..RL..QQIFLQHHQII--qq...........................................................................................
A0A096P136_PAPAN/487-762               ..............................................................YKYGd..esSNSLPGHSVALCLAVAF.KS.KAT.......NDEIFSILKD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.T.R.L.F.V.WEILHS.TIRKMNKH.......VLKIQKELEEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGVLE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TSVLT----.............................................PWYKNC..IE..RL..QQIFLQHHQII--qq...........................................................................................
H3B1S7_LATCH/487-774                   ..............................................................YKYGd..esNSSLPGYNVALSISTAI.KN.KAT.......NEEILSILRD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFMQTLL...YLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVLYEVWK.NHP...Q...ICIIFFFF.LIKTSLLFCCFSSQAVFI................................KKK..KKK.K.K.K.K.T.D.YTLLRG.TRRDEKKR.......---CKKLVSKEKARKEKKcfhi..lfsrA-Ksr..slkRDsdddddd..................................................................rdsdeedGPLE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..GG.IDFST----.............................................PWYKNC..IE..RL..QQIFLQHHQII--qq...........................................................................................
A0A0D1DTA6_USTMA/651-975               ..............................................................FTYA.....DESHPYAAQAGRLINSI.KA.KAS.......AEVILADFES.FKASI.LDNS.SAI....PSDDAveglvadalqadvVVRDLTIQCVL...QVGSRSFSHFL.N.IVE.R..YHSL..LRQL............SKS......................................................ARMRAA...I....LSGAVRFWH.RSQ...Q...WIHIVVDK.LLQYRIVEPADVVEFIFSppmdepg..................tisspngASG..REG.W.V.G.F.N.T.WTLLRL.TLEKVNGR.......VDQLKKRLEEIQRNEAEEve......rrE-AaaaagfgEEdvgqgddeaeqasmplf..............................................ptsatlpirpatssakeEKSQ..LSST.EALASLDA.I.KS...EQRKVLVTTL.........V....GFKTLIVRS..................Q---.--..--.----TNEPD.............................................EWTLWW..IK..SW..YRQMVRFFNRQ--ll...........................................................................................
A7TKT7_VANPO/763-842                   .........................................................ittgn----.....-----------------.--.---.......----------.-----.----.---....-----.............-----------...-----------.-.---.-..----..----............---......................................................------...-....---------.---...-...--------.------------------................................---..---.-.-.-.-.-.-.------.--------.......------------------..........---.......--................................................................................----..----.--------.-.--...--PANFEFVF.........E....KLCVIINDT..................INKL.GV..NA.IENV-VAPIitedtifnd...........................eqelvkldlIWKYQT..AV..GF..CKSLLRKYSDEYR.............................................................................................
A7EUS0_SCLS1/1-149                     ..............................................................----.....-----------------.--.---.......----------.-----.----.---....-----.............-----------...-----------.-.---.-..----..----............---......................................................------...-....----MEYWK.DQP...G...IGVNIIDK.LLNYTILSPQSVVQWALG................................S-E..GKK.L.S.Q.A.F.V.YEMVSA.TVGKVTGR.......IRQVQLSL-------RVP..........---.......--................................................................................GLLE..EQKA.LINQTVEM.E.RV...NMRELGQEMD.........D....LLSSWANGL..................KDQM.-I..DA.DGNGMVGDD.............................................ELVRAW..GE..RW..LRVFRRKFAVEE-a............................................................................................
Q0UGB2_PHANO/647-900                   ..............................................................FKYD.....NQQTPYAAEGQTLLAQL.RK.KAS.......AEDMQATIDK.IHEKA.LEQG.--I....AEVLV.............PSTDAFVTAIC...RLGAKSLSHVL.S.CIE.R..GKDR..LLEI............SQN......................................................EVARRQ...I....VASVVEYWK.DQP...G...VAVRIIDI.LLNYTILAPMTVVQWVFGs..............................hMGA..GEA.L.T.E.S.W.V.FEMVSN.TVAKVTNR.......---NRQIA----SARLQK..........---.......--................................................................................GLPD..EQVP.MVEATLAK.D.RD...NARELFKYIE.........D....STRGVEEGS.................aDVLI.EK..QS.SGALTEEEV.............................................NLIRAW..GK..RW..HSVFIRKAAVEE-a............................................................................................
A0A0K0DHJ6_ANGCA/491-660               ............................................................km----.....-----------------.--.---.......----------.-----.----.---....-----.............------LQMLM...KTTAKSFSHTF.V.ALT.R..YSLT..LKTV...........aDSS......................................................DEMQEV...L....LQTLFHCWR.NNH...L...RIIILVDK.MLKMQILDCGVVISWIFS................................GSL..RSE.T.H.K.Q.W.K.WEVLNT.ALERLSRH.......IHKVAHDVQILQKRVKHQri......gaDDE.......MDdm...........................................................................dvkTREQ..EELE.QQKEKLEN.L.KD...FQKSLFLDVL.........-....---------..................----.--..--.---------.............................................------..--..--..-------------hv...........................................................................................
M5GC50_DACSP/570-871                   ..............................................................FEFG.....NSENEHHQASNTIAKLM.QG.NPEqriprstPQEVIDEVNR.IREQL.AQGE.YTQ....EMADQ.............TARAITFQTLL...NVGSRSFSHLL.N.AIE.R..YLPL..LRNL............AGP......................................................NGAKQQ...L....LDETQKFWR.QDE...Q...RILIVFDK.LMQYQILDPVDIINWCCAsdstvd....................skmnghSER..STR.W.F.S.T.F.R.WEALRS.AIDKANGR.......VTVAKKRAAALRKEDDEA..........RAKva...saGDdyamadnp................................................................dafeaptpVVDS..PALA.NALKALAT.L.TK...EQKSSLTAAL.........T....GFCRILVYSp...............dgLSWE.ER..DQ.WDE-----D.............................................GWGSWE..TW..GW..FRHFCTFYCSY--lr...........................................................................................
G9NFI7_HYPAI/533-778                   ..............................................................FKFD.....NPDTPFASEGQEISGLL.RK.KAP.......DEEFQPIIDK.IQSDA.SERA.---....LDPVV.............ASTDVLMTAIC...WVGSKSLSHVI.A.CIE.R..SKSR..LLDA...........aNSS......................................................PAAQNQ...I....LVAVMAYWS.AHP...G...IALSIVDK.LVNYSILTPTSIVRWALTadp.........................vadgATA..GES.L.A.Q.P.H.I.FELVLN.TVTKASFK.......---TRQIV----SSPD--..........---.......--................................................................................----..----.ADEETRKA.E.SK...AIVDLFSTLN.........D....LLVSWAGGS..................KDEL.ME..TG.DGS--SERE.............................................ATIRQW..GQ..RW..LRVFKRLGAIEE-a............................................................................................
W1PP24_AMBTC/486-817                   ..............................................................FKYS.....AGDSEEHSLSENLCTMV.RG.RKT.......AREVISWLEE.AIVPT.--HG.P--....----K.............VALEVVVQTLL...DIGSKSFTHLV.N.VLE.R..YGQV..ISKL............CPD......................................................QEKQVW...L....IDEVSLYWK.NSA...Q...MTALTIDR.MMGYRLVSNLSIISWVFS................................PAN..VKQ.FhT.S.D.R.P.WEILRN.AVGKTYNR.......IRDLRKEISSLEKSIVSAea.....saaE--.......-Aqaesdaaesrlevvdgepiq.......................................aeppsrlkrlkafaekakeeaVSLQ..ESLE.AKQALLSR.A.IT...ENEAMFISLY.........K....SLANVLMEClprvycdk..hndhiqldL---.--..--.--------Ddeesskmdvdddenk..............ksnrggeinghdtqeeEHWCHC..TL..GY..VKALSRQYAS---ei...........................................................................................
NCBP1_CAEEL/489-768                    ...........................................................yli---D.....EEDTALVQRAETFTQMF.QE.RQP.......AEAFLNELKS.NDEND.ELPY.---....---NI.............NEFGLFVMVML...KMASKTYSHNF.S.ALF.R..YQTT..LKTV...........cDAS......................................................ELYQEK...L....LETLYSCWK.TNQ...Q...MLMILTDK.LLKMQVIDCSAVVGWLFD................................EKM..WQE.H.D.R.Q.W.L.FEVLNQ.ALEKLTRQ.......INVVEKDIKELTEKTENK.........iKEEd.....dEEsdikmde.................................................................detkeekfKQDL..EDLE.NNKEKLER.M.VT...FQKGLFNDFL.........I....AFIEEIKNAat..............snTSEM.DG..SG.DTPGT--QT.............................................PKFMWL..RG..RF..CHVLLAHAETL--lk...........................................................................................
W7UBY3_9STRA/647-895                   ....................................................aastqilkvl----.....---------VRHFQAVL.QG.QMP.......AAEVQAWLDS.SVAPP.ADIA.TSD....P---L.............WRVTLVAHALS...RISDDTVAHLP.A.LLE.K..CLGW..FRQL............FEA......................................................DEHQLR...M....VEALAEVWA.GSP...Q...MLLLALNA.VMRMHMVLPVNLVAWLVRpe...........................tarRYA..QDA.L.Y.H.D.L.F.VDAVDR.SLESVANY.......GELISRALGPHPPATGQS..........---.......-Ee..............................................................................aRARQ..CAGE.ETVEHGIV.A.VE...NAQDLLLELV.........E....GLSKVLGEG..................LASS.--..--.---------.............................................------..--..--..-------------aeqasewvraglaylrgtlqiyl......................................................................
A0A0D9REV2_CHLSB/485-760               ..............................................................YKYGd..esSNSLPGHSVALCLAVAF.KS.KAT.......NDEIFSILKD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.T.R.L.F.V.WEILHS.TIRKMNKH.......VLKIQKELEEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGVLE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TSVLT----.............................................PWYKNC..IE..RL..QQIFLQHHQII--qq...........................................................................................
L0PFW0_PNEJ8/1-115                     ............................................................mg----.....-----------------.--.---.......----------.-----.----.---....-----.............-----------...-----------.-.---.-..----..----............---......................................................------...-....---------.---...-...--------.------------------................................---..---.-.-.-.-.F.I.WELMKI.VLDKINSR.......VIQTKRHLKNTDTFLN--..........---.......--................................................................................-DNS..EDLL.KYEKTYKK.V.FS...DQKDVLIAIF.........E....MFPKLYDRIknl............hgkSNGC.QE..NG.FSDNQ---V.............................................SWQLQW..VK..GL..FEEFVRKCHHEI-s............................................................................................
E9J6J3_SOLIN/475-751                   ..............................................................YKYSs..egASSLPGTSAAHELVVSI.RR.KCT.......PEEVLNVLNT.LPGPR.ENEE.TNN....YNP--.............LKIDVFVQTLL...NLGSKSFSHSF.A.AIV.K..FHYV..FKIL............AET......................................................EEAQIC...I....LRNMYALWK.NHY...Q...MMVVLTDK.FLKTGIIECSAIANWIFS................................KEM..ASE.F.T.K.L.Y.I.WEILHL.TIRKMNKH.......VTKLSTELTEAREKLRRAes.....rsgS--.......-Ssdeedt...................................................................nkernreRPSE..DVVE.RMEEKLEA.A.QA...DQKNLFLIIF.........Q....RFIMILSEH..................LVRC.DT..DA.IDYNT----.............................................HWYKWT..IG..RL..QQVFLSHQEQVQK.............................................................................................
A0A0B2UV61_TOXCA/5-175                 ............................................................ik----.....-----------------.--.---.......----------.-----.----.---....-----.............-----------...-----------.-.---.-..----..----............---......................................................------...-....---------.---...-...MMFVIVSK.MMKITLIAPCVVVDWIFS................................DEM..RLE.F.E.R.M.W.T.LELLNS.AVDCITSH.......LRYTQKKLENLHRETTDTk.......dsN-Kk....hsSSssasesd..................................................................sdndnesVLTD..QQMA.ALQSEIEN.L.RE...LLKNLLLNIL.........H....KFMMKLTEH..................IVLC.DS..KD.VDVNT----.............................................SWYVYV..NG..RF..NDFFMENWEE---lfe..........................................................................................
D8QLP8_SCHCM/488-803                   ............................................................wa--WE.....DPSHPHHDAAQGILNLL.RG.RAK.......AEDVIAHLET.VKGTL.EGGD.V--....SDAEG.............TVRDMATQALL...NVGSRSFSHLL.N.AIE.R..YLPL..LRTLa..........gQAG......................................................GNAHTD...I....LASAASFWA.SSP...Q...LITIVFDK.LMQYQIVDPKDVVAWVFArskqprqdgmvia......kveggvktedgdaPDA..GAP.G.M.T.I.T.E.WDVLRA.AVDKANGR.......VIIARRKLAALRREDDER..........HARav...agMEvdgdge....................................................................kevkeqSEEN..PAVQ.TALKAFES.L.TA...EQKGALSRTL.........E....GFVDLLIGA..................ESPV.GP..AA.RAIIS---Ekswhnr.................................anwseaEWAAWA..TW..GW..YKAFAREYAVYL-r............................................................................................
R9ALM1_WALI9/528-818                   ..............................................................FIYA.....NEEHPYNATTTSVMDSM.RN.KIT.......SDAMIKNIVK.IEEDL.KENP.SLP....QSGNSa..........kkVARDIATQCLL...NVGSRSFSHFL.N.VIE.K..YIEV..IKYL............TAD......................................................KDSRID...L....LRSVGRFWV.RNS...Q...MKKIIVDK.LLQYRLIEPTDVVQWLFNpndpef....................psevddTVY..QIG.W.S.D.L.N.F.GDLLKT.ALNKVNTR.......VNQQYQKLVETKKNDEEVas......iaKAR......nMEidne.......................................................................dettkEEER..RDYS.QLQLTFDN.L.NR...EQRECFVLLV.........Q....AFVEALEGV..................DSIS.DK..SI.EEYTD---Q.............................................DWDKWL..SW..SW..YQAFLREYWPS--is...........................................................................................
A0A0E0KDN3_ORYPU/464-810               ......................................................fryhsdeg----.....KESTDGHRLSKELVGMV.RG.RKT.......QGDIISWVDG.QIIPV.--NG.---....---AK.............FALDVVSQTLL...DIGSKSFTHLI.T.VLE.R..YGQI..ISKL............CPN......................................................EEMQLL...L....MDEVSAYWK.NST...Q...MIAIAIDR.MMGYRQISNLAIVKWVFS................................PAN..VDQ.F.H.V.SdR.P.WEILRN.AVSKTYNR.......IFDLRKEIQTLRKGLQAAkv.....aseK-A......aREleeaksiieivdgqpvpse..........................................npvrlrrlqvradktkaeeVTTE..ESLE.AKEALLAR.G.LE...ESKELLRLLF.........K....SFVEVLTERlppisa......dgdvpnL---.--..--.-----RAGDpnvnsaardpeattmeidneng.adndsqlngqnkkighnvgeleQWCL-C..TL..GY..LKSFSRQYATE--i............................................................................................
NCBP1_ASHGO/582-827                    ............................................................ll--FK.....NEVFPFHEKVQLILDYI.HK.QPL.......EKNISELESL.LEDIK.SAHG.DKI....PDFNR.............FTVTLLIQALV...YSGNRSLSHAN.K.YIS.D..AKSD..LVTI............LEKme.................................................vppEVKEQW...I....IEAVIRYWN.CNS...Q...NGFLIVDS.FKHSELVTAKSILTFSLTd..............................lNGQ..NLG.L.V.D.A.T.S.IESTFR.TLTELALQ.......------------------..........---.......--................................................................................----..----.--------.-.QA...SDISVFEFVF.........E....RLLEIINDT..................VSQL.GT..NE.EIVAPSVDNetmldvd...............................elarldlIWKYES..AV..GF..IKSILRKYSDEY-s............................................................................................
I3IZ41_ORENI/483-765                   ..........................................................ftyk--YVd..esASSLPGYPMSITVSNAI.KN.RAS.......NEEILTVLKE.VPNPN.QEDD.DDE...gESFNP.............LKIDVFLQTLL...NLAAKSFSHSF.S.ALG.K..FHEI..LKTL............ANS......................................................DEGKLH...L....LKVLYEVWR.NHP...Q...MIAVLVDK.LIRTQVVDCAAVANWLFS................................QDM..AHE.F.T.R.L.F.I.WEILHS.TIRKMNKH.......VQKIQKELEEAKDKLEKQq........hK-Rrd...sgDDedmdk.....................................................................nsedeeGQLE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMLLTEH..................LVRC.ET..GS.VDIST----.............................................PWYKNC..ID..RL..QQIFLMHHATIQ-q............................................................................................
G4NH07_MAGO7/543-787                   ..............................................................FKYK.....NDDVPFASQGREIANLL.KK.KEP.......DEAIQPLIEE.IQNGA.VDQG.---....LDPLV.............TSTDVFMTAVL...AVGSKSLSHVL.A.CIE.R..VKDR..LLDA...........gAAS......................................................VAARIQ...V....IEAVMAYWS.AHQ...G...VALSIVEK.LLNYAILTPAVVVEWAVGagrg.......................avtaiEDD..ESR.L.A.Q.D.H.I.YELVLN.TVRKVTGR.......---VRQVA--LTKA----..........---.......--................................................................................QNLD..GDVS.MTEDQDGP.E.VK...EMRELFQLIE.........H....ALAARASSL..................A---.--..--.--SNK----.............................................LLARLW..VD..RW..QRAFKRCAAIEE-n............................................................................................
N1J947_BLUG1/530-769                   ..............................................................FKFN.....VDDYPFAREGQEILSLL.RK.KSP.......EESIQPIIEQ.IHAQA.TVMN.--Y....PDPLV.............ASTDAYMTAIC...YIGSKSLSHVL.S.CIE.R..CKER..LMAL...........gPVS......................................................PLARKQ...I....IDSVLDYWK.HQP...G...IGVNIVDK.LLNYTILSPKSVVDWALS................................Q-D..GKR.L.G.K.A.Y.I.FEMVSA.TIFKVTGR.......---LRQVI----QAKSVP..........---.......--................................................................................GLSP..EQFE.ILLKTVES.E.RA...SMKELFDFME.........N....SLLGWAKDT..................S---.--..-D.NEED-----.............................................TMIQQW..AM..RW..LRVFRRKLAVEE-a............................................................................................
W5LAI3_ASTMX/483-767                   ............................................................fqYKYDd..esKSSLPGYPMAITVSNAI.KN.RAS.......NEELLTILKE.VPNPN.QEDD.DDE....GDGFN............pLKIDVFLQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..LKAL............TET......................................................DEGKLH...I....LKVVYEAWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................PDM..AHD.F.T.R.F.Y.M.WEILHS.TIRKMNKH.......VQKIQKELEEAKDKLEKQq.......hkK-Qkd...sgDEedmekn....................................................................nsededGQLE..EQIE.KLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMLLTEH..................LVRC.ET..AS.MDINT----.............................................CWYKNC..IE..RL..QQIFLMHHVTI--qq...........................................................................................
A0A0M3IY46_ANISI/456-735               ............................................................ty-DIE.....NEDTPVGRLAIHLNEAI.RN.KIT.......NEELTEIFSD.LDVWS.VSEE.---....-----.............EALSTCVAVLL...NLSQKTISHSF.A.ALT.R..YFKT..FKQY............AAS......................................................EESQLI...I....LKALYMVWK.HNQ...Q...MMSVVANK.MVTMTIIDASTIVAWIFS................................DEM..KSE.F.E.R.M.W.T.WELLCG.SVEHVIGH.......LRRCRKKLENAQRKSAGK.........nK-Ssh...qnSEnmdtdkidndd..........................................................askdeeefdddEQND..EDLG.SLESEFED.L.RE...YLQNLLLDVL.........H....KFTVKLTEH..................IVNC.DT..KG.EDVNT----.............................................SWYKYF..TA..RF..RGFFLKHWKE---lfe..........................................................................................
A0A075B041_9FUNG/473-612               ..........................................................dgde----.....-----------TLIGML.KE.KKS.......KEEINEYLSN.CENSL.E---.---....-----.............----KLIHSIW...KFGSKSFTFIL.I.AIE.R..SLPI..LKDL............VST......................................................DQDQIE...I....LKLTLEFFQ.NNH...Q...--------.LISYNLVHPKVLMDFIFS................................--N..QQP.L.N.Q.Y.W.I.WRIIDA.ALSKSVDR.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------niylekekgmkvd................................................................................
M7WDI9_RHOT1/709-986                   ..............................................................YAYE.....DPEHIHNAAATSFLRMV.RA.KAP.......ISEATEELDS.FQKSL.ETEH.NMT....AEAAE............nVKRDMAVQTIL...NVGSRSFSHFL.N.ALE.R..YLTL..LRNL............SSS......................................................PSARQH...L....LNTVAAFWK.RHP...Q...FHLIVLDK.LLQYRLVDTRDVIAWVFApse..........................eqeGSK..TKT.W.S.D.P.D.L.WQMVKI.TLRSVTGQ.......IDSAKMRVEGLKREEEMKg.......aeN-Dt....gkQDgedvlda..................................................................egdlpvrDAQN..PELD.SANSYLAE.A.ED...EQASVLVNVL.........G....HFAKLLPAD..................VDEE.--..--.---------.............................................DWETWW..IK..GW..VREFCRS------sfshka.......................................................................................
Q6FN07_CANGA/580-828                   ..............................................................FYFK.....HESSPLRDVVVELLDYI.HK.PNN.......TREVSELEQL.LEKIK.ANHG.SII....KNFDR.............FIIVLIVQALL...ESGSRSLSHAN.K.YIS.D..LKDD..FKYVld.......kieLDQ......................................................DQKEFI...I....IEAVIRFWN.SNS...Q...NGYLIVDA.FKFAELVSSRSIINFALNe..............................eLAN..NYG.L.V.D.S.T.A.IEAIFR.TLSHEITL.......------------------..........---.......--................................................................................----..----.--------.-.EI...EHADDFEFVL.........E....KLCIIINNT..................VSQL.NI..QL.DEDID-VPQifeltdgdn...........................asdlaaydlKWKYYT..SI..VF..IKSLLRKYSLKY-k............................................................................................
M3Y4U2_MUSPF/485-760                   ..............................................................YKYGd..esSNSLPGHSVALCLAVAF.KS.KAT.......NDEIFSILKD.VPNPN.QEDD.DDE....G-FSFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.T.R.L.F.V.WEILHS.TIRKMNKH.......VLKIQKELEEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGALE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TSVLT----.............................................PWYKNC..IE..RL..QQIFLQHHQII--qq...........................................................................................
B9HP11_POPTR/485-830                   .....................................................fiysiedgr----.....-EKTEQHALSAELNNKV.KA.RQT.......AREIISWVEE.SVVPN.--HG.W--....----D.............VALKVVVHTLL...EIGSKSFTHLI.T.VLE.R..YGQV..FARI............CPD......................................................HDKQVM...L....IAEVSSYWK.NNA...Q...MTAIAIDR.MMGYRLISNLAIVRWVFS................................PAN..IEQ.F.H.T.SdR.P.WEVLRN.AISKTYNR.......ISDLRNEISSLKKSVVSAee.....aatK--.......-Akteldaaesklslvdgepvl.......................................gdnparlkrlkanaekakeeeVSVH..ESLE.AKEALLAR.A.LD...ENEALFLSLY.........K....NFSNVLMERlpdp.........srartLREL.KS..IQ.ADEMTVDLDessvmevdnesgrpn..............ksqsnggkesniynvgEKEQWClsTL..GY..VKAFARQYAS---ei...........................................................................................
R1EFH6_BOTPV/627-881                   ..............................................................FKYE.....SDQTPYAPQGRELLSLL.KK.KAS.......EDEIQKVINS.IHEQA.AEHD.V--....ADVLT.............PSTDAYVTCIC...YIGSKSLSHVL.S.CIE.R..CKER..LLAI...........gPAS......................................................ETARKQ...I....ITSVTEYWK.DQP...G...IAVNIVDK.LLNYTILSPMCVVQWALSd..............................rLGA..GGA.L.S.E.S.W.I.FEMVAG.TVGKVTNR.......---VRQIVAARLQK----..........---.......--................................................................................GLPE..EQVQ.LLDDTLTK.E.RD...AMRQLFQVID.........D....VTSGVAQGAad..............gfI---.EA..DG.SEGMDEEKG.............................................KLIKAW..GE..RW..SRVFRRKAAVEE-a............................................................................................
R0MH35_NOSB1/38-153                    ............tldvlskfcnlenliqflpefkekieiplikpipkekftiddnkekffrd----.....-----------------.--.---.......----------.-----.----.---....-----.............---------FC...LLGSPSVSHFL.S.YLE.I..YKKE..FK--............-LS......................................................EEDQRL...F....LEVFSRIFI.KRK...S...FTGIILGK.MVKFGIIK----------................................---..---.-.-.-.-.-.-.------.--------.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------reli.........................................................................................
W5PNL4_SHEEP/485-760                   ..............................................................YKYGd..esSNSLPGHSVALCLAVAF.KS.KAT.......NDEIFSILKD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.T.R.L.F.V.WEILHS.TIRKMNKH.......VLKIQKELEEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGALE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TSVLT----.............................................PWYKNC..IE..RL..QQIFLQHHQTI--hq...........................................................................................
F6ZI49_XENTR/488-764                   ..............................................................FKYGd..esNSALPGYSVAVALTNAI.KN.KAS.......DKEIFNILKD.IPNPN.QDDD.DDE...gISFNP.............LKIEVFVQTLL...SLASKSFSHSF.S.ALA.K..FHDI..FKAL............SES......................................................DEGKLH...I....LRVVYDIWK.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................PEL..SRD.F.P.R.F.Y.I.WEILHS.TIRKMNKH.......VQKIQKELEDMKLRLAKQ.........hKHRds...ddNDeds.........................................................................grkdGPLE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..GG.IDVNT----.............................................AWYKNC..RE..RL..QQIFLQHHQII--qq...........................................................................................
A0A0L7LUP8_9NEOP/7-204                 ............................................................ct----.....-----------------.--.---.......----------.-----.----.---....-----.............-----------...-----------.-.---.-..---N..LQIL............AES......................................................EEAQMC...I....LRNVWELWQ.RHP...Q...MVCVLVDK.MLKTQIVDCSAVATWLFS................................KEM..APY.F.T.H.G.Y.L.WELLHL.TVDKMNKH.......VSKLNAEDADSGLQRRGH..........---.......-Lallqgdgallp..........................................................vgaavphrrpdEQAR..AELQ.EAREALAR.A.DS...SSSDSEDETN.........N....KKKKDQNKPte..............ehLVRC.DT..DA.REYET----.............................................HWYNAT..VG..RL..RQVFL--------cvsi.........................................................................................
J4W7Z6_BEAB2/534-789                   ..............................................................FKYK.....NPDTPFSAEGQEIGALL.RR.KAT.......DEEIQPTIDA.IQAQA.KERA.---....LDPVV.............TSTDVFVTAMC...WVGSKSLSHVL.A.CID.R..SKVR..LLDA...........gAAS......................................................PAARSQ...I....ISSVMAYWH.AHP...G...VALSIIEK.LLNYSILTPFSVADWAILads.........................ashkGSP..GAA.L.A.Q.P.H.I.YEAIFN.TVSKVTAR.......---VRQLVTAAAPN----..........---.......--................................................................................NSEA..AAID.DEEETRAK.E.VA...DMTELFRTIN.........D....ALEAWAGGS..................KDEL.MQ..QD.GASET--DD.............................................ALIRRW..GQ..RW..LRVFRRRAAVE--aa...........................................................................................
G7KX77_MEDTR/493-829                   ......................................................kennehll----.....---------SGQLNDMV.KG.KVP.......VREIISWIDE.SVFSN.NS--.---....---LE.............VTLRVVVQTLL...NIGSKSFTHLI.T.VLE.R..YGQV..ISKI............CPD......................................................EDKQIM...L....IAEVSSFWK.SNT...Q...MTAIAIDR.MMSYRLVSNLAIVRWVFS................................EEN..VEQ.F.H.T.TdR.P.WEVLRN.AVSKTYNR.......ISDLRKEITSLKRNISSAev.....aanE--.......-Akaevdaaesklalvdgepvi.......................................genparlnrlklraekakdelVSIQ..ESVE.AKEALLAR.A.TD...ENEALFLLLF.........K....SFSNVLTDRlpkgsgar.tlrewkstqVEEM.AV..DP.--------Eesstmeldnenqipq..............nsqsnggkksaaynvgEKEQWC..IT..TLsyVKAFSRQYAT---ei...........................................................................................
A0A0N5DLP0_TRIMR/524-780               .............................................................n-KFE.....LDGEPLCELALQVHGAI.KA.RKH.......PEELLSILSK.-DGQG.NEDG.SNF....AETVE.............FKTELLISQLL...VVGQKVMSQTM.M.LLT.K..YSHV..LDQL...........vRNN......................................................ENAQLC...L....LNGIVDAWP.NFE...Q...RVAVVVDK.LFRLEIVQGPTIIKWIFS................................EKM..KDY.F.L.K.Q.Y.V.WEILFS.TFDKLCTN.......YRVLSDKLSTFAEDTVSP..........---.......SQ................................................................................GENS..PALL.ELQQGLDA.C.LG...AQKAYIFTLF.........Q....HFIITLSEH..................LLAV.DE..GG.DNVS-----.............................................DWYRIV..FG..RM..CQFFTTR------cieihr.......................................................................................
B4R0Z6_DROSI/496-718                   ..............................................................FKFV.....DETLFGAILSKDLLEAM.RGpRAS.......PEIISEIIKS.SKGIG.----.---....P---L.............LKINVFTQNCL...HLGSKSFSHTF.A.ILA.K..YQSV..FKDL...........vEGD......................................................SEGQIA...V....LNGVFDVWV.ASD...H...YKFVVAEK.LVKVFIIEPINIVTWIFG................................PSM..RKE.L.T.K.M.Y.I.WELLHS.AVRHLKRV.......----QHDVEVVDVD----..........---.......--................................................................................----..----.----NPSA.C.DP...VVKSVLYTVV.........E....RLVKILCSA..................P--F.AD..EG.TEEH-----.............................................YWFQWV..LG..RL..EE-----------tlfiyaddf....................................................................................
R0KSP6_NOSB1/298-432                   fpfskdqdlnkikefvddltldvlskfcnlenliqflpefkekieiplikpipkekfvihkd----.....-----------------.--.---.......----------.-----.----.---....-----.............--REKFFKDFC...LLGSPSVSHFL.S.YLE.I..YKKE..FK--............-LS......................................................EEDQRL...F....LEVFSRIFI.KRK...S...FTGIILGK.MVKFGIIK----------................................---..---.-.-.-.-.-.-.------.--------.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------reli.........................................................................................
I0Z3N8_9CHLO/528-857                   ......................................................hederdae----.....------TVRAYQLLQMV.RH.KVV.......SEGVLEWVEE.-EQLR.QELG.GGL....-----.............GVLRMLLRGYL...VAGAKSFTHMI.T.ALE.R..YCTT..LQALl..........hE-Tghearspast..................................sfvcnnsggiLQGEVA...L....VDVTAKVWA.NAP...Q...RAAQVIDR.LMALRLVSGAAIVAWVFGcp............................gvRTL..ADE.L.S.T.G.L.A.WEVFYN.AVNKMLAR.......TQDARDDLSEAQAESDAAga.....rarE--.......-Aaeafsragegedtpqd................................................laerlaqeeaaagsvlAETQ..AQVE.GRQADLDE.A.VQ...LQEALLLQVF.........T....NFRDILLEG..................HAEL.GA..SA.AEPASGEEPdpsaiga..............................teqqdakhAWYAFM..LA..TL..Q-SFTRRYYK---ava..........................................................................................
I7M7J6_TETTS/614-871                   .......................................................tkyqqdp----.....--------LAQRFMELL.VQ.KKT.......HEEMGEEINEaLKEGI.DDEG.EDE....NEKKN.............FVISVFLECLF...FRSCETFTHLK.I.LYD.R..YAPL..LKKLl..........eEHG......................................................EVFQNA...L....VNTLLLFWQ.NNS...S...NLEHYLKK.FISNNFITPQIVASSIFEhlk..........................elkA-S..SAS.V.R.QvH.Q.L.WLFLRR.ITFNIFDT.......FHNYTEEV-------NSNi........yQGQ.......DE................................................................................EEKA..GEVE.TLSQKLEK.A.KQ...QLTELLEIIF.........S....QFESIFSEV..................TA-D.EI..KD.KQYD-----.............................................------..--..--..-------------tyflyfyrkykkfvdwentyqsq......................................................................
H9IWE9_BOMMO/2-278                     ..........................................................ytfs----.....-AALPGTEAAHQLVVFV.RN.KCT.......PEEALNVLRD.LPNPL.KEGE.QTA....NQPTAy..........npLKIDVFVQTLL...NLGSKSISHSF.A.AIS.K..FHYV..FKIL............AES......................................................EEAQIC...I....LRNVWELWQ.RHP...Q...MVCVLIDK.MLKTQIVECSAVATWLFS................................KEM..APY.F.T.H.G.C.L.WEMLHL.TIDKMNKH.......VSKLSAELQEAREALARAdss....ssdS--.......-Edensk.....................................................................kkkdqdKPTE..EAVE.RMEERLEA.A.HM...DQKRLFLIVF.........Q....RFIMILSEH..................LVRC.DT..DA.RDPHT----.............................................HWYRAT..LH..RL..TQVFLIHHEQVQK.............................................................................................
R8BBG4_TOGMI/542-796                   ..............................................................FKFK.....DDQTPFAAEGRELAQLL.RR.KAP.......DEEIQPVIER.IHSLA.LDQG.---....IDPLV.............ASTDVFTTAVL...WVGSKSLSHVL.A.AIE.R..TKDR..FLDA...........gAAS......................................................EPARAQ...I....ISAVMAYWS.PHP...G...VAVSIVEK.LLNYSILSPAAVIQWALIty............................agKTR..GDA.L.A.Q.A.H.V.YELVFN.TVIKVTGR.......---VRQVVQNPIPQ----..........---.......--................................................................................AANG..QDVDmDAEDIKQR.E.IK...AMRELFKIME.........D....ALVAWAAGS..................KDEM.ME..DG.QEGA-EQRN.............................................KLIQRW..GN..RW..ARVFRRRSAIEE-a............................................................................................
T1JMW3_STRMM/488-758                   ..............................................................YKYNm..dgAGSLPGTIAAHQLMTSI.KN.KCT.......PGEVLTIIKD.LPNPL.QDAE.DT-....YNP--.............LKIDVFVQTLL...FLGNKSISHTF.A.AVA.K..FHYI..FKTL............AVN......................................................EEAQIC...I....LRNAFEVWR.QHQ...Q...MMTILVDK.MLKTQIVECIAVANWIFS................................KEM..MPE.F.T.K.I.Y.V.WEILHL.TIRKMSTH.......VQKLQKELNDARDKFGRD..........DQTm....elDDden.........................................................................seieRPTE..EMIE.RMEERLEA.A.QA...DQKNLFLVIF.........Q....RFIMILTEH..................IAKC.EF..DG.KDGNT----.............................................FWYRWT..IG..RL..QQVFHTHHDQVF-r............................................................................................
A0A0K0F7J2_9BILA/489-774               ........................................................fnnvlk----.....DSDDSTYKLSQDLAESL.SK.RIT.......NDELLAYLAK.SSDNG.DAMD.DGQlrllPSYDK.............EKIKLLMATLL...DLAQNAYTHNV.T.FFL.R..YRPA..FLEI...........vKQD......................................................SSIREI...I....LESIFTAWK.YNP...Q...LIELLTDK.LLKMQILDTYSIVKYILE...............................sRDL..GDY.V.D.K.K.Y.F.YHVLYQ.SVHRLSTH.......ANNLFNDYEKLKSQIKSVerk....fvkK-E.......-Edsnmeecsttnledei................................................didslgnydewlinqkKNLE..EKER.CMFESSNA.L.KD...ILERIFTFYF.........S....KVISIDREH..................E---.--..--.---------.............................................------..--..--..-------------eifynfvngrlkqfvi.............................................................................
Q6BLJ6_DEBHA/674-939                   ..............................................................YNFS.....NSGLPLHEGSSKVYDLIiAN.WKP.......NSEFYDLYKE.ISTNL.DDYA.SIN....SDK--.............FLINLFFQTYA...YIGSRSIYSVV.S.LLS.R..DIIK..LKFLsgv......eikD-Enyqasefqf...................................pvaelaeqhfDNKQNW...I....IDSIFRIWV.HQP...Q...VVFLILEY.LIEFEVLKPKYLIGKTLN................................LAS..NLI.I.E.N.V.S.C.MESVNR.ILINFSKS.......------------------..........---.......--................................................................................----..----.--------.S.ND...EFKVLTLKLF.........E....LIVNNLNEI..................TKTL.ET..NN.SDEVTILKDfsdeesed............................ielmnkvdnQWLFYE..YK..GL..LKSYLRKFSIH--ns...........................................................................................
A0A0H5C952_CYBJA/584-823               ..........................................................lyvc----.....-DKLPLKPYVEKLIEVI.HT.NQQ.......PQNLQQAIEE.LKTVT.EPFT.NGE....----E.............LLITIVFQAIA...FVGSKSTSHVA.K.CID.S..TRDQ..LKNLl.........spS-Sdemd.............................................deqkaLEKQVW...A....VGAVLSYWN.QDP...H...CGYLAVDV.LENFGVVSPLAVLKHSLDd..............................sRDV..NIG.L.V.N.V.A.T.IESIFR.SLTRVVFS.......------------GS----..........---.......--................................................................................----..----.-----STK.E.LI...YVFETLLKTI.........S....KTCQVLTQSeai............pipD--V.EA..--.--------Dvte......................................evelSWKYHT..TL..GF..VRAVLRKFSDEY-t............................................................................................
F4RMF2_MELLP/640-988                   ..........................................................fedk----.....--------ASSDIVQLL.KR.KEP.......VSRLLEYLKK.MVERF.EGEE.GMN...gSEALS.............IQHQLTIEAIL...FVGSRSFSHFL.N.VLE.R..YTEL..LKKM............TES......................................................KESRRL...T....LKSVTRVWK.NNP...Q...FELIVYEK.LMEYRLIDPIDLIQHFFDheet........................geeeEKN..GKK.R.R.E.I.K.F.WDGIRL.SIGMVKNR.......VGIARVRVNRMKKEDEDEmd.....lvrA-Aa....gnGDngndpdgnmtgdkemedipkaeemskegetlkesdaskdgevpkegeglkegqetkeeneseitkesevlkeeemkklkrIERE..KSLE.SKISELNS.E.IK...ELIEVFLEVV.........K....LFGKELEDI..................SKEE.EE..EE.MNGKE----.............................................DWGKWW..VE..GW..TREFCRLFGNE--iv...........................................................................................
M4AV18_XIPMA/485-766                   ..............................................................FKYGd..esGTSLPGYPVSITVSNAI.KN.RAS.......NEEILAILKE.VPNPN.QEDD.DDE...gESFNP.............LKIDVFLQTLL...HLAAKSFSHSF.S.ALG.K..FHEI..LKNL............TES......................................................DDGKLH...I....LKVIYEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWLFS................................QDM..AHE.F.T.R.L.F.T.WEILHS.TIRKMNKH.......VQKIQKELEEAKDKLEKQq........hK-Rrd...sgDDedmekn....................................................................seedeeGQLE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMLLTEH..................LVRC.ET..GS.VDIST----.............................................PWYKNC..IE..RL..QQVFLMHHGTI--qq...........................................................................................
A0A067LWN8_9HOMO/535-823               ..............................................................FEYD.....DPAHPLYEPAQSLLTLI.RG.RSK.......ADEVVQHAET.LRSTI.SDTP.NLT....PD--S.............AVRSIAVQCLL...HVGARSFSHFL.N.AIE.R..YLAL..LRSL............SNT......................................................ADDKAD...I....LDAAGRFWI.KNS...Q...MVGIVFDK.FMQYQIVEPGDVIAWAFR................................TAT..GHR.L.-.G.T.N.E.WDIVKV.ALDKSIGR.......VLLTKRKVALLRKEEEDVsa......raKAQa....aaEEdsqmdve.................................................................aekkddavVSDS..PALQ.TSLKALAT.L.TR...EQRMTFSRAL.........D....EFVAVLTKSasps.........igvigAEAW.EG..RA.DWNE----E.............................................QWQFWE..MW..GW..YRHFCRAYAVH--lg...........................................................................................
E7QJB4_YEASZ/578-825                   .............................................................l-YFR.....QEGVPMENTVRKILDYT.HK.ANN.......SREVTELESI.LGELK.NEYG.SII....SDFNR.............FVIILLVQAVT...DSGSRSLSHAN.K.YIN.D..LKED..LKTI............FAKie.................................................ldiETKEYI...I....IEAVLTFWN.ANP...Q...TGFLVADA.FKYAGLLTSRTIFTFIFNe..............................tGLK..NNG.L.I.E.A.T.A.IEAVFR.NLSQQISE.......------------------..........---.......--................................................................................----..----.--------.-.EN...ESGNNFEFVF.........E....RLCTIANST..................IDLL.DV..NA.DEDIE-IPKvngemdid............................dieddkldlKWKYFT..VI..GF..IKSILRRYSHEYR.............................................................................................
A0A084W0C9_ANOSI/488-776               ..............................................................YKYSm..egAASLPGTATAHKLVVAI.RQ.KCN.......ADDVLNELND.LPNLG.DSSE.TDM....TETTYn...........pLKIDVFVQTLL...NLGSKSFSHTF.A.AIS.K..FHTV..FKAL............ADT......................................................EEAQIC...I....LHNMFELWV.DHQ...Q...MMVVIVDK.LLKVQIVECSAVATWVFS................................KEM..VGE.F.T.K.M.Y.L.WEILHL.TIKKMNQH.......VTKLSREMNEAKEKLARTae.....sssS--.......-Esedesssnpq...........................................................rrrknadgsaeKPTE..EQVE.RMEEKLEA.A.YV...EQKRLFLIIF.........Q....RFIMILSEH..................LVKC.DT..DG.RDYDT----.............................................DWYRWT..IG..RL..QQVFMMHHEQVQK.............................................................................................
N1QI61_SPHMS/567-818                   ..............................................................FKYA.....EDRTPFAKEGREVLALL.KK.KAS.......EEEVQKVLDS.VHEQA.AAMG.--F....TDPLV.............ASTDIYMTSIL...SVGSKSLSHVL.S.TID.R..CKDR..LLNI...........aQGS......................................................EAARRQ...V....VGSVVDFWS.DHP...G...TAVNIVDK.LLNYTIITPMSVISWALVd..............................rMDR..GRA.L.A.S.S.Q.I.YEMVSI.TMFKVTNR.......---VRQVLRDRNNL----..........---.......--................................................................................KLDF..ASRK.QIDEALPN.E.RQ...AMRDLFAAIE.........D....AVVAVSEGA..................QDEM.IE..R-.-YDGDSAEQ.............................................QLIQLW..GS..RW..ARVWRRKAAVEE-a............................................................................................
K2QJ30_MACPH/499-753                   ..............................................................FKYE.....SDQTPYAPEGRELLQLL.KK.KAS.......EDEIQTVINK.IHEQA.AEHQ.V--....TDVLV.............PSTDAYVTCIC...YIGSKSLSHVL.S.CIE.R..CKER..LLAI...........gPAS......................................................ENARKQ...I....ISSVADYWK.DQP...G...IAVNIVDK.LLNYTILSPMCVVQWALSd..............................rLGA..GGS.L.S.E.S.W.I.FEMVAG.TVGKVTNR.......---VRQIVAARLQK----..........---.......--................................................................................GLPE..EQVQ.LLDDTLTK.E.RD...AMRQLFQVID.........D....VTSGVSQGAad..............gfIEAD.GG..KD.MDEET---G.............................................KLIKAW..GE..RW..ARVFRRKAAVEE-a............................................................................................
E2BW56_HARSA/488-760                   ..............................................................YKYTs..egASSLPGTAAAHELVVSI.RR.KCT.......PEEVLNVLNT.LPGPK.ENEE.TN-....-NFNP.............LKIDVFVQTLL...NLGSKSFSHSF.A.AIV.K..FHHV..FKA-............---......................................................KEAQIC...I....LRNMYALWK.NHY...Q...MMVVLTDK.FLKTGIIECSAIANWIFS................................KEM..ASE.F.T.K.L.Y.I.WEILHL.TIRKMNKH.......VMKLSTELTEAREKLRRAesr....sgsS--.......-Sedednn....................................................................kernreRPSE..DVVE.RMEERLEA.A.QG...DQKNLFLIIF.........Q....RFIMILSEH..................LVRC.DT..DG.IDYNT----.............................................HWYKWT..IG..RL..QQVFLSHQEQVQK.............................................................................................
Q6CJM2_KLULA/577-822                   .............................................................l-YFR.....SPSFPFHENVTQLLDFF.HK.QPD.......TRSVAELEGI.LKDIA.VNHG.SII....EDFNR.............FTVTLLIQTIV...FCGSRSLSHAN.K.YID.D..SREE..LKAI............MAQve.................................................vspQIKDQW...I....CEAVVRYWN.SNS...Q...TGYLILDS.LRYNGLISNESVLNFSLTe..............................qCGV..NMS.L.V.D.S.T.S.IESIFR.ILNELAMA.......------------------..........---.......--................................................................................----..----.--------.-.AD...KDVGSFEYVF.........N....RLVGAANEV..................LSQL.--..NT.IDPI-VVPDldqdiqat............................deelpsldlAWKYEA..IM..GF..LKSVLRKYSDEF-s............................................................................................
A0A0L6UA42_9BASI/648-1012              ........................................................eprahr----.....-----DHLAALDVVQLL.KH.KEP.......VSRLLDYLTK.MQERL.VNE-.GIL....ESAQD.............VTREVAVQALL...HVGSRSFSHFL.N.ILE.R..LVTC..IYHGakrqyleliknlTNS......................................................PNARAS...L....LQTVSKFWR.KNG...Q...FELIVIDK.LLEYRVVDPIDSLRHSFD................................TYK..SLQ.W.G.E.L.Q.F.WDGLKL.TVEKVTRR.......VKASRTKLATLKKDEEDQr........dR-Qra...agVEflfskerkyifldrnkaymqtkidsilwfpi..................ldmkegidaeegkkdgeevqgastrqkeeleTIRR..DEIA.TAEKELEA.H.LA...EQVVVLAEAV.........G....RFSRARLEA..................EEML.NE..EE.G--AAAAATgggseeqepanga..................keeqpqkapskgtaFWKAWW..LR..GW..CRELYRLV-----sytsr........................................................................................
C3Y2C6_BRAFL/549-659                   ..................................................lenllftsdtda----.....-----------------.--.---.......----------.-----.----.---....-----.............-----------...-----------.-.---.-..----..----............---......................................................------...-....---------.---...-...--------.------------------................................---..---.-.-.-.-.-.-.------.-------H.......ILRVFQQFCALRAGSEDE..........MQD.......MD................................................................................GVDE..EEIE.HLQERLES.A.QS...EQKKLFLVIF.........Q....RFIMVLTEH..................LGRC.ET..SG.KDFNT----.............................................AWYRYS..SE..RL..QQIFLQHHSTV--tk...........................................................................................
S9X512_SCHCR/515-731                   ............................................................ip--YE.....NESHPLHASFKEITDHL.RI.HKP.......IEVISSALSS.VEENK.ASET.---....-----.............SGVRFLMACNY...SLGSKSLSHAL.N.AFE.K..HLDV..IKHF...........sRKS......................................................LSTEME...T....IDELFLCWR.LQP...S...IAVIWLGK.MLNYSIVSLTSVFRWLLD................................QKD..PSI.W.A.K.S.W.T.WSLMHM.SLKKMDAR.......LENVNSDDENLKELIRES..........---.......--................................................................................----..----.--------.-.KE...EKEAV-----.........-....---------..................----.--..--.---------.............................................------..--..--..-------------lnllftelpkrksenesipwlshwiqliqndlesvy.........................................................
A0A060SP03_PYCCI/543-845               ..............................................................FEYD.....EPTNPYHESAQSILNLI.RG.RAK.......PDDVMAHLES.LRNSL.METT.---....ENVDA.............VLRAITVQSLL...HIGSRSFSHFL.N.AIE.R..YLPL..LRNL............AAGrist.............................................ggnanVEARTD...I....MSAVATFWR.HSR...H...MINIVFDK.LMQYQIVDPTDVVGWTFThcs..........................qvtYGK..AKT.T.F.G.A.F.Q.WDLLKA.ALDKANGR.......VMMQRRKVAALRKEADEK..........AAKai...agESatmevda.................................................................earpdvipTGES..PQLT.SAIKAFTI.L.AR...EQKSALTRTL.........Q....GFVGYLASEsv.............npkVEEV.IT..EN.--------Awhnra...................................nwedeDWEAWE..TW..CW..YRHWGRMYSPYL-r............................................................................................
G4TF65_PIRID/529-819                   ..............................................................FEYE.....SSDNSHHAIADGLLSKL.QN.RPV.......MSEISVYIDT.MRTEL.ISSG.LSD....SRAAS.............RTRSIAVQCLL...VVGSRSFSHFL.N.AIE.K..YIKV..LQGL............SNT......................................................PDAKFE...I....LEIVSSFWR.RNR...Q...MIMIIFDK.LMQYQIVDPSDVVSWAFEgg............................glGDK..GDG.L.-.G.T.F.Q.WELMRI.ALDKSNGR.......VAIAQRRVVQQRKLDEET.........rAAR......mATiagngmdvdd............................................................mpakvdgkskFDDS..EELR.KQIRAHSI.L.VA...DQKAVLSRTM.........E....GFVTVLSDT..................DSVL.TE..ESwNNRASWSKK.............................................EWETFE..SW..GW..FRHFTRNYAPYL-r............................................................................................
A0A0L7LTZ4_9NEOP/6-95                  ............................................................sd----.....KPSLPGTEAAHQLVVCV.RN.KCT.......PEEALNVLRD.LPNPL.REGE.QPP....AAQAAph.........npLKIDVFVQTLL...NLGSKSISHSF.A.AIS.K..FHYV..FK--............---......................................................------...-....---------.---...-...--------.------------------................................---..---.-.-.-.-.-.-.------.--------.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------vt...........................................................................................
U9UVG0_RHIID/571-831                   ..............................................................FKYE.....DSTHPLHDLAETLLGKI.RK.RAS.......NEDVQAYFKE.IVTAL.PPKE.Q--....---DQ.............TIRDIFVQCVL...MQGCKSFSHVL.N.VIE.R..YLPI..LQSL............NES......................................................PEDKLH...T....VKIVAEFWK.RNT...Q...FLGILLDK.LLNYRVIDASSIITWLFT................................KEM..ETE.V.S.K.S.Y.M.WEIMKN.TINKVISR.......VKQVQYKLDTLINPRTDIi.......diT-Sd.....vDK................................................................................KVNS..EELR.SLENTLSN.V.TR...EQKEVLLALV.........N....LFVGMLDER..................LKEY.IE..QD.IQDPM---S.............................................QYWFWW..AY..GF..FKEIGRCYQPQM-s............................................................................................
M7SBY9_EUTLA/537-793                   ..............................................................FKFN.....DDHTPFAAEGKELAALL.KR.KAP.......DEEIQPVIDR.IHSEA.LDQK.---....LDPLV.............HSTDVFMTAVC...WVGSKSLSHVL.A.CIE.R..TKDR..LLDA...........gAAS......................................................EAVRSQ...I....ITAVMTYWS.AHP...G...VAISIVEK.LLNYSIITPGSVIDWALVgd............................kaGPY..GEA.L.S.K.A.W.V.FELVFN.TVVKVTGR.......---LRQVVSTTSSSGNSG..........---.......-V................................................................................DADA..GAEE.SQQQDQEG.E.IA...AMRDLFKAME.........D....ALFSWAQGT..................KDQImDP..VV.SDGGE----.............................................DLIKRW..GQ..RW..LRVFRRRSAIEE-a............................................................................................
A0A093X5E1_9PEZI/534-785               ..............................................................FKYN.....DEDTPFAAEGREIHTLL.KR.KAP.......EPEIQTVIDQ.IHTQA.TTIA.--I....HEPLL.............SSTDAYVTSIC...YIGSKSLSHVL.S.CIE.R..CKER..LLSI...........gNTS......................................................ETARRQ...I....ITSVMAYWV.DQP...G...IGVNIVDK.LLNYTILTPLSVVEWALLd..............................dTKA..GDK.L.A.E.P.F.V.FEMVAG.TVQKVTNR.......---LRQIV----ASRNAP..........---.......--................................................................................GLEH..EQRL.LLDETLLR.E.RV...AMKDMFKVME.........D....ALFSWAAGS..................KDQT.ME..GG.NGDT--SDE.............................................AFIRRW..GE..KW..LRVFRRKMAVEE-a............................................................................................
E5ABN2_LEPMJ/742-995                   ..............................................................FKYD.....DPQTPYSAEGQKLLQQL.KK.KAP.......AEEVQSTIDK.IHEQA.LEQG.V--....AEVLV.............PSTDAFVTAIC...RMGAKSLSHVL.S.CIE.R..GKDR..LLEI............SQN......................................................EVARRQ...I....VASVVEYWK.DQP...G...VAVRIIDI.LLNYTILAPMTVIQWVLGs..............................hMGA..GEA.L.T.E.S.W.V.YEMVSN.TVAKVTNR.......---NRQIA----SARLQK..........---.......--................................................................................GLPQ..EQIE.MVEATLAK.D.RD...NARELFKYIE.........D....SMRGVAEGS.................aDVLL.EK..QT.SGALTEEEV.............................................ELIKAW..GK..RW..HTVFIRKAQVEE-s............................................................................................
W9X406_9EURO/538-790                   ..............................................................FKYN.....NDSTPFAAEGKEVAQMV.RR.KAT.......SEEFAPILEK.IEQEV.AASG.--L....PDPSL.............ASTDVFVTSMC...WTGSKSLSHAL.A.CIE.R..CKER..LLAI...........sASS......................................................PACRKQ...I....ITSVVDYWR.DQR...G...VGVVLVDK.LLNYQILTPDSVVEWALId..............................hVSR..GTL.L.A.T.T.W.C.YELISN.TTRKVAGR.......---VRSIVGAIRSP----..........---.......--................................................................................GLSE..EQRL.ELQQTLNR.E.LE...GMKSLFAIIE.........D....AVVSIRDGN..................QDEM.-M..ES.SDALRAEEE.............................................ELLKSW..GG..RW..ARVFQRRYAVEE-s............................................................................................
A0A024TDB5_9STRA/640-840               ......................................eqvfgkikaregttaieawidaqg----.....-----------------.--.---.......----------.-----.----.---....---KD.............VGLEMAVAALL...DAGSATFTHFR.T.LLD.K..YLPV..LMHAi..........dA-Ngd..................................................ggVDRQVV...V....IATVSSVWE.QSP...Q...HVILILNI.LLRHRVLSPVAIVSWLFG................................ADA..VQQ.Y.S.W.P.Y.V.WEILDH.TMRYALEQ.......------------------..........---.......--................................................................................----..----.----RPAA.D.TA...AVDELFVAVF.........E....GLSRVIAAH..................KAQC.DK..DG.TTFKD----.............................................NWYAST..LA..RL..QS-----------fgrdfrva.....................................................................................
A0A094FNT1_9PEZI/275-526               ........................................................ikltkl----.....--DTPFAAEGREIHTLL.KR.KAP.......EPEIQTVIDQ.IHTQA.TTIA.--I....HEPLL.............SSTDAYVTSIC...YIGSKSLSHVL.S.CIE.R..CKER..LLSI...........gNTS......................................................ETARRQ...I....ITSVMAYWV.DQP...G...IGVNIVDK.LLNYTILTPLSVVEWALLd..............................dTKA..GDK.L.A.E.P.F.V.FEMVAG.TVQKVTNR.......---LRQIV----ASRNAP..........---.......--................................................................................GLEH..EQRL.LLDETLLR.E.RV...AMKDMFKVME.........D....ALFSWAAGS..................KDQA.ME..AG.IGETT--DE.............................................AFIQRW..GE..KW..LRVFRRKMAVEE-a............................................................................................
E3S7J3_PYRTT/731-984                   ..............................................................FKYD.....NQDTPYAAEGQMLLTQL.RK.KAT.......SEEIQATIDS.IHEKA.LEQG.--I....TEVLV.............PSTDAFVTAIC...RLGAKSLSHVL.S.CIE.R..GKDR..LLEI............SQN......................................................EGARRQ...I....VASVVEYWK.DQP...G...VAVRIIDI.LLNYTILAPMTVVQWVFGs..............................hMGA..GEA.L.T.E.S.W.V.FEMVSN.TVAKVTNR.......---NRQIA----SARLQK..........---.......--................................................................................GLQQ..EQTE.MVEATLAK.D.RD...NARELFKYIE.........D....SMRGVAEGSa...............dtLVEK.ST..NG.NLTDE---E............................................vQLIKAW..GK..RW..HTVFIRKAQVEE-s............................................................................................
G1T696_RABIT/486-761                   ..............................................................YKYGd..esSNSLPGHSVALCLAVAF.KS.KAT.......NDEIFSILKD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.I.R.L.F.V.WEILHS.TIRKMNKH.......VLKIQKELEEAKEKLARQ.........hKRRs.....dDDdrgs........................................................................drkdGALE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TSVLT----.............................................PWYKNC..IE..RL..QQIFLQHHQII--qq...........................................................................................
T1GNS6_MEGSC/18-236                    ..............................................................YKYSs..enASSLPGTQVALQLILAI.RQ.KCT.......PEEELPNPNE.SMETD.NAEE.---....-SFNP.............LKIDVFVQTLL...NLGSKSFSHTF.A.AIS.K..FHTV..FRAL............ADT......................................................EEAQIC...V....LHNVFELWK.HHQ...Q...MMVVIIDK.LLKLQIVDCSVVATWIFS................................KEM..TSE.F.T.K.M.Y.L.WEILHL.TIKKMNNI.......----DDEDEQSNKNKNDNvd.....kptE--.......-Egpkq........................................................................asskP---..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------pnilseandgtnndedtkdkskcyelf..................................................................
E4UYW2_ARTGP/547-800                   ..............................................................FKFS.....QETTPYSKEGQELMKLI.RQ.KSS.......DEEIQAVITS.IEEQA.QTHG.--L....TDPLI.............ASTDVYMTSIC...YVGSKSLSHFL.S.CIE.R..CKDR..LLAI...........gPKS......................................................GAARRQ...M....INSVMEYWA.DQP...G...IGINIIDK.LLNYTILTPLSVLEWALVd..............................nLAA..GST.L.A.K.P.H.I.FEMIAA.TMRKVTNR.......---MRQIVAARTQP----..........---.......--................................................................................TLYE..PQLS.ILDETLKK.E.KA...DMLSMFQLIE.........D....TLVPVAGGYsd..............giMERT.--..--.EDDALQTEN.............................................VMIQQW..GS..RW..LNVFRRKVAVE--ra...........................................................................................
G3QGA9_GORGO/487-762                   ..............................................................YKYGd..esSNSLPGHSVALCLAVAF.KS.KAT.......NDEIFSILKD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.T.R.L.F.V.WEILHS.TIRKMNKH.......VLKIQKELEEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGVLE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TSVLT----.............................................PWYKNC..IE..RL..QQIFLQHHQII--qq...........................................................................................
J9EFK0_WUCBA/483-676                   ............................................................sy-DLN.....DDEHPDRDFAMVLEKAF.RE.KIS.......ADEMVDLLRN.KTGNR.MDIN.---....-----.............SRLSIFFKVLL...YLARKTFSHNF.A.ALT.R..YYST..LKEF...........iGGR......................................................EDAQLT...I....LRTLYETWK.LHG...Q...MIIVLVTK.LLKMSLVDASAVVAWLFS................................DEM..KPE.F.G.R.L.W.I.WEILNI.ALEHVSGH.......VRRNRQTIENAKLKKEEK..........---.......--................................................................................----..----.----ELND.E.K-...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------ddfvsdfviilcs................................................................................
F0ZKI8_DICPU/494-724                   ...................................................fkflssenpee----.....-ENKELVSQSHKLLLSF.KT.KEP.......LENLIQTFSA.IPSSI.----.---....-----.............NCVELLTKCIL...QIGSTSFSHLT.Y.AIE.R..YLTL..FKTV............LKS......................................................QDDRQE...C....LRSIFEFWK.YSQ...Q...HIVIVVDK.FITFKIIYPIDTVTWFMK...............................pENI..SRF.I.T.E.S.F.T.WEILHN.SIQKTIIV.......IETLSLDLEENQSE----..........---.......--................................................................................----..----.EKEFKLNT.S.IS...EQQLLLSELI.........K....GIGSILSND..................KNSL.N-..--.---------.............................................DSSKLL..IA..GQ..LKSITRKY-----ftqik........................................................................................
NCBP1_ANOGA/488-777                    ..............................................................YKYSm..egAASLPGTATAHKLVVAI.RQ.KCN.......AEDVLNELND.LPNSR.DASD.TDM....AEAPFn...........pLKIDVFVQTLL...NLGSKSFSHSF.A.AIS.K..FHAV..FKAL............AET......................................................EEAQIC...I....LHNMFELWV.DHQ...Q...MMVVIVDK.LLKVQIVECSAVATWVFS................................KEM..VGE.F.T.K.M.Y.L.WEILHL.TIKKMNQH.......VTKLSREMNEAKEKLARTve.....sssS--.......-Esedeaaspnaq..........................................................krrkntegsgeKPTE..EQVE.RMEEKLEA.A.YV...DQKRLFLIIF.........Q....RFIMILSEH..................LVKC.DT..DG.RDYDT----.............................................DWYRWT..IG..RL..QQVFMMHHEQVQK.............................................................................................
B8ND12_ASPFN/529-782                   ..............................................................FKYS.....LDTTPYANEGTEIMQLI.RK.KAT.......DDDILPIINA.IEEQA.RAMG.V--....EDPML.............PSTDAFVTAIC...FVGSKSLSHVL.S.CIE.R..NKER..LLAI...........gPKS......................................................TRARRQ...I....ITSVMEYWT.DQP...G...IGINIIDK.LLNYTILTPLSVIEWALVd..............................kLEA..GTI.L.A.R.T.H.V.FEMISA.TVGKVTNR.......---LRQIV----AARTQP..........---.......--................................................................................GLYE..PQLS.VLDETLNR.E.KA...DMQALFKVIE.........D....SIMSVAEGH..................NDEL.ME..RG.DGSGELPED.............................................EIIRQW..GC..RW..LRAFRRKAGVEE-s............................................................................................
E3KEG4_PUCGT/487-821                   ..............................................................FEYE.....DPAHRDHLAALDVVQLL.KH.KEP.......VSRLLDYLTK.MQERL.ITEG.-IQ....EPVQD.............VTREVAIQALL...NVGSRSFSHFL.N.ILE.R..YLEL..LRNL............TNS......................................................ANARAS...L....LQTVSKFWR.KNG...Q...FELIVIDK.LLEYRVIDPIDSLRHSFE................................TYK..TSQ.W.G.E.L.Q.F.WDGMKL.TIEKVTKR.......VKASRTKLAKLKKDEEDQr........dR-Qra...agGEiletgngtanmgdinmkegiege.................................egkkdeepteeaqgestqlkeeleTMRR..DEIA.TAERELEA.N.LT...EQVVVLAEAI.........S....RFSSARSEA..................EEKL.KT..EQ.ESVGG-EEEvepsngeekd........................qarkvsskdiaFWKAWW..LR..GW..CREFYRLFGTE--i............................................................................................
V5G4F2_BYSSN/534-787                   ..............................................................FKYA.....VDTTPYAKEGRELMQLI.RQ.KAS.......DEEIQPVIEA.IEQQA.KEHG.V--....EDPMI.............PSTDAFVTSIC...FVGSKSLSHVL.S.CIE.R..NKER..LLAI...........gPRS......................................................PIARRQ...I....ITSVMEYWA.DQP...G...IAINIVDK.LLNYTILTPLSVIEWALLd..............................rLSA..GTI.L.A.Q.C.H.I.YEVVAA.TIRKVTNR.......---IRQIV----IARIQP..........---.......--................................................................................GLYE..PQLS.VVDETLNR.E.KA...DMQTLFKLLE.........D....SLVPVAGGN..................NDQL.ME..RG.DGSGTLPED.............................................EIIRQW..GR..RW..LRVFRRKAAVEE-s............................................................................................
A0A015LJ81_9GLOM/314-574               ..............................................................FKYE.....DSTHPLHDLAETLLGKI.RK.RAS.......NEDVQAYFKE.IVTAL.PPKE.Q--....---DQ.............TIRDIFVQCVL...MQGCKSFSHVL.N.VIE.R..YLPI..LQSL............NES......................................................PEDKLH...T....VKIVAEFWK.RNT...Q...FLGILLDK.LLNYRVIDASSIITWLFT................................KEM..ETE.V.S.K.S.Y.M.WEIMKN.TINKVISR.......VKQVQYKLDTLINPRTDIi.......diT-Sd.....vDK................................................................................KVNS..EELR.SLENTLSN.V.TR...EQKEVLLALV.........N....LFVGMLDER..................LKEY.IE..QD.IQDPM---S.............................................QYWFWW..AY..GF..FKEIGRCYQPQM-s............................................................................................
W5EC97_WHEAT/370-652                   ......................................................fryhtdes----.....KESTEGHRLSKELVSMV.RG.RKT.......TRDIILWVEE.QIVPA.NGA-.---....----K.............FAVDVVSQTLL...DIGSKSFTHLI.T.VLE.R..YGQI..ISKL............CPD......................................................EEMQLL...L....MDEVSAYWK.NST...Q...MTAIAIDR.MMGYRLISNLAIVKWVFS................................PAN..VDQ.F.H.V.SdR.P.WEILRN.TVSKTYNR.......ISDLRKEIQTLRKSIQVA.........kE-Asa..kaiKEleeaksileivegqpvsse..........................................rpgrlrrlqgfadkakeeeVTIE..ESLE.AKQALLAR.G.LE...EGKELLRLLF.........K....SFVDVLTEC..................LPP-.--..--.---------.............................................------..--..--..-------------vsadgdvpnlragdp..............................................................................
A0A0B1NXU2_UNCNE/535-780               ..............................................................FKYS.....QEDTPFAAEGREILSLL.RK.KST.......EDAIQPVIDR.IHARA.IEMN.--I....PDPLV.............VSTDAYMTAIC...YIGSKSLSHVL.S.CIE.R..CKGR..LMAL...........gPVS......................................................PAARKQ...I....IESVMEYWK.DQP...G...IGVNLVDK.LLNYTILSPESVVEWALA................................R-D..GTR.L.A.K.A.Y.I.FEMVSS.TISKVTGR.......---VRQVYRAKSVS----..........---.......--................................................................................GLSP..EQTK.ILINTVES.E.RA...SMKNLFQLLE.........K....YLLGWINLY..................N--G.AQ..NG.TK---NVED.............................................VLTNEW..AN..RW..LRVFKRKLAVE--da...........................................................................................
B3MVZ8_DROAN/524-753                   ..............................................................FKYI.....DELVPGAKLSQLLLEAMrGR.RAE.......PTEISTILTG.STDLH.----.---....----L.............LKINVMTQVCL...HIGSKSFTHTF.A.TLT.R..YQTV..FKQL............IHS......................................................ESEQHA...I....LKGVFELWA.GNE...Q...FKYVVVEK.LIRMQIVEAKYVVTWIFA................................PQL..RVE.L.T.K.M.Y.I.WELLHA.TVRTVKHP.......----SRLLPR--------..........---.......--................................................................................-KRS..PETV.KALEEMDD.T.EV...AVKGILLEII.........H....RFVKVLAGS..................TEGP.--..EG.SNTH-----.............................................YWCQWV..QG..RM..QEFLFVYSE----dykk.........................................................................................
A0A022QJ29_ERYGU/485-802               .............................................................f-RYSa...eDEDQTEHGLSSELNVMV.KE.RVT.......SRDIISWIED.QV--L.PSHG.---....---LE.............VTLRVVVQTLL...NIGSKSFTHLI.T.VLE.R..YGQV..IARI............CSD......................................................QDKQVM...L....ISEVSSFWK.NSA...Q...MTALSIDR.MMGYRLIS--NVLRNAVS................................KTF..SRI.T.D.L.R.K.E.IASLKK.SVQSVTEA.......ASKAQAELDDAKSKPTLAlvdg..epvlA--.......-Enpvkmkrln.............................................................skvektkeeeVSTR..DSLE.AKEALFAR.A.VD...EIEALFLFLY.........K....SFSNVLAAP..................LQET.EG..SL.HLS------.............................................------..--..--..-------------gkademaidpedtstmeldkegeisekshsnggkttkgynvgekeqwclstlgyvkaltrqyasei...........................
F0YDT9_AURAN/1513-1687                 .................................edaageareprpadaalaaafdalgddaa----.....-----------------.--.---.......----------.-----.----.---....-----.............-KAAAVMRGVF...ARGAASFTHAL.A.PLD.DaeLSAA..LRNL...........vRDD......................................................DDCEAA...A....LDALADVWA.ASA...Q...HVALLADA.LVRRGVVRCRAVAAWVLD................................PRN..ESP.W.A.G.S.N.-.------.--------.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------vgasfkphellqvavdrsldllsaavasaaargadaatdgvvraqldea............................................
J9J348_9SPIT/488-775                   .........................................................cteqq----.....-----DSPDAQIILDLL.NQ.KET.......PENLKAALAG.ENSKI.EASG.E--....-----.............QMKEIFLECII...SKTKKSLEHLK.R.VFE.H..YYQH..IMQPf.........flGDT.....................................................iAESQVT...L....IRTICNIWI.NNP...K...KNLQIIEK.LYSLGIIVPKYALVYSFQal...........................ndlSVK..EQQ.S.N.E.N.I.H.SQIISL.LVKSVSHR.......PSQLFTLYNQKDNPISQR.........eKDR.......-Qalegegnaanahpa....................................................hfdlslskrlviknD---..---A.DFENQHKL.A.CQ...ERDEVIKMTT.........Q....SYLKLINEN..................QNGL.K-..--.---------.............................................------..--..--..-------------elqsqfarllrgyihsfsgpaiieavtqmeiqneiake.......................................................
A0A0L7LU78_9NEOP/1-42                  ..............................................................----.....-----------------.--.---.......----------.-----.----.---....-----.............-----------...-----------.-.---.-..----..----............---......................................................------...-....---------.---...-...--------.------------------................................---..---.-.-.-.-.-.-.------.--------.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---MILSEH..................LVRC.DT..DA.REYET----.............................................HWYNAT..VG..RL..RQVFLCHHEQVQK.............................................................................................
F8PPT7_SERL3/540-853                   ..............................................................FEYD.....EPTHPHHDAAQSVLNLL.RG.RSK.......ADEVMSHLDS.LRDTL.-EIS.DTH....MNIDT.............LIRFIAVQSLL...SIGSRSFSHLL.N.AIE.R..YLPL..LRGLangg...ivgagSGS......................................................SEAKQD...I....LSAAAAFWK.RNR...Q...MVNIVFDK.LMQYQIVDPTDVVAWTFTnvag........................dshlSGM..RPL.S.L.S.A.F.E.WDLLKG.ALDKANGR.......VMISRRKVAALRKEEDDTi.......arA-Kas...ggADvasmevda................................................................dakpdetpAVES..PALV.TALKAFTS.L.TR...EQKAALSRTL.........E....GFVSCLAPS..................VSDM.HQ..NP.HAGK--VITqdawdg................................ranwnadEWNAWE..TW..GW..YRHYCRVYSPYL-r............................................................................................
A0A067CB45_SAPPC/616-817               ........................................tkrikarddaavieawcnekts----.....-----------------.--.---.......----------.-----.--S-.---....LD-KA.............IVLEMVVSALL...EAGSATFTHFR.S.LLE.K..YQEL..LATL............TAS......................................................TEDALA...A....INAVGAVWE.QSP...Q...HVILILSL.MMRHKVLSSTAISTWMFS................................SDA..VQQ.Y.S.W.H.Y.V.WEILDN.SIVYGIER.......-------V---EANPED-..........---.......--................................................................................----..----.------AA.A.LD...DLQSMLRAVL.........E....GFMKVVADH..................KFSC.DK..EG.TSFKD----.............................................NWYTST..LA..RM..KAVGRR-------frva.........................................................................................
A0A095CIX4_CRYGA/593-871               .............................................................g----.....-----------------.KQ.KLP.......STEIIKHITE.MPNAS.SG-P.GEP....LYP--.............AVRQMVFETIS...HLGSRSFSHFL.N.ATE.R..YSDV..LRFL............TPD......................................................FASRRI...L....LDAVKSYWR.RSS...E...MRLVTLDK.YLQYGILEGIDIVEWIFAdd...........................eaeGEE..GDG.W.T.D.G.D.K.WEVLSM.CLEKHLGR.......VKAISRRLKVIEREDEAA.........rA-Rk....agEQlergedvnv..............................................................dddtnedprPETS..KEAR.DAQTSLDI.Q.ST...RLEKVLLATF.........K....HFIFALLPW..................TAER.EE..GI.STSN----Eglkgvlt..............................lldsneegLWGVRA..KW..GW..YREFVRRYQAQL-m............................................................................................
E2QD75_DROME/488-770                   ..............................................................YKYAn..eeAANLPGTTVAHQLVVAI.RQ.KCT.......PEEVVNILKD.IPNSG.YSGE.EMS...dGSFNA.............LKIDVFVQTLL...NLGSKSFSHSF.A.AIS.K..FHSV..FRAL............AET......................................................EEAQIC...I....LHNIFELWS.SHQ...Q...MMVVLIDK.LLKLQIVDCSAVATWIFS................................KEM..TGE.F.T.K.L.Y.L.WEILHL.TIKKMNKH.......VIKLNTELSEAKEKLAKAds......ssS--.......-Dseddsshk...............................................................rkkpithadKPSE..EVVE.RMEEKLEA.A.NV...NQKRLFLIVF.........Q....RFIMILSEH..................LLRS.DT..DG.RDPDT----.............................................DWYRWT..IG..RL..QQVFLMHHEQVQK.............................................................................................
W7IGH9_9PEZI/535-781                   ..............................................................FKFE.....ADDIAFPEEGKQLLNLI.RQ.KAP.......NEEVDTLMNA.ITEAA.SNKG.--L....PDATK.............YARDMYVTCIC...HIGAKSLSHVL.S.CIE.R..CKDK..LTQL...........gQES......................................................NQAQRQ...I....VGTVMHYWA.EQP...G...IGANVIDK.LLNYSILTPLSVVEWVLL................................DAG..REV.L.P.R.G.H.A.WEMVNT.TVRKVVSR.......----TRNLAAARGAP---..........---.......--................................................................................DLPE..EQMT.IMEQGHEV.A.KA...EQAELFKVVM.........E....GLAGYADGS..................VPAP.EG..TG.EEDA-----.............................................AWLKVW..SG..SW..LRALKRQSDIEE-a............................................................................................
E9F5L4_METRA/538-783                   ..............................................................FKYT.....NPDTPFAKEGQEISALL.RR.KAP.......DEEMQPLIDS.IQAQA.KEQA.---....LDPVV.............ASTDVFMTAVC...WVGSKSLSHVL.A.CID.R..TKGR..LIDV...........gTAH......................................................PAARSQ...I....ISSIMNYWA.AHP...G...VAITIIEK.LLNYSILTPLSIVDWTLVass.........................psngTQG..GEA.L.G.R.S.H.I.FELVAN.TVAKVSGR.......---VRQLLTSPDA-----..........---.......--................................................................................----..----.-DADTRDK.E.VS...SMRDLFAAIN.........D....ALASWASGS..................KDQL.ME..DG.DGSS--ERE.............................................AMIRRW..GQ..RW..LRVFQRLAAIEE-t............................................................................................
B4LSE0_DROVI/496-710                   ..............................................................FKYI.....NELLPGAKLAKHLLEAI.RS.KCA.......PELLGGLVES.TTELE.----.---....---DA.............LKINVLMQTFL...HLGCKSFTHIF.S.IFS.K..FQAV..LKML............ACN......................................................DANQMS...M....LSALFELWA.SNE...Q...VKLVVADK.LMKMQIVGAHVIVAWVFD................................PTL..KQE.L.V.K.M.Y.M.WELLNL.TVKYTKFH.......----RRDS----------..........---.......--................................................................................----..----.-----EQD.Q.DS...RLEALLLNIV.........Q....SCVQVLTKH..................QPAS.--..--.---QALEID.............................................YWFDWV..QG..RL..QQLLFN-------ymddvr.......................................................................................
G4VPN1_SCHMA/530-885                   .....................mkrnlkissednadeqvgvrsdsveklpfttapqvselspg----.....-----------------.--.---.......----------.-----.----.---....--VTN.............LAIELFYSAML...IAGHKTISHTF.A.FIK.K..YAAV..IRTL............TST......................................................VETQVE...A....LHVIQAVWA.NNP...Q...MIVIITEH.MCRVGLIDPEAVVRWAYSpimttlt.................ddtvnlnsANA..RPK.I.L.D.F.Y.V.WECLSR.TLVRVGRR.......VTRITNRLELAKETMEIN.........rR-Ss....pySTpdredadqggdgdsfsrtgvdsdsffkkpkds................isgrvkvsdrrklmagcelvsssddeaygggkDNVG..GRVA.RLEEARCE.A.VR...SQCAVITLLL.........H....RHARLTAEL..................ASEM.SGpsQN.HSFN----Tdspfflhept........................qpkslsdealrNIMFWL..KG..RL..VQVVLEHCD----qli..........................................................................................
N1RS65_FUSC4/531-775                   ..............................................................FKFQ.....NSETPFSKEGQEIASLL.RR.KAP.......DEEFQPLFES.IQTQA.SEQS.---....LDPIV.............ASTDVFMTAVC...WVGSKSLSHVL.A.CID.R..TKGR..LLEA...........gNSS......................................................EAARAQ...I....ISAVMSYWH.AHP...G...VALSIIEK.LLNYSILTPFTVVDWALVast.........................pangTDG..GDS.L.T.E.P.H.I.FELVFN.TIFKVTRR.......---SRDVV-AAP------..........---.......--................................................................................----..----.ETDETRIK.E.IK...STRDLFRAMN.........D....ALVSWAGGS..................KDEL.ME..GG.DGS--SDRE.............................................AMIRRW..GQ..RW..LRVFKRMGAIEE-a............................................................................................
F7HCL0_CALJA/418-693                   ..............................................................YKYGd..esSNSLPGHSVALCLAVAF.KS.KAT.......NDEIFSILKD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.T.R.L.F.V.WEILHS.TIRKMNKH.......VLKIQKELEEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGALE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TSVLT----.............................................PWYKNC..IE..RL..QQIFLQHHQII--qq...........................................................................................
A0CRM1_PARTE/469-689                   ..........................................................dieq----.....------HSLAEKINSYL.QQ.KLN.......GVDMLEQLKQ.ITNPN.PD--.---....-----.............AVIQTFIECLF...QCISKSITHLN.V.LSK.R..YLSF..LLQPn..........iIKP......................................................EKLGEI...M....LNTIFRMWN.HSV...F...HLKVYLKE.FLNLEVISNLQVVNWLNDl..............................iKQK..PEV.F.K.I.Y.N.V.LIAIND.VFRKQTKL.......-DQVQDCTYESVKEINTIlt.....kmiD--.......-Qeqdvviqssle..........................................................niqlqiliafkQTNG..TQLE.KLLKEIK-.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------snnvkqivm....................................................................................
W5J8I3_ANODA/6-291                     ...........................................................rct----.....--SLPGTATAHKLVVAI.RK.KCN.......ASEVLTELND.LPNPR.EGSE.ADM....TESTFn...........pLKIDVFVQTLL...NLGSKSFSHTF.A.AIS.K..FHAV..FKAL............AET......................................................EEAQIC...I....LHNMFELWV.DHQ...Q...MMVVIVDK.LLKVQIVECSAVATWVFS................................KEM..VGE.F.T.K.M.Y.L.WEILHL.TIKKMNQH.......VTKLSREMNEAKDKLARTae.....sssS--.......-Eseeegaggtsnt........................................................qkrrknadgtaeKPTE..EQVE.RMEEKLEA.A.YV...DQKRLFLIIF.........Q....RFIMILSEH..................LVKC.DT..DG.REYNT----.............................................DWYRWT..VG..RL..QQVFMMHHEQVQK.............................................................................................
G3H7F1_CRIGR/276-551                   ..............................................................YKYGd..esSNSLPGHSVALCLSVAF.KS.KAT.......NDEIFSILKD.VPNPN.QDDD.NDE....G-FSFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................NEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.T.R.L.F.V.WEILHS.TIRKMNKH.......VLKIQKELEEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGALE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TSILT----.............................................PWYKNC..IE..RL..QQIFLQHHQII--qq...........................................................................................
Q1K7E2_NEUCR/533-786                   ..............................................................FKFA.....DDKTPFAAEGKEIAALL.RR.KAP.......EEEIEPVIER.IHSLA.LDNN.---....LDPLV.............ASTDVFVTSVL...HVGSKSLSHVL.A.AIE.R..TKER..LTDA...........gATS......................................................EAARTQ...I....ISSVMEYWS.AHP...G...VAIAIIEK.LLNYSILTPQAVINWAITty............................agATR..GEA.L.A.K.G.F.V.YEMVFN.TVVKVTSR.......---LRQVLQKA-------..........---.......--................................................................................--TL..PEAM.IDDETIEA.E.IN...GMRSLFRAIE.........D....ALFAWASGSkd..............emLEAS.DG..LG.EGDGTSETE.............................................KLVKRW..GE..RW..LRVFKRRAAIEE-a............................................................................................
A0A074SCM4_9HOMO/536-816               ..............................................................YAYE.....NPDHPHYQEAAELLTMI.KD.RAK.......ADEVAAHCLK.LPRSV.----.---....-----.............PIQHMVMQSLL...HVGSRSFSHFL.N.AVE.R..YLSL..LRGE............SGSgslr..............................................geknAEKARP...I....LCAAGEYWA.NNQ...Q...MIGIVFDK.LMQYQIIDPSDVIEYAFEs.............................giKEG..ETP.D.L.S.S.E.R.WLLVQA.ALNKANGR.......VVGAKRKVVTLNKDEEER..........RARa....iaNAggigmdvd...............................................................vdaqpaepdMPTS..QSLV.SAQKALET.L.TK...EQKKVFQSAI.........T....GFINALTKA.................gVPAL.AP..VG.TWGRA----.............................................EWSAWE..TW..CW..YRQFCRAVS----stht.........................................................................................
M0SWM8_MUSAM/81-421                    ..............................................................FKYN.....SEEDHGYTLSKEFREMV.RG.RKT.......AGEITSWVEE.--NII.QIHG.S--....----K.............FAIEVVIQTLL...DIGSKSFTHLI.T.VLE.R..YGQV..IAKL............CTD......................................................QNMQVL...L....IDEVSSHWK.NNT...Q...MTAIAIDR.MMGYRIISNLAIVSWVFS................................LSN..IEQ.F.H.V.SdR.P.WEILRN.AINKTYNR.......IADLRKEIQTLKKSVLLAed.....vavK-A......lKEfeaaetrlevvdgqpvqae..........................................kpgrlkrlkgyaekakddeIAAR..EALE.AKDALLAR.A.LE...ENKSLFVSLY.........K....SFANVLTERl...............ppV---.--..--.---------.............................................------..--..--..-------------sadgafpklrdeedidsmaidleepstmemdhdnrrkddrngekvthrysikeqdqwclctlgyvkafsrqyatev.................
A0A066WJ86_9BASI/636-951               ..............................................................FTYE.....DPNQTWHVKATELVNSF.RA.KAS.......ADVVLANLES.FKREI.IAPD.DVT...mTDTDAptvat..eaqaeiMIRDVAVQAVL...SVGSRSFSHFL.N.VVE.R..YHAL..LRNL............STS......................................................PEMRIH...I....LGAVARFWR.RSP...Q...WILIVADK.LLQYRILEPSDIVKYVFDpaaskl...................pvdglgqNEE..ARD.W.S.S.F.V.W.WDLLRN.TIEKINGR.......VNQLQARVEALEAEEAARqem....aeaE--.......-Aaaapskkaneeeeapa................................................ivfptsvavpvpedpaKEKK..DTLQ.DRRVALEA.V.MT...EQRKVLSALI.........N....GFAEAMPAN..................----.PT..DA.VDEP-----.............................................DWNQYW..LT..GW..SKELLRRFHTQF-g............................................................................................
NCBP1_ORYSJ/483-829                    ......................................................fryhsdeg----.....KESTDGHRLSKELVAMV.RG.RKT.......QGDIISWVDE.KIIPV.--NG.---....---AK.............FALDVVSQTLL...DIGSKSFTHLI.T.VLE.R..YGQI..ISKL............CPN......................................................EEMQLL...L....MDEVSAYWK.NST...Q...MIAIAIDR.MMGYRLLSNLAIVKWVFS................................PAN..VDQ.F.H.V.SdR.P.WEILRN.AVSKTYNR.......IFDLRKEIQTLRKGLQAAke......asE--.......-Kaareleeaksiieivdgqpvp......................................senpgrlrrlqaradkakegeVTTE..ESLE.AKEALLAR.G.LE...ESKELLRLLF.........K....SFVEVLTERlppisad...gdvpnlraG---.--..--.--------Dpnvnssardpeattmeidneng.gdndsqlngqnkkishnvgeleQWCL-C..TL..GY..LKSFSRQYATE--i............................................................................................
G0SE05_CHATD/536-786                   ..............................................................FKFA.....NDETPFAPEGREIASLL.KR.KAA.......DEEIETYIQR.IQSQA.VDRD.---....MDALV.............ASTDVFVTCVL...HIGNKSLSHVL.A.AIE.R..TKDR..LADA...........gAAS......................................................DAARAQ...I....ITATMAYWS.AHP...G...VAITIIEK.LLNYSILTPAAVLEWVLRgr............................vaETR..GRV.L.G.T.A.Y.M.YELVAN.TVNKVTSR.......VRGLAFKVP---------..........---.......--................................................................................-TTP..EEEE.EDAKTRET.E.VA...RMRALFTEIE.........E....ALAPWASSSa................rEEQM.EE..DG.K---NEEDE.............................................RMVRRW..AD..RW..LRVFRRRAAIEE-t............................................................................................
G2XE50_VERDV/537-781                   ..............................................................FKFS.....DETTPFSAEGRELAALL.KR.KVP.......DEDFQPVLDR.IHAAA.TEHS.---....LDALV.............TSTDVFVTAVC...WVGSKSLSHVL.A.CIE.R..VKDR..LLDI...........gAAS......................................................EAARAQ...I....ITAVMAYWR.AQP...G...VAISIIEK.LLNYSILTPLSVIEWSLVyn............................hsERE..GDA.L.A.E.A.H.V.FELVSN.TVTKVTGR.......---VRQIMTAPELD----..........---.......--................................................................................----..---A.DAEASKEL.D.KK...AMRDLFSSLK.........D....ALSSWKAGI.................kDEML.DE..PD.SEERK----.............................................AHLQRW..GA..RW..LRVFERKSAIEE-a............................................................................................
M0YQX5_HORVD/83-429                    ......................................................fryhtdes----.....KESTEGHRLSKELVSMV.RG.RKT.......TRDIILWVEE.QIVPA.NGA-.---....----K.............FAVDVVSQTLL...DIGSKSFTHLI.T.VLE.R..YGQI..ISKL............CPD......................................................EEMQLL...L....MDEVSAYWK.NST...Q...MSAIAIDR.MMGYRLISNLAIVKWVFS................................SAN..VDQ.F.H.V.SdR.P.WEILRN.TVSKTYNR.......ISDLRKEIQTLRKSIQVA.........kE-Asa..kaiKEleeakstleivegqpvpse..........................................rpgrlrrlqgfadkakeeeVTIE..ESLE.AKEALLAR.G.LE...EGKELLRLLF.........K....SFVDVLTER..................LPPV.SA..DG.DVPNLRAGDpnvtfpvsdpeaatmeidneng.adnnsqvdcgntkagynigeleQWCL-C..TL..GY..LKSFSRQYATE--i............................................................................................
W5MTK1_LEPOC/491-771                   .............................................................iYKYMd..esSSSLPGYPMAMIISNAI.KN.HST.......NDEILALLKD.VPNPN.QEED.DDE....GDSFN............pLKIDAFLQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..LKNL............TDS......................................................DEGKLH...I....LRVVYDAWK.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................PDM..AHD.F.T.R.F.Y.V.WEILHS.TIRKMNKH.......VQKIQKELEEAKEKLEKQh.......rrK-Ds....gdEDefekn......................................................................sdeedGQLE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..GG.VDFNT----.............................................PWYKNC..IE..RL..QQIFLMHHVTI--qq...........................................................................................
H2YUE8_CIOSA/1-163                     ..............................................................----.....-----------------.--.---.......----------.-----.----.---....-----.............-----------...-----------.-.---.-..----..----............---......................................................------...-....---------.---...-...MMGVLVDK.MIRMQVVDCASVAKWIFS................................PNM..ADD.F.T.R.L.Y.V.WEIMHS.TIRKMNKH.......VIKIEAELGEMRSKAQVS.........eK-Ks....edEEddlmn......................................................................tynifAPNQ..DDLQ.RMQDQLET.A.NG...EQKKLFLIIF.........Q....RFIMILSDH..................LVRC.DA..GH.TNFNT----.............................................PWYRNA..IQ..RL..QEIFLLHKDTV--kk...........................................................................................
E1Z775_CHLVA/534-793                   .........................................................dtegh----.....--------AAAQMLALV.RG.KAT.......PEELDAWMAQ.QGLEA.QLGG.--P....L----.............GVLRCMARCLL...VAGAKSYTHMV.I.ALE.R..YYGP..LKNAv..........dTAG......................................................LEGEAA...L....VGVANSVWR.ASP...Q...RAAMAVDR.LMTLRLVSAEAIVGWVFGse............................gvTAL..GDE.S.L.S.G.A.A.WEILYN.AINKTIAR.......VQDAREDLTATEAAVAQL..........QARvd...alMTagemaa....................................................................daasqlDEAV..QSLE.EKRAYVAE.T.RE...QQECAFLQVM.........R....CFVSVLSLG..................----.--..--.---------.............................................------..--..--..-------------hgsamgnamdtgadeatrcktlcwqr...................................................................
X6R941_HUMAN/1-124                     ............................................................xl----.....-----------------.--.---.......----------.-----.----.---....-----.............-----------...-----------.-.---.-..----..----............---......................................................------...-....---------.---...-...--------.------------------................................---..---.-.-.-.-.F.V.WEILHS.TIRKMNKH.......VLKIQKELEEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGVLE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TSVLT----.............................................PWYKNC..IE..RL..QQIFLQ-------vcge.........................................................................................
C6HGR2_AJECH/477-712                   ..............................................................FKYA.....LESTPYAAEAQEIMQLI.RK.KAP.......DAEIEPHILA.IQHAA.ANQT.-DT....ADSLI.............PSTDAFVTSIC...YVGSKSLSHVL.S.CIE.R..SKER..LLSI...........gPQS......................................................PAARRQ...I....ITSVLSYWA.DQP...G...IGVNIIDK.LLNYTILTPLSVIEWALVd..............................hIEG..GAA.L.A.K.A.H.V.YEMVAA.TMGKVTNR.......---IRQIVVARVQR----..........---.......--................................................................................GIVE..PQLS.VIDETLRR.E.RG...EVQVMFEVIE.........G....ALEGVISGS.................gMEDV.--..--.---------.............................................------..--..--..-------------dggvgrgggeeamara.............................................................................
Q2U9I0_ASPOR/529-782                   ..............................................................FKYS.....LDTTPYANEGTEIMQLI.RK.KAT.......DDDILPIINA.IEEQA.RAMG.V--....EDPML.............PSTDAFVTAIC...FVGSKSLSHVL.S.CIE.R..NKER..LLAI...........gPKS......................................................TRARRQ...I....ITSVMEYWT.DQP...G...IGINIIDK.LLNYTILTPLSVIEWALVd..............................kLEA..GTI.L.A.R.T.H.V.FEMISA.TVGKVTNR.......---LRQIV----AARTQP..........---.......--................................................................................GLYE..PQLS.VLDETLNR.E.KA...DMQALFKVIE.........D....SIMSVAEGH..................NDEL.ME..RG.DGSGELPED.............................................EIIRQW..GC..RW..LRAFRRKAGVEE-s............................................................................................
M2ML26_BAUCO/552-803                   ..............................................................YKYN.....SDVTPYAEAGREVLHLL.KK.KAP.......ETDIQAALNA.VHEQA.RGHG.V--....TDPLV.............PSTDIYMTAIL...SIGSKSLSHVL.S.TID.R..CKER..LLAV...........gSQS......................................................EMARRQ...I....ISSVVEFWA.EHP...G...TAVNIVDK.LLNYTIVTPMSVIQWALQd..............................hIDR..GRA.L.A.N.S.Q.I.YELISI.TMFKVTNR.......---VRQVV----RERNNM..........---.......--................................................................................ALPF..EQRQ.QIDEALPR.E.RQ...GMRDLFAAIE.........D....AVAGIAAGA..................QDEM.IE..RY.DNG--SSEE.............................................NAIKTW..GQ..RW..ARVWRRKAAVEE-a............................................................................................
A0A0M0TWC4_9PEZI/535-790               ..............................................................FKFA.....NDDTPFAAEGREIAALL.KR.KAP.......DEEIDPVIQR.IQSLA.IDRE.---....IDALV.............ASTDVFVTCVL...HVGSKSLSHVL.A.AIE.R..TKDR..LADA...........gAAS......................................................DAARTQ...I....ISAVMAYWS.AHP...G...VAISIIEK.LLNYSILTPATVISWALVgr............................agSTR..GEA.L.A.A.A.H.I.YELVFN.TVIKVTGR.......VRQIALKPDHRP------..........---.......--................................................................................QPNA..MATD.ENTTTRDL.E.TR...AMRSLFAAIE.........D....ALTSWATGS..................KDEM.IE..TS.DGDGGSESE.............................................TLVRRW..GE..RW..LRVFKRRAAIEE-a............................................................................................
H3DUI8_PRIPA/67-343                    .................................................kdqvaenheefer----.....---------ARHFQALF.QE.KLA.......ADAMIEELRV.-EEQT.----.GEG....PEFDS.............RAFSVFFAVLL...KLASKSFSHNF.A.ALT.R..YHKT..LKHV...........vANS......................................................PTMQQT...L....LSTLYGCWR.NNT...Q...MMLILIDK.LLKMQILDCSVVVAWIFD...............................gEDA..QQE.H.S.R.Q.W.L.WEMLNN.SLGKLGKH.......VAKCKKDLETLKEAKQRK.........eKARk.....eKEaeaqgegeg.............................................................kddekmeegdDEAA..AAEM.DGEAEVEA.L.AD...AQKRIFLDVL.........M....KFASALTTR..................LQEQ.-G..DG.AEKS-----.............................................LWYTFV..QG..RM..RHVFLAH------epvir........................................................................................
C5FRD0_ARTOC/547-798                   ......................................................dtpdfkfs----.....------QEKGQELMKLI.RQ.KSS.......DEEIETVITS.IEEQA.KTHG.--L....VDPLI.............ASTDVYMTSIC...YVGSKSLSHFL.S.CIE.R..CKDR..LLAI...........gPKS......................................................DAARRQ...I....INSVMEYWA.DQP...G...IGINIIDK.LLNYTILTPLSVLEWALVd..............................nLAA..GST.L.A.K.P.H.I.FEMIAA.TMRKVTNR.......---MRQIVAARTQP----..........---.......--................................................................................TLYE..PQLS.ILEETLKK.E.KA...EMLSMFQLIE.........D....TLVPVAGGYsd..............gmMERT.ED..DA.LQ-----PE............................................nVMIQQW..GS..RW..LNVFRRRVAVE--ra...........................................................................................
A0A0L0CL87_LUCCU/488-771               ..............................................................YKYAs..eeAASLAGTQVAHQLVVAI.RQ.KCT.......PEEVINILKE.LPNSG.ENAD.QEM....SETSFn...........pLKIDVFVQTLL...NLGSKSFSHSF.A.AIS.K..FHLV..FKAL............AES......................................................EEAQIC...I....LHNVFELWQ.NHQ...Q...MMVVIIDK.LLKTQIVDCSAVATWIFS................................KEM..TGE.F.T.K.M.Y.L.WEILHL.TIKKMNKH.......VIKLNNELTDAKDKLAKAds......ssS--.......-Dsedeaapk...............................................................rkkpvvvvdKPTE..EMVE.RMEEKLEA.A.NV...DQKRLFLIVF.........Q....RFIMILSEH..................LVRS.DT..DG.RDPDT----.............................................DWYRWT..IG..RL..QQVFLMHHEQVQK.............................................................................................
Q59QD1_CANAL/619-796                   ..............................................................FNFT.....NSELPFHETASKVYDFIlTH.WKS.......NTDFNELYKS.VLESI.TAPN.---....--NER.............FAINLIIQTYA...YIGSRSIYSVV.S.ILS.R..DINK..LKFL............SGApidyvgdear.................................fedlhfteeekQNRQNW...I....IEAVFRIWI.HQP...Q...VVFLILEY.LIEFGIIDPKYILVKALE................................S--..NLI.I.D.N.V.S.C.MESINR.ILSKAES-.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------k............................................................................................
G6CZS3_DANPL/487-767                   ..............................................................YKYAm..egAASLPGTEAAHQLVVCV.RN.KCT.......PEEALNVLRE.LPNPL.REGE.ANA....AHTAYn...........pLKIDVFVQTLL...NLGSKSISHSF.A.AIS.K..FHYV..FKIL............AES......................................................EEAQIC...V....LRNVWELWQ.RHS...Q...MVCVLVDK.MLKTQIVECSAVATWLFS................................KEM..APY.F.T.H.G.Y.L.WEILHL.TIDKMNKH.......VSKLSKELQEAREALARAds.....sssE--.......-Sedesgs...................................................................kkkkdqdKPTE..EAVE.RMEERLEM.A.HT...DQKRLFLIVF.........Q....RFIMILSEH..................LVRA.DT..DA.RDPHT----.............................................HWYRAT..LA..RL..RQVFLLHHEQVQK.............................................................................................
NCBP1_DICDI/524-754                    ....................................................fkflnadnpe----.....EESKELIAESHKLLLSF.KT.KEP.......LENIISHVAN.IPSHI.----.---....-----.............NIVELLTKCIL...QIGSTSFSHLT.Y.AIE.R..YITL..FKTV............LKS......................................................QDDRQE...C....IRSIFEFWK.LSH...Q...HIVIVVDK.FVTFKIIYPIDTVTWFMK................................PEN.iDRF.I.T.E.P.F.T.WECLHN.SIQKTIII.......IQTLTLDLEENQSQ----..........---.......--................................................................................----..----.EKEFKLNT.S.IS...EQQLLLAELV.........K....GLGSILSSE..................KYQL.GA..S-.---------.............................................------..--..--..-------------skllisgqlksiirkyfnqmk........................................................................
M1VV04_CLAP2/553-807                   ..............................................................FKYR.....DPDTPFSKEGQELAALL.KR.KAP.......DEDFQSVIDS.IQAQA.TEQA.---....LDPIV.............TSTDVFMTAVC...WAGSKSLSHVL.A.CID.R..TKTR..LSDA...........aSSS......................................................PAARAQ...V....ISSVMNYWS.AHP...G...IALSIIEK.LLNYSILTPLSIVDWTLGast.........................pingTQG..GAA.L.G.Q.A.H.M.YELITN.TVTKVSGR.......---VRLLLTSSASASA--..........---.......--................................................................................---S..ADGS.DEEQTREK.E.IG...GMRDLFRAIN.........D....ALASWASGS..................KDQL.ME..EG.DGS--SDRE.............................................AMIRRW..GQ..RW..QRVFQRLAAIEE-t............................................................................................
L1IJA4_GUITH/524-768                   ......................................mrelvtevqdmvslsrreecsvle----.....-----------------.--.---.......--------EF.VANSL.SDLT.SET....--PTA.............DRAKILVAAMV...YEGRESFSHVL.G.IVG.R..YLKV..LRSC............VEG......................................................EQEQFA...C....ATAISHTWK.KNP...Q...CFVMVMDK.FVAMKLISPINLAKWLLS................................SFE..YVE.G.R.G.D.A.V.WELMIM.AIRKPVEL.......VRTVRRDLSEAQKELDKL..........KQTs.....dEEde............................................................................emIQKA..DRIS.RIKNVLRS.S.TR...DQDDILIAVI.........R....GLVLLANEC..................YERK.EE..KE.KEEDNNET-.............................................------..--..--..-------------eesgnkkpkl...................................................................................
E6ZW71_SPORE/641-959                   ..............................................................FTYA.....DESHAYGAHAARLINSI.KA.KAS.......AEVILADFET.FKASI.VDSA.STL....PTDGSdgmvcd.qqqadvVVRDLTIQCVL...QVGSRSFSHFL.N.IVE.R..YHAL..LRQL............SRS......................................................ARMRAA...I....LAGAVRFWT.RSQ...Q...WIHIVVDK.LLQYRIVEPADVVEFIFSpptdep....................atirsgAEA..QEG.W.V.G.F.N.T.WTLLRL.TLEKVNGR.......VDQLRKRLEEIERHEADEre......rkD--.......-Aaaaaglpledddespaaaqq.......................................eamplfptsatlpirptepsaQQQH..LSSA.DALANLDA.I.KS...EQRKVLITAL.........R....GFKTHLAAL..................E---.--..--.-HDQH----.............................................AWTHWW..TM..GW..YRQLVRCFNVQL-m............................................................................................
A8PGT3_COPC7/535-854                   ..............................................................FEYD.....-ASHPHHDAAEAILNLF.RG.RAK.......AEDVISHLDE.LRTKL.ESSE.EGH....VNVDT.............LVRSIAVQSLL...QIGSRSFSHLL.N.AIE.R..YLPL..LRNL...........aG-Asapgattt.....................................gatatagsnPEARTE...I....LSAAAAFWK.HNR...Q...MVGIVFDK.LMQYQIVDPTDIVAWTFLngas.......................vgqlsELG..GPM.N.L.S.A.F.E.WDLLRA.AIDKANGR.......VVAARRRVMQLRKEADERra......lsKAKae...ngNDmdmdv.....................................................................enkeeeKDDD..PQLV.TALKAYSS.L.TK...EQRMVLSRTL.........E....GFVESLAPA..................--PT.AR..NP.NPHARTVIDeaawen................................raswgrdEWNAWE..TW..GW..YKQFCRAYAPYL-r............................................................................................
C9S8W0_VERA1/460-704                   ..............................................................FKFS.....DETTPFSAEGRELAALL.KR.KVP.......DEEFQPVLDR.IHAAA.TEHS.---....LDALV.............TSTDVFVTAVC...WVGSKSLSHVL.A.CIE.R..VKDR..LLDI...........gAAS......................................................EAARAQ...I....ITAVMAYWR.AQP...G...VAISIIEK.LLNYSILTPLSVIEWSLVyn............................hsERE..GDA.L.A.E.A.H.V.FELVSN.TVTKVTGR.......---VRQIMTAPELD----..........---.......--................................................................................----..---A.DAEASKEL.D.KK...AMRDLFTSLK.........D....ALSSWKAGI.................kDEML.DE..PN.SEERK----.............................................AHLQRW..GA..RW..LRVFERKSAIEE-a............................................................................................
H2SJV6_TAKRU/485-765                   ..............................................................YKYGe..esSSSLPGYPVAITMGNAI.KN.RAT.......NEEILAILKE.LPNPN.QDDD.DDE...gETFNP.............LKVDVFLQTLL...SVASKSFSHSF.S.ALG.K..FHEI..LKTL............TES......................................................DEGKLH...I....LKVVYDVWR.NHP...Q...MIAVLVDK.MIRTQITDCAAVANWLFS................................QDM..AHE.F.T.R.L.Y.I.WEILHS.TIRKMDKH.......VQKIQQELEEAKDKLEKQq........hK-Rrd...sgDDedmdk.....................................................................asedeeGQLE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMLLTEH..................LVRC.ET..GS.VDIST----.............................................PWYKNC..IE..RL..QQIFLMHHVTI--qq...........................................................................................
A0A0B2UWP0_TOXCA/547-823               ..............................................................YNFE.....NEDAPTAALAVRVSELI.RS.KTT.......ADELIETLTG.SEVEG.LSD-.---....----E.............LVLSAFVAVLL...NLSQKTISHSF.A.ALT.R..YFKT..LKQL............AGG......................................................EDSQMT...V....LRTLYMVWK.HNQ...Q...MMSVIANK.MVTMTIIDATAVVAWIFS................................DEM..KLE.F.E.R.M.W.T.WELLCD.TVEHVVGH.......LRRCRLKLNKLQKSRTKK.........dKEKqe..vsrRDtemdvdkdi..............................................................sedeskgedGPNE..DDVS.LLANEVED.L.RE...YLQNLLLDVL.........H....KFTVKLTEH..................IVIC.DS..KG.EDINT----.............................................SWYKYF..TA..RF..RGFFLKHWKE---lfe..........................................................................................
B8MTN8_TALSN/547-801                   ..............................................................FKYT.....LETTPYCKQGSELMQLI.RK.KAA.......DEEIEPVIAE.IETQA.KDHG.V--....EDPMV.............PSTDAFVTSIC...YVGSKSLSHVL.S.CIE.R..NKER..LLAI...........gPRS......................................................APARRQ...I....ITSVMEYWV.DQP...G...IAINIIDK.LLNYTILTPLSVIEWALLd..............................hIDA..GKI.L.A.K.A.H.I.YEMLSA.TVGKVTNR.......---IRQIVAARTQL----..........---.......--................................................................................GLYE..PQLS.VLDETLNR.E.KA...DMQTLFTLIE.........D....SITPVAAGS.................nDELM.ER..SE.DDPSTRDEN.............................................EIIRRW..AV..RW..RRVFQRKAAVE--aa...........................................................................................
A0A085NGJ1_9BILA/2175-2430             ...................................................kfsmegaepsg----.....--------LALELQEAI.KA.RKE.......PEKVLSILLQ.QGEGS.-ENG.DGP....VESVE.............YKTEVVISQLL...VIGQRTMSQTL.S.LLT.R..FAPV..LDQL...........vKNN......................................................ENAQLS...L....LNAVRETWP.TFE...Q...RIGVVVDK.LFRLEIVPAPVIVKWVFS................................KEM..KNE.F.L.K.Q.Y.V.WEIVSS.TFDKLCIN.......FCVLSDKLKAVMGEDMSP..........---.......EE................................................................................SGDP..AQAL.ELQEGLEA.C.LG...AQKAFIFTLF.........Q....HFIITLSEH..................LLTA.DE..SG.DRVS-----.............................................DWYRIV..FG..RM..CQFFTTQ------cvevqr.......................................................................................
A0A0M8MQP6_9BASI/617-925               ..............................................................YLYG.....DPSHAHHALAMQFFNSL.KA.KAS.......VQVVQADLQS.FQQRI.LAPP.SDV....PSLDEthvet..paeaeqVVRDMAVQTLL...NAGSRSFSHLL.N.VIE.R..YHEL..LRAL............SQT......................................................PEARVS...I....LASTAAFWT.RSP...Q...WVLIVCDK.LLQYRIVEPVDVVTFVFStpeateaddeag........safalatpsavwGST..SRD.W.S.S.F.H.W.WAMLRL.TVDKVLGR.......VGQLARRVEELKRASSTE.........tTASa....dpTShsvss......................................................................sdappRAAA..SSVD.EAQVHLDA.I.QL...EQRKVLVTIL.........T....QMVALLHAR.................gLPTL.DA..HA.SAD------.............................................AWQTWW..LH..EW..YRAFLGVYAPVL-a............................................................................................
A0A0F8X6W2_9EURO/534-787               ..............................................................FKYA.....LETTPYANEGKEIMQLI.RK.KAT.......DEEIQPFITA.IEEQA.KEHG.VE-....-DLLL.............PSTDAFVTAIC...FVGSKSLSHVL.S.CIE.R..NKER..LLAI...........gPQS......................................................PAARRQ...I....ITSVMEYWV.DQP...G...IGINIIDK.LLNYTILTPLSVIEWALVd..............................kLDA..GTI.L.A.K.A.P.I.FEMISA.TVGKVTNR.......---LRQIV----AARTQP..........---.......--................................................................................GLYE..PQLS.VLDETLTR.E.KA...DMHALFRIIE.........D....SVVTVAGGSnd..............qlMERG.DG..SG.DLPED----.............................................EIIRQW..GQ..RW..LRVFRRKAAVEE-s............................................................................................
W6QLA4_PENRO/531-784                   ..............................................................FKYS.....SEMAPYSKEGQELMQLI.RK.KAS.......DEEIQPVITA.IEDQA.KSQG.VD-....-DPKI.............PSTDAFVTSLC...FVGSKSLSHVL.S.CIE.R..SKDR..LLAI...........gTES......................................................PHARCQ...I....ITSVMEYWV.DQP...G...IAINIIDK.LLNYTILSPLSVLEWALSe..............................sVAA..GTI.L.A.K.P.H.I.FEMISA.TVGKVTNR.......---MRQIV----AARVQP..........---.......--................................................................................GLYE..PQLS.VIDETLAS.E.RT...DMQALFKYIE.........D....SIVSIAAGS..................NDEL.ME..RG.DGSGTLPED.............................................AIIRQW..GR..RW..LRVFRRKAAVEE-s............................................................................................
A0A087XF49_POEFO/485-769               ..............................................................FKYGd..esGTSLPGYPVSITVSNAI.KN.RAS.......NEEILAILKE.VPNPN.QEDD.DDE...gESFNP.............LKIDVFLQTLL...HLAAKSFSHSF.S.ALG.K..FHEI..LKNL............TES......................................................DDGKLH...I....LKVVYEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWLFS................................QDM..AHE.F.T.R.L.F.I.WEILHS.TIRKMNKH.......VQKIQNELEEAKDKLEKQ.........qH-KrvaprdsGDdedmek...................................................................nseedeeGQLE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMLLTEH..................LVRC.ET..GS.VDIST----.............................................PWYKNC..IE..RL..QQIFLMHHGTI--qq...........................................................................................
V4U5T8_9ROSI/271-616                   ..............................................................FKYSme.dgRERSEEHALSAELTNKV.KG.RQT.......AREIIVWVEE.SVYPI.HGLG.---....-----.............VTIKVVVQTLL...DIGSKSFTHLI.T.VLE.R..YGQV..ISKI............CPD......................................................HDKQLM...L....IDEVSLFWK.NNT...Q...NAAIAIDR.MMGYRLISNLAIVRWVFS................................PEN..IDQ.F.H.A.S.DrP.WEVLRN.AVSKTYNR.......ICDLRKEIISLKKGVTLAee.....aaaKA-.......-Kaeleaaesklslvdgepvlg........................................gnparlsrlklhaekakneeISAK..ESLE.AKEALFAR.A.VE...ENEALYLSLY.........R....NFSNVLMERl...............pdASR-.--..--.---------.............................................------..--..--..-------------agtlqdlksthadamavdleepsameldnedgrpkksqsnggssgnvynigekeqwclstlgyvkafsrqyasei..................
NCBP1_ARATH/484-814                    .....................................................fmysleegk----.....-EKTEEQQLSAELSRKV.KE.KQT.......ARDMIVWIEE.TIYPV.HGF-.---....----E.............VTLTIVVQTLL...DIGSKSFTHLV.T.VLE.R..YGQV..FSKL............CPD......................................................NDKQVM...L....LSQVSTYWK.NNV...Q...MTAVAIDR.MMGYRLVSNQAIVRWVFS................................PEN..VDQ.F.H.V.S.D.QpWEILGN.ALNKTYNR.......ISDLRKDISNITKNVLVA.........eKASan...arVEleaaesklslvegepvlge..........................................npakmkrlkstvektgeaeLSLR..ESLE.AKEALLNR.A.LS...ETEVLLLLLF.........Q....SFLGVLKERlpdptk......vrsvqdL---.KS..IG.--------Aeddkpsamdvdse..................ngnpkkscevgereQWCLST..L-..GY..LTAFTRQYA----sei..........................................................................................
NCBP1_DROSE/488-770                    ..............................................................YKYAn..eeAASLPGTTVAHQLVVAI.RQ.KCT.......PEEVVNILKD.IPNSG.YSGE.EMS...dGSFNA.............LKIDVFVQTLL...NLGSKSFSHSF.A.AIS.K..FHSV..FRAL............AET......................................................EEAQIC...I....LHNIFELWS.SHQ...Q...MMVVLIDK.LLKLQIVDCSAVATWIFS................................KEM..TGE.F.T.K.L.Y.L.WEILHL.TIKKMNKH.......VIKLNSELSEAKDKLAKAds......ssS--.......-Dseddsshk...............................................................rkkpithadKPSE..EVVE.RMEEKLEA.A.NV...NQKRLFLIVF.........Q....RFIMILSEH..................LLRS.DT..DG.RDPDT----.............................................DWYRWT..IG..RL..QQVFLMHHEQVQK.............................................................................................
G3XXC7_ASPNA/548-801                   ..............................................................FKYS.....SDTTPYANEGREIMQLV.RK.KAS.......DEEIQPLINA.IEEQA.RSLG.V--....EDPLL.............PSTDAFVTAIC...FVGSKSLSHVL.S.CIE.R..NKER..LLAI...........gPQS......................................................AQARRQ...I....ITSVMEYWV.DQP...G...VGINIIDK.LLNYTILTPLSVIEWALVd..............................kLEA..GTV.L.A.K.S.H.V.FEMISA.TVGKVTNR.......---LRQIV----AARTQP..........---.......--................................................................................GLYE..PQLS.VLDETLSR.E.RV...DMQSLFRVIE.........D....SIVSVAGGSnd..............eqMERG.DG..SG.NLPED----.............................................EIIRQW..GQ..RW..LRVFRRKAGVEE-s............................................................................................
X6MHP4_RETFI/46-337                    .......................................lllhevismkqvdqmlnseiqgg----.....-----------------.--.---.......----------.----N.DSSS.SNS....TNQLFqvstt...erikiRQMQLLFACLL...HVGKSSCSHVV.T.FLK.M..YGSG..LLKSy..........mVCF......................................................ELSQMK...L....MSILLEYWY.KSC...F...RCEILCDK.LHAQNYISTQAIIKFIFLeenscqit...............sviyiyiyiSTY..TYIyM.Y.M.P.V.Y.WKILLN.SIDRTVKTavgmlrtVSRYQKDLKDLEKEMTADf........aD-Ada..iaaQQ................................................................................SMKQ..QQLE.GLIRRHNQ.T.LA...SIREIFFLLF.........S....EFKRVLTVL..................HQKI.QS..SS.DAVDSN---.............................................------..--..--..-------------dkssnsrsnknstqdaniskldvheie..................................................................
A0A0B2UIA8_9MICR/305-411               ..........................................................vncl----.....-----------------.MN.KIS.......KEEFEAKVLN.RDYSN.GDVK.DGV....-----.............ENKEFFFRNFC...YLGSPSISHFL.T.YLE.M..YKSY..FRL-............--E......................................................ADDQQL...F....IDVFLDVFK.SSE...S...FRRIVLEK.MVLFGIVQ----------................................---..---.-.-.-.-.-.-.------.--------.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------kdvvd........................................................................................
G1X9L4_ARTOA/544-790                   ..............................................................FKFE.....SDDIAFPEEGKQLLNLI.RQ.KAP.......NEEVDTLMNA.ITDAA.NNKG.--L....PDPSK.............YARDMYMTCIC...HIGAKSLSHVL.S.CIE.R..CKEK..LTQL...........gQES......................................................SQAQRQ...I....VGTVMRYWA.DQP...G...IGANVIDK.LLNYSILTPLSVIEWVVL................................DAG..GEV.L.P.R.G.H.A.WEMVNT.TTRKVVLR.......----TRNLASARGE----..........---.......--................................................................................DLPE..EQIA.TAEQQHEV.A.KA...EQAELFKVVM.........E....GLGRYEDGG..................VVVG.KE..GT.SGEDV----.............................................ELLKWW..AA..SW..LRALKRQRDIEE-a............................................................................................
E9E5T2_METAQ/604-848                   ...........................................................anr----.....NTDTPFAKEGQEISALL.RR.KAT.......DEEIQPLIDS.IQAQA.KEQA.---....LDPVV.............ASTDVFMTAVC...WVGSKSLSHVL.A.CID.R..TKGR..LIDV...........gSAH......................................................PAARSQ...I....ISSIMNYWA.AHP...G...VAITIIEK.LLNYSILTPLSIVDWTLVass.........................psngTQG..GEA.L.G.R.S.H.M.FELVAN.TVAKVSGR.......---VRQLLTSPDA-----..........---.......--................................................................................----..----.-DADTRDK.E.VS...SMRDLFAAIN.........D....ALASWASGT..................KDQL.ME..DG.DGSPE--RE.............................................AMIRRW..GQ..RW..LRVFQRLAAIEE-t............................................................................................
G1S4W7_NOMLE/485-760                   ..............................................................YKYGd..esSNSLPGHSVALCLAVAF.KS.KAT.......NDEIFSILKD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.T.R.L.F.V.WEILHS.TIRKMNKH.......VLKIQKELEEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGVLE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TSVLT----.............................................PWYKNC..IE..RL..QQIFLQHHQII--qq...........................................................................................
K3WAB2_PYTUL/691-934                   ................................nnqesgvtqitrnlyqavtaklkghppasa----.....-----------------.--.---.......------LQSW.IEEEI.ATLG.DID....R---R.............DVAEVVWTCIL...EAGAATFTHMR.L.LLE.K..YGHA..-ESL............FGG......................................................EDKELV...L....VKTVGFVWL.KSP...Q...HIGLILNM.MLRQEIIRATTIAKWIFT................................PDA..VQQ.Y.S.W.P.Y.V.WEILNE.TLAFVQAS.......IARKTQQL---ETQATAKs........gERR......dTD................................................................................ETEM..VDVV.AVEDARKA.L.QD...ELKQILILLF.........E....GFNRVISEH..................KSNC.DA..EG.ISYKD----.............................................NWFV--..--..--..-------------salaqmka.....................................................................................
A7AR12_BABBO/735-958                   ..............................lptnlfaedkmpdvemvddkdgqptvktwsrd----.....-----------------.--.---.......----------.-----.----.---....-----.............ELILIFWESVL...LFGNKSLTHLL.R.LIE.F..HGEV..LKNFi..........sE-Eqng................................................afeDSISFK...I....MVLTRETLK.TDT...K...KFELVIDN.LIREGILPPADVCRYVFR................................GYP..STE.F.F.S.N.H.A.FCLMQN.AFAFVRGN.......IESVKARMANEAI-----..........---.......--................................................................................----..-HNE.TLQTTLQS.R.RH...IMCNLTKLVM.........E....LTNNIL---..................----.--..--.---------.............................................------..--..--..-------------mqgvdrqqecvlssivrrllltrecdaemll..............................................................
A0A084QBE8_9HYPO/545-790               ..............................................................FKFS.....DPNTPFATEGQEIGALL.RK.KAP.......DEEFQPIIDR.IHAEA.TQRA.---....LDPYV.............ASTDVFMTAVC...WVGSKSLSHVL.A.CID.R..TKGR..LLDV...........gSTS......................................................EAARTQ...I....ISAVMAYWH.AHP...G...VALSITEK.LLNYSILTPISVIDWALAgnt.........................aasgTNG..GDS.L.G.Q.P.H.V.FELVAN.TIAKVTGR.......---VRQLLLSA-------..........---.......--................................................................................----..---D.ADAETRDK.E.VK...AMRDLFRATN.........D....ALASWAGGS..................KDEL.ME..QG.DGSS--ERE.............................................AMIRRW..GQ..RW..LRVFQRQAAIEE-a............................................................................................
J9ETZ7_WUCBA/3-75                      ............................................................ld----.....-----------------.--.---.......----------.-----.----.---....-----.............-----------...-----------.-.---.-..----..----............---......................................................------...-....---------.---...-...--------.------------------................................---..---.-.-.-.-.-.-.------.--------.......------------------..........---.......--................................................................................----..DDIE.VKKKELKE.L.QD...MLRNLFLNIL.........H....KLVVFLSEH..................LVKS.EM..TE.RNHDT----.............................................YWYRYM..MG..RF..KEMLLRYW-----celfe........................................................................................
X0K335_FUSOX/531-775                   ..............................................................FKFQ.....NSETPFSKEGQEIASLL.RR.KAP.......DEEFQPLFES.IQTQA.SEQS.---....LDPIV.............ASTDVFMTAVC...WVGSKSLSHVL.A.CID.R..TKGR..LLEA...........gNSS......................................................EAARAQ...I....ISAVMSYWH.AHP...G...VALSIIEK.LLNYSILTPFTVVDWALVast.........................pangTDG..GDS.L.T.E.P.H.I.FELVFN.TIFKVTRR.......---SRDVV-AAP------..........---.......--................................................................................----..----.ETDETRIK.E.IK...STRDLFRAMN.........D....ALVSWAGGS..................KDEL.ME..GG.DGS--SDRE.............................................AMIRRW..GQ..RW..LRVFKRMGAIEE-a............................................................................................
B4I3F9_DROSE/496-720                   ..............................................................FKFV.....DETLPGAILSKDLLEAM.RCpRAS.......PKIISEIIKS.STGIG.----.---....P---L.............LKINVFTQNCL...HLGSKSFSHTF.A.ILA.K..YQSV..FKDL...........vKGD......................................................WDGQIA...V....LNGVFDVWV.ASD...H...YKFVVAEK.LVKVFIIEPISIVTWIFG................................PSM..RKE.L.T.K.M.Y.I.WELLHS.AVRHLK-R.......---VQHDVEVVDVD----..........---.......--................................................................................----..----.----NPNA.C.DP...VVKSVLYTVV.........E....RLVKILCSA..................P--F.AD..EG.TEEH-----.............................................YWFQWV..LG..RL..EE-----------tlfiyaddfkv..................................................................................
A0A044SD50_ONCVO/526-809               ............................................................sy-DLN.....DDEHPDRDFAIILEKAF.RD.KIS.......ADEMIDLLRS.KTGNR.MDIN.---....-----.............SRLSIFFKVLL...YLARKTFSHNF.A.ALT.R..YYST..LKEF...........iGGR......................................................EDAQLT...I....LRTLYETWK.LNG...Q...MIIVLVTK.LLKMSLVDASAVVAWLFS................................DEM..KHE.F.E.R.L.W.I.WEILNR.ALEHVSGH.......VHRSRQAVENRKLKNERKds.....dheK--.......-Ddfdmea....................................................................dehhitDPNA..VELF.VKESEFAD.L.HE...CLKNLLLDVL.........H....AIFSSLIEYnglcfqk...faitlaehIVNS.ES..SG.RDFQN----.............................................NWYSYV..TG..RF..KNVFLKHWKD---lfe..........................................................................................
NCBP1_DROVI/551-753                    ............................................................gq----.....-----------------.--.---.......----------.-----.----.---....-----.............-----------...-----------.-.--S.K..FHVV..FRAL............AET......................................................EEAQIC...I....LHNIFELWS.SHQ...Q...MMVVLIDK.LLKLQIVDCSAVATWIFS................................KEM..TGE.F.T.K.M.Y.L.WEILHL.TIKKMNKH.......VIKLDTELDNAKEKLSKAds......ssS--.......-Dtdedtphk...............................................................rkkpithadKPSE..EVVE.RMEEKLEA.A.NV...NQKRLFLIVF.........Q....RFIMILSEH..................LLRS.DT..DG.RDPDT----.............................................DWYRWT..IG..RL..QQVFLMHHEQVQK.............................................................................................
A0A068RLR1_9FUNG/535-804               ..............................................................FAYQ.....SAEHPQHEAAKEVISTL.RA.KKS.......TDDVQALLDR.IKEQH.STDA.---....QEQER.............FMQELFTQCML...FVGSKSFSHVL.N.VVE.R..YLEV..LRCV............NSS......................................................PEARLR...T....VQIAAAFWK.DNT...Q...FLGIILDK.LLNYRVIDPASIITWVFE................................TQQ..ADS.A.Y.R.F.Y.A.WEILQN.TMSKVVAR.......VGQVRVKLEDAEKTHKEN..........EAKr....aqEEsnem.......................................................................aqaeaQQEL..DTLR.IIENSLNT.V.CR...EQKEVFMAAY.........Q....RSVQTLQDA..................LAPF.PP..HE.RDTQL----.............................................TWNYRW..IF..GW..YRESMRKYYKE--sg...........................................................................................
W1QCA3_OGAPD/671-916                   ..............................................................YLFN.....NEEHPYHELCHSIYTNI.QE.GES.......LQQFNDLIVL.LKEQI.AKES.SEH....PGAEEylig.....nidcYIVTLVIQSTC...IIGSRSLSVVE.SgALE.L..CGAK..LRKVlg.......lpaA-Egehedlend...................................qfpllkaeevAERQKW...L....IDGVLRLWN.NEP...R...IGYLILER.IKNKGFISATQLVDSFFA...............................nNES..LTM.I.S.Q.V.Y.A.SELFDR.MVTSSASE.......-AEAKDLLQT--------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------fyskiiehidllieklgddreemilgtveteesadqdtelr....................................................
A0A0D9Z790_9ORYZ/516-862               ......................................................fryhsdeg----.....KESTDGHRLSKELVAMV.RG.RKT.......QGDIISWVDE.KIIPV.--NG.---....---AK.............FALDVVSQTLL...DIGSKSFTHLI.T.VLE.R..YGQI..ISKL............CPN......................................................EEMQLL...L....MDEVSAYWK.NST...Q...MIAIAIDR.MMGYRLLSNLAIVKWVFS................................PAN..VDQ.F.H.V.SdR.P.WEILRN.AVSKTYNR.......IFDLRKEIQTLRKGLQAAke......asE--.......-Kaareleeaksiieivdgqpvp......................................senpgrlrrlqaradkakegeVTTE..ESLE.AKEALLAR.G.LE...ESKELLRLLF.........K....SFVEVLTERlppisad...gdvpnlraG---.--..--.--------Dpnvnssardpeattmeidneng.gdndsqlngqnkkishnvgeleQWCL-C..TL..GY..LKSFSRQYATE--i............................................................................................
A0A0N5B8K9_STREA/489-776               ........................................................fnnvlk----.....DSDDSTYKLSQDLAESL.SK.RIT.......NDELLAYLTK.SSDNG.DAMD.DGQlrllPSYDK.............EKIKLLMATLL...DLAQNAYTHNV.T.FFL.R..YRPA..FLEI...........vKQD......................................................SSIREI...I....LESIFTAWK.YNP...Q...LIELLTDK.LLKMQILDTYSIVKYILE...............................sRDV..GDY.V.D.K.K.Y.F.YHVLYQ.SVHRLSTH.......ANNLFNDYEKLKSQIKSVer.....kfvKK-.......-Eedcgmeecstt..........................................................nledeididslGNCD..EWLT.NQKRNLEE.K.ERymcESSNVLKDIL.........E....KIITFYFSK..................VASI.DR..--.-EH-E----.............................................EIFYNF..VN..GR..LKQF---------iivn.........................................................................................
S9XU20_9CETA/244-493                   ..............................................................YKYGd..esSNSLPGHSVALCLAVAF.KS.KAT.......NDEIFSILKD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.T.R.L.F.V.WEILHS.TIRKMNKH.......VLKIQKELEEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGALE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....HHQI-----..................----.--..--.---------.............................................------..--..--..-------------iqqymvtlenllfta..............................................................................
A0A061GUF2_THECC/484-829               ..............................................................FKYSve.dgGERTEQHAISAEISNKV.KG.RQT.......AHEIISLIEE.NIYPA.--HG.---....---LE.............ITLSVVVQTLL...DIGSKSFTHLI.T.VLE.R..YGQV..IAKI............CPD......................................................QDKQVM...L....IAEVSSYWK.NNA...Q...MTSIAIDR.MMGYRLISNLAIVRWVFS................................PEN..IGQ.F.HiS.D.R.P.WEILRN.AVSKTYNR.......ITDLRKEISSLKKGVISAee.....aasK--.......-Akaaleaaeskltlvegepvl.......................................genparlkslktqaekakeeeVSIH..DSLQ.AKEALLAR.A.LD...ENEVLFLSLY.........K....NFSNVLVER..................LPDA.--..--.---------.............................................------..--..--..-------------sragtlqalksihgdsmavdleesstmevddengrpkksqpngskatniynvgekeqwclstlgyvkafsrqyasei................
U3JEQ1_FICAL/473-756                   ..............................................................YKYGd..esNRSLPGYTVALCLTIAI.KN.KAS.......NDEIFSILKD.VPNPN.QDDD.DGE....G-FTFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVVYEVWK.NHP...QkiqMIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..AHD.F.T.R.F.Y.I.WEILHS.TIRKMNKH.......VLKIHKELEETKARLARQ.........hKRRd....sdDDdddddr....................................................................stdredGPLE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMLLTEH..................LVRC.ET..GG.IDVFT----.............................................PWYKSC..IE..RL..QQIFLQHHQII--qq...........................................................................................
I1PB96_ORYGL/483-830                   ......................................................fryhsdeg----.....KESTDGHRLSKELVAMV.RG.RKT.......QGDIISWVDE.KIIPV.--NG.---....---AK.............FALDVVSQTLL...DIGSKSFTHLI.T.VLE.R..YGQI..ISKL............CPN......................................................EEMQLL...L....MDEVSAYWK.NST...Q...MIAIAIDR.MMGYRLLSNLAIVKWVFS................................PAN..VDQ.F.H.V.SdR.P.WEILRN.AVSKTYNR.......IFDLRKEIQTLRKGLQAAke......asE--.......-Kaareleeaksiieivdgqpvp......................................senpgrlrrlqaradkakegeVTTE..ESLE.AKEALLAR.G.LE...ESKELLRLLF.........K....SFVEVLTERlppisad...gdvpnlraG---.--..--.--------DpnvnssardpeattmeidnenggdndssqlngqnkkishnvgeleQWCL-C..TL..GY..LKSFSRQYATE--i............................................................................................
J3KLQ5_COCIM/532-785                   ..............................................................FKYA.....QETTPYSKEGQEILQLI.RK.KAS.......DEEIAPVIAS.IEEQA.KAHG.--I....ADPSI.............PSTDAFVTSIC...CVGSKSLSHLL.S.SIE.R..CKER..LLAI...........gPRS......................................................AAARRQ...I....ITSVMEYWV.DQP...G...NAVNIVDK.LLNYTILTPLSVIEWALVd..............................nLAA..GSI.L.A.K.P.H.I.FEMISA.TMGKVTNR.......---IRQIVAARTQP----..........---.......--................................................................................TLVE..PQLS.VIQDALTR.E.SA...DMRAMFRLID.........D....SIVPVASGT..................NDVM.ME..RD.DDSAL-APE............................................nELIREW..GK..RW..LRVFRRKAAVE--da...........................................................................................
H2YUE9_CIOSA/492-771                   ...................................................fkydfklgpdh---S.....QEERAAYNASQRVITAI.KT.KCK.......EDELIIMLED.IHQEE.SNID.G--....STFSL.............PRLEVFLQSLL...FLAQKSFSHSF.S.AIF.K..FHKV..LKWA............GDG......................................................EEGKVA...I....LGITKDVWK.NHP...Q...MMGVLVDK.MIRMQVVDCASVAKWIFS................................PNM..ADD.F.T.R.L.Y.V.WEIMHS.TIRKMNKH.......VIKIEAELGEMRSKAQVS.........eK-Ks....edEEddlmn......................................................................tynifAPNQ..DDLQ.RMQDQLET.A.NG...EQKKLFLIIF.........Q....RFIMILSDH..................LVRC.DA..GH.TNFNT----.............................................PWYRNA..IQ..RL..QEIFLLHKDTV--kk...........................................................................................
G4VPN2_SCHMA/542-896                   ......................krnlkissednadeqvgvrsdsveklpfttapqvselspg----.....-----------------.--.---.......----------.-----.----.---....--VTN.............LAIELFYSAML...IAGHKTISHTF.A.FIK.K..YAAV..IRTL............TST......................................................VETQVE...A....LHVIQAVWA.NNP...Q...MIVIITEH.MCRVGLIDPEAVVRWAYSpimttlt.................ddtvnlnsANA..RPK.I.L.D.F.Y.V.WECLSR.TLVRVGRR.......VTRITNRLELAKETMEIN.........rR-Ss....pySTpdredadqggdgdsfsrtgvdsdsffkkpkds................isgrvkvsdrrklmagcelvsssddeaygggkDNVG..GRVA.RLEEARCE.A.VR...SQCAVITLLL.........H....RHARLTAEL..................ASEM.SGpsQN.HSFN----Tdspfflhept........................qpkslsdealrNIMFWL..KG..RL..VQVVLEHCD----qli..........................................................................................
A0A0N4ZFL0_PARTI/492-768               ......................................................vlndvden----.....-----VYKISQDLAESL.SK.RMS.......NDDLLEFVKD.SVKNE.EKMEyDQV....NLYDK.............DKIKILLATLL...DLAKNAYTHNV.T.FFL.R..YRPA..LLEI...........vKDD......................................................DQNRQL...I....LDSIFTAWR.FNP...Q...LIELITDK.LLKMQILDTASIVKYIIG...............................sQNL..GDF.I.D.R.R.Y.F.HQVLYL.SIHRFSKH.......VNNLCSAHDKLKYQIESV..........ERQl....tkSEcideqlnhnm............................................................dneidinsleN---..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------peewlyvqkglleekeilysqnlkqlqviledvicyylsnisminknednilydfaygrlkqfii............................
A0A094A8W6_9PEZI/534-785               ..............................................................FKYN.....DDDTPFAAEGREIHTLL.KR.KAP.......EPEIQTVIDQ.IHTQA.TTIA.--I....HEPLL.............SSTDAYVTSIC...YIGSKSLSHVL.S.CID.R..CKER..LLSI...........gNTS......................................................ETARRQ...I....ITSVMAYWV.DQP...G...IGVNIIDK.LLNYTILTPLSVVEWALLd..............................dTKA..GDK.L.A.E.P.F.V.FEMVAG.TVQKVTNR.......---LRQIV----ASRNAP..........---.......--................................................................................GLDH..EQRL.LLDETLLR.E.RV...AMKDMFKVME.........D....ALFSWAAGS..................KDQA.ME..AG.IGETT--DE.............................................AFIRRW..GE..KW..LRVFRRKMAVEE-a............................................................................................
G3PX26_GASAC/498-780                   ..............................................................YKYEd..esASSLPGYPASITVGNAI.KN.RAT.......NEEILAILKE.VPNPN.QEDD.DDE...gESFNP.............LKIDVFLQTLL...HLAAKSFSHSF.S.ALG.K..FHEI..LKAL............TER......................................................DEGKLH...I....LKVVYEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWLFS................................QDM..AHE.F.T.R.L.F.V.WEILHS.TIRKMNKH.......VQKIQQELEEAKDKLEKQqhk....rqqK--.......-Dsgdeedm.................................................................dknsedeeGQLE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMLLTEH..................LVRC.ET..GS.VEIST----.............................................PWYKNC..IE..RL..QQVFLMHHVTI--qq...........................................................................................
NCBP1_DROAN/488-770                    ..............................................................YKYAn..eeAANLPGTTVAHQLVVAI.RQ.KCL.......PEEVVNILKE.IPSSG.YSGE.EMS...dGSFNA.............LKIDVFVQTLL...NLGSKSFSHSF.A.AIS.K..FHSV..FRAL............AET......................................................EEAQIC...I....LHNIFELWS.THQ...Q...MMVVLIDK.LLKLQIVDCSAVATWIFS................................KEM..TGE.F.T.K.M.Y.L.WEILHL.TIKKMNKH.......VIKLNTELSEAKDKLSKAds......ssS--.......-Dsdddtphk...............................................................rkkpithadKPSE..EVVE.RMEEKLEA.A.NV...NQKRLFLIVF.........Q....RFIMILSEH..................LLRS.DT..DG.RDPDT----.............................................DWYRWT..IG..RL..QQVFLMHHEQVQK.............................................................................................
Q4V551_DROME/498-719                   ..............................................................FKFV.....DETLPGAILSKDLLEAM.RSpQAS.......PEMISEIIKS.STGIG.----.---....P---L.............LKINVFTQNCL...HLGSKSFSHTF.G.ILR.K..YHSV..FKDL...........vAGD......................................................PERQAA...V....LNGIFDVWV.ASD...Q...YKFVVTEK.LVTGLIIEPISVVRWIFG................................PSM..RKE.L.T.K.I.Y.I.WELLHS.ALRHLK-R.......---VQQKIEVVDVD----..........---.......--................................................................................----..----.----DPSA.C.DP...VVKGILFTIV.........Q....RFVKTLCGA..................P--F.AD..EG.TEEH-----.............................................YWFQWV..LG..RL..-------------eetlfiyadd...................................................................................
X1WQ84_ACYPI/491-791                   ..............................................................FKYAi...eKSSLPGQFLSNTLLTKI.RN.KTT.......PEDIIEILKE.---PL.MSEN.GEI....LEPADigi.......snpTKVDAFVQTLL...FIASKSFSHAF.A.AIT.K..FISV..FKAL............GET......................................................DDGQLQ...I....LRSTFDLWS.ADQ...Q...MLTVLIDK.MLKTQIIECSSVANWIFS................................KDM..IPE.F.T.K.L.Y.I.WEILSL.TINKMSRH.......VDRLTRELNEAREKLRTTaai...snssD--.......-Dsdtetekaeakprqs.................................................ttttfggqgvpmdvddNVTE..EMVE.RMEEKLEM.A.QA...DQKNLFLIVF.........Q....RFIMILSEH..................LVKC.DT..DD.RPFDT----.............................................YWYKYT..VG..RL..QQVFLAHHEQVQK.............................................................................................
B4KJA1_DROMO/497-712                   ..............................................................FKYI.....DGLLPGATLAKHLLDAI.RS.KCA.......PELLGGLLEA.TTELD.--DG.---....-----.............LKINVLMQSLL...HLGCKSFSHIF.S.LLS.K..FQPV..LKVL............VNN......................................................DAHQLA...M....LRALFEVWS.NNE...H...VKLVVADK.LLKMHIVSNHAVVAWVFN................................PSL..KSE.L.V.K.M.Y.L.WELLNL.TVRYTKYH.......------------------..........---.......--................................................................................----..----.-MRVTEEN.Q.ST...DLNCLLLNIA.........Q....TCVKVLLDH..................RKSE.--..-Q.S----SEVD.............................................YWFQWI..QG..RL..LQLLFN-------yiddvrk......................................................................................
A0A0F9Y2U7_TRIHA/533-778               ..............................................................FKFN.....NSDTPFSSEGQEIGALL.KR.KAP.......DEEFQPIIDR.IEAEA.GERA.---....LDPVV.............ASTDVFMTAIC...WVGSKSLSHVL.A.CID.R..SKER..LLKA...........aNSS......................................................PAAQNQ...V....LAAVMAYWH.AHP...G...IALSIVEK.LLNYSILTPASVVRWALTdgs.........................lvdgANA..GEA.L.A.Q.P.H.I.FELVLN.TVTKVSFR.......---VRQILASPD------..........---.......--................................................................................----..----.ADEEGRKS.E.IK...AMQDLFGLLN.........D....LLVSWAGGN..................KDEL.ME..MG.DGS--SEPE.............................................ALIRRW..GQ..RW..LRVFKRLGAIEE-a............................................................................................
F7VZ09_SORMK/533-786                   ..............................................................FKFA.....DEKTPFAAEGKEIAALL.RR.KAP.......EEEIEPVIER.IHSLA.LDNN.---....LDPLV.............ASTDVFVTSVL...HVGSKSLSHVL.A.AIE.R..TKER..LTDA...........gATS......................................................EAARTQ...I....ISSVMEYWS.AHP...G...VAIAIIEK.LLNYSILTPQAVINWAITty............................agATR..GEA.L.A.R.G.F.V.YEMIFN.TVVKVTSR.......---LRQVLQKA-------..........---.......--................................................................................--TL..PEAM.IDDETIEA.E.IN...GMRSLFRAIE.........D....ALVAWATGSkd..............emIEAS.DS..LG.EGDGNSETE.............................................KLVKRW..GE..RW..LRVFKRRAAIEE-a............................................................................................
C4R1D3_PICPG/635-804                   ..............................................................FLFI.....NEEHPFMNDCIDVYDNLhQS.DVS.......VEQFSQIIAD.LKTKL.QQHS.AFS....INSDK.............YIIMLLIQATC...VTGGRSLSIFN.R.ALG.V..SKDK..IRAVfd.......tliDDK......................................................SLLNSW...I....IDSVLILWN.HEP...R...IGYLLIEK.LCHEKFITASSIVDSVFS...............................yESS..LPM.I.S.Q.F.Y.T.IELVNR.LFES----.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------hgee.........................................................................................
A0A024TE12_9STRA/640-769               ......................................eqvfgkikaregttaieawidaqg----.....-----------------.--.---.......----------.-----.----.---....---KD.............VGLEMAVAALL...DAGSATFTHFR.T.LLD.K..YLPV..LMHAi..........dA-Ngd..................................................ggVDRQVV...V....IATVSSVWE.QSP...Q...HVILILNI.LLRHRVLSPVAIVSWLFG................................ADA..---.-.-.-.-.-.-.------.--------.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------vqqyswyvdsmr.................................................................................
U6NYV9_HAECO/687-947                   .............................................................c-KFD.....DENQPGYEAASKFLALI.QS.RSD.......DNAIMAEIRD.EENR-.--YD.---....P----.............DLFGIFFAVLL...KTSAKSFSHTF.V.ALS.R..YSTT..LKTI...........aDTS......................................................DEMQEV...L....LCCLFQCWR.NNH...L...RIIILVDK.MLKMQILDCGVVISWIFS................................ESL..KSE.T.D.R.Q.W.V.WEVLNT.ALERLSRH.......IHKVAHDVDILQKRVERQr........iEAGe.....eMEds...........................................................................dvkTREQ..EELE.QQQEKLEN.L.KD...FQKSLFLDVL.........H....KFTVLLTEF..................IVNC.ET..EG.TDFRT----.............................................PYYAWI..NG..RF..KQIFLMHGAD---lhe..........................................................................................
E4XB39_OIKDI/505-584                   .......................................................xxxxxxx----.....-----------------.--.---.......----------.-----.----.---....-----.............-----------...-----------.-.---.-..----..----............---......................................................------...-....---------.---...-...--------.------------------................................---..---.-.-.-.-.-.-.------.--------.......------------------..........---.......--................................................................................----..----.------XN.A.KI...EQKNLFLVIF.........Q....RFIGVISEHvak...........hglaVEED.EM..MD.S-------Qeiav....................................qgknaIWLQCT..CE..RL..KEVFLRNES----avl..........................................................................................
N4VJM2_COLOR/521-766                   ..............................................................FKFN.....DDHTPFSAEGREIAALL.KR.KAA.......DEEFQPVIER.VHSLA.IERG.---....LDPLV.............TSTDIFVTAIC...WVGSKSLSHVL.A.CIE.R..TKDR..LLDV...........gAAS......................................................ETAKAQ...I....ITAVMSYWA.AQP...G...VAISIVEK.LLNYTILLPINVIEWALVgss.........................hvdgASS..GDS.L.A.Q.T.H.V.FELVFG.TVAKVTGR.......VRQLHTEAGADA------..........---.......--................................................................................----..----.---EAKTV.E.IE...AMRVLFKAME.........D....ALVSWATGT..................KDEM.ME..EV.DGA--GQRD.............................................ALIRRW..GE..RW..LRVFRRRSAIEE-a............................................................................................
V4AG41_LOTGI/488-760                   ..............................................................YKYEq..egAGSLPGTMKAHALMSAI.KS.KCT.......PEEAAQILKE.LPSDM.SDDN.DL-....-SFNP.............LKIDVFVSTLL...YLGSKSFSHSF.A.ALA.K..FHPL..LKSL............AET......................................................EESQIY...L....LKTLYSVWK.SHQ...Q...MLVVLVDK.LLRTQIVECSAVANWLFS................................DSM..KQD.F.I.S.G.Y.L.WEIMHS.TIKKMSKQ.......VDKLQKEVDEGRDRLDAQr........rR-Aad..gldMDgy...........................................................................dedIPTT..EMID.RMEEKLES.A.IS...QQKSLFLIIF.........Q....RFIILLTEH..................LARC.ES..EG.IDYNT----.............................................AWYKWV..IE..RL..QQVFLQHHTLVY-k............................................................................................
C4XYV4_CLAL4/259-527                   ..............................................................YEFS.....NPALPLNEVANKLYDFIiAN.WRS.......NEQFNDMVNE.TLEAI.KSS-.VVN....VDSDK.............VLINLLFQTYA...YIGSRSIYSVV.S.ILN.R..DIAK..LKFVsgv......evtE-Edyklsgtefq.................................fpdlhltpeqlGNRQKW...I....IESILRIWI.QQP...Q...VAFLILEY.LIEFGILNPQYLIRKALD................................PDS..NLI.I.N.N.V.S.C.MESINR.VLSTCAVG.......------------------..........---.......--................................................................................----..----.--------.-.-E...SSKEVILLLF.........N....LIVENLNYT..................LGKI.GV..EN.PETEEVKIItefsdedkn..........................dtelmakidlQWLFYE..YR..GL..LKTYLRKFNLQ--hs...........................................................................................
E9HSG0_DAPPU/486-779                   ..............................................................FKYQi..egGNGFPGAAQVQTLTELL.RK.KPT.......PEEVLELVQQ.LPNPL.KDDD.GDM....EPSHN............pLAIEVFVQTLL...HLGSKSFTHTF.A.GLA.K..YHSV..FKNI............CEN......................................................EEAQIC...M....LRQVYELWQ.HHP...Q...FLGVVVDK.MLKTQIVECCAVANWIFS................................RDM..ALE.F.T.R.S.Y.I.WEVLHL.TIRKMNKH.......VVRLEKEVADARAKLRAApsd....sesS--.......-Dedpsreggekrrr......................................................tssnkeatkddgeQPTE..EMVE.RMEERLEA.A.QS...DQKNLFLIVF.........Q....RFIMILSEH..................VVRC.DT..DG.KDFNT----.............................................FWYQWT..VG..RL..QQVFMAHHEQVEK.............................................................................................
A0A099P1G9_PICKU/793-990               ..............................................................YLFN.....HDEHPFNDICRDVYMNLeNV.EDS.......NESLLELIDR.LKERV.VNEG.DV-....KNANE.............YIVTLVLQSVC...LIGSRSFSVFE.E.SLN.K.vFGDK..LKSVle.......hvdAGE......................................................AEKKEW...I....INAVLRIWN.SEP...R...IGLMFLER.LARYHIIDEGTLVRYVWN................................Y-N..CLP.L.R.E.V.Y.A.DEFL--.--------.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------erliddredlnlvyleclerqvekskedgdeyqckylrda.....................................................
F7H7F0_CALJA/487-762                   ..............................................................YKYGd..esSNSLPGHSVALCLAVAF.KS.KAT.......NDEIFSILKD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.T.R.L.F.V.WEILHS.TIRKMNKH.......VLKIQKELEEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGALE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TSVLT----.............................................PWYKNC..IE..RL..QQIFLQHHQII--qq...........................................................................................
M7TI29_BOTF1/577-824                   ..............................................................FKFD.....DPSTPFSAEGQEILALL.RK.KAT.......EEEIQPVVDR.IHALA.VEQA.--L....PDPLV.............PSTDAYVTSIC...YIGSKSLSHVL.S.CIE.R..CKDR..LLAI...........gPVS......................................................PVARRQ...I....ITSVMQYWK.DQP...G...IGVNIIDK.LLNYTILSPQSVVQWAIG................................S-E..GKR.L.S.Q.S.F.V.YEMVEA.TVGKVTGR.......IRQVQLSL-------RVP..........---.......--................................................................................GLLE..EQKQ.LIEKTVEM.E.RI...NMRELGREMD.........E....LLTAWANGS.................kDQEI.EM..DG.REEDR----.............................................ALVRGW..GE..RW..LRVFRRKFAVEE-a............................................................................................
S2JP86_MUCC1/537-805                   ..............................................................FAYK.....DIKDPLHAQAKVVIESL.RT.KKT.......ADEVRTILDK.YKEEV.RATG.VDE....QEQNQ.............RVREMFVQCLL...LVGSKSFSHIL.N.VVE.R..YLDV..LRFV............NAT......................................................PDGRLH...T....VQIVASFWE.HNT...Q...FLGILLDK.LLNYRVIDPASVINWIFE................................TNQ..LQF.A.G.R.A.F.I.WEILKN.TLSKVNSR.......VVQVKAKLDSFQSLHSANk.......lkR-A......eSEhnel.......................................................................aeaeeQQEL..DSLR.IVENSLAS.V.SR...EQKEVFMAVY.........Q....KFTQVLQEL..................I---.KT..NA.QPEA-----.............................................NWTYRW..VF..GW..FREMLRVHYKE--cg...........................................................................................
V2XHE6_MONRO/531-843                   ..............................................................FEYD.....DPAKPHHDAAQSILNLF.RG.RAQ.......AGDVIAHLDT.LKNNL.ENES.SDSg.qlVNVDT.............AMRSIAIQSLL...HIGSRSFSHLL.N.AIE.R..YLSL..LRFI............ANGgvsea............................................pgggiPEAKSD...I....LNAVAAFWK.NDK...L...MVNIVFDK.LMQYQIVDPADVVKWTFTnvs.........................etedELK..TPL.T.L.T.A.F.E.WSLLKG.ALDKANGR.......VTIARRKLAALRKEDDET..........KARan...agTTgdmdvdd.................................................................vkpvtetsGAEN..PALA.SAIKALSI.L.TR...EQKNTLSRTL.........E....GFTNCLAPP..................LSSV.SP..EA.QAILT---Ekswhnr.................................anwgrdEWNFWE..TW..AW..YRHFCRTYSPYL-r............................................................................................
D6W9J4_TRICA/1-255                     ............................................................mv----.....-----------------.-T.KCT.......PEEVLGVLKD.LPNPR.SEEE.-TD....SRFNP.............LKIDVFVQTLL...NLGSKSFSHSF.A.AIS.K..FLYV..FKIL............AES......................................................EEAQIC...V....LRNMFELWH.HHQ...Q...MMVVLVDK.MLKIQIVECSAVANWIFS................................KEM..TAE.F.T.K.M.Y.L.WEILHL.TIKKMNRH.......VIKLGGELAEAREKLARAes.....sesE--.......-Sededsk...................................................................kkqsdneKPTE..EYVE.RMEEKLEA.A.QA...DQKNLFLIIF.........Q....RFIMILSEH..................LVRC.DT..DG.RDYNT----.............................................HWYKWT..IG..RL..QQVFLAHHEQVQK.............................................................................................
D8SFU6_SELML/513-831                   ..........................................................etgf----.....---------ASELLAQI.KT.KKG.......MKDIESWFES.KIVPA.AGQ-.---....----K.............VAIEILLQTLL...NLGSKSFTHMV.T.VLE.R..YGQL..IATL............APD......................................................ETLQVH...V....IDEVARFWQ.NSS...Q...MIAIVVDR.MMGYRLVSNLAVIRWSFK................................DEN..VQT.FhT.S.G.R.V.WELLGN.AINKAGNR.......TADLQRDVVNAKRALDEAdg.....avsKAEr.....nRSnvqelidsaetddarkqa............................................tskmewvkttvvkargrqTAAQ..DLLE.TKEALLSG.A.LR...EQDTLVCLVF.........Q....NLVSTISSK..................LSKS.DA..DG.ADTAEPEPMdvdadpsaaategn.................nnennenqnerykkSHWQRC..TM..GH..LEAFCRQYAAE--v............................................................................................
A0C585_PARTE/472-686                   ...........................................................qls----.....--------VAEKINSYL.QQ.KLN.......GIEMLEQLKL.ITNPG.P---.---....----E.............VVIQTFLESLL...QSISKSITHLN.V.LSK.R..YLSF..LLQPn..........iIKP......................................................EKLGEI...L....LQTIFRMWN.HSI...F...HLKVYLKE.FLNLEVISNLQIINWVGEi..............................iKQK..SEA.F.K.I.Y.N.V.LIAIND.VFRKQTKL.......-DQVQDCTYENVKE----..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------intiltkmieqeqdiiiqssletiqlqiliafkstngaqsekllkevkstyikq.......................................
J9EBN4_WUCBA/332-503                   .........................................................qeeke----.....--------LVAEIERAF.RN.KAE.......PKEITEMLRE.FDKEG.NSL-.---....-----.............ATLSTFFSVML...NAAQKSFSHNF.A.ALT.R..YHET..LKEL...........sGID......................................................DESSTA...L....LRTLYDVWK.HNR...Q...MMVVLITK.MLRMTLLNANAVVSWLLS................................SYV..GQE.L.H.R.F.W.L.WEALFI.IVKHVCGH.......MNRCKIKLQQMQEKRARM..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------erssgn.......................................................................................
G0R794_HYPJQ/533-778                   ..............................................................FKFS.....NPDTPFASEGQEIAALL.RK.KAP.......DEEFQPIIDK.IQAEA.AERA.---....LDPVV.............ASTDVFMTAVC...WVGSKSLSHVL.A.CID.R..SKGR..LLEA...........aNSS......................................................PAAQNQ...V....LAAVMAYWH.AHP...G...VALSIVEK.LLNYSILTPSSVVRWALTadn.........................hpnaASA..GEA.L.A.Q.P.H.I.FELVLN.TVTKVTGR.......---VRQLLTSADA-----..........---.......--................................................................................----..----.-DEEARKT.D.VK...AMQDLFALLN.........D....LLVSWAGGN..................KDEL.ME..MG.DGS--SEPE.............................................VLIRNW..GQ..RW..LRVFKRLGAIEE-a............................................................................................
W9CCH7_9HELO/603-851                   ..............................................................FKFN.....DPNTPFSAEGQEILGLI.RR.KVS.......EDEIQPVIDK.IHALA.VEQA.--L....PDPLV.............SSTDAYVTSIC...YIGSKSLSHVL.S.CIE.R..CKDR..LLAI...........dPAS......................................................PVARRQ...I....ITSVMEYWK.DQP...G...IGVNIIDK.LLNYTILSPQSVVQWALG................................S-E..GKK.L.S.Q.S.F.V.YEMVGA.TVGKVTGR.......IRQLQLST-------RVP..........---.......--................................................................................GLLA..EQKD.LINQTVEV.E.RM...NMRELATEMD.........E....LLSSWATGTk................dQEME.EG..DG.TS----GGE.............................................ELVRGW..GE..RW..LRVFRRKFAVEE-a............................................................................................
R0KNI0_SETT2/564-817                   ..............................................................FKYD.....NPETPYAVEGQTLLNQL.RK.KAT.......PEEVQVTIDS.IHEKA.LAQG.V--....SEVLV.............PSTDAFVTAIC...RLGAKSLSHVL.S.CIE.R..GKDR..LLEI............SQN......................................................ETARRQ...I....VASVVEYWK.DQP...G...VAVRIIDI.LLNYTILAPMTVVQWVFGs..............................hMGA..GEA.L.T.E.S.W.V.FEMVSN.TVAKVTNR.......---NRQIA----SARLQK..........---.......--................................................................................GLPQ..EQIE.MVEATLAK.D.RD...NARELFKYIE.........D....SMRGVAEGS..................ADTL.IE..KS.SSGALGDEE............................................vELIKAW..GK..RW..QTVFIRKAQVEE-s............................................................................................
D8TCU0_SELML/476-804                   ..........................................................etgf----.....---------ASELLAQI.KT.KKG.......MKDIESWFES.KIVPA.AGQ-.---....----K.............VAIEILLQTLL...NLGSKSFTHMV.T.VLE.R..YGQL..IATL............APD......................................................ETLQVH...V....IDEVARFWQ.NSS...Q...MIAIVVDR.MMGYRLVSNLAVIRWSFK................................DEN..VQT.FhT.S.G.R.V.WELLGN.AINKAGNR.......TADLQRDVVNAKRALDEAdg.....avsKAEr.....nRSnvqelidsaetddarkqa............................................tskmewvkttvikargrqTAAQ..DLLE.TKEALLSG.A.LR...EQDTLVCLVF.........Q....NLVSTISSK..................HSKS.DA..DG.ADTAE--PEamdvdadpsaaategnnnen.....nenqnesvaskgedhpneelKHWQRC..TM..GH..LEAFCRQYAAE--v............................................................................................
W4WRZ8_ATTCE/488-762                   ..............................................................YKYTp..kgASSLPGSDAALKLIDSI.KN.KGT.......SEDVLAILNA.LPREN.EETN.NYN....P----.............LKIDVFVQSLL...NLGSKSFSHSF.A.AIV.K..FHDI..FKML............AET......................................................EEAQIC...I....LRNMYALWK.NHY...Q...MMVVLTDK.FLKTGIIECSAIANWIFS................................KEM..ASE.F.T.K.L.Y.I.WEILHL.TIRKMNKH.......VTKLSTELTDAREKLRRAesr....sgsS--.......-Sdeednn....................................................................kernreRPSE..DEVE.RKEEKLEA.A.QA...DQKNLFLIIF.........Q....RFIMILSEH..................LVRC.DT..DG.IDYNT----.............................................HWYKWT..VG..RL..QQVFLSHQEQVQK.............................................................................................
W9XJL5_9EURO/548-800                   ..............................................................FKYN.....DESTPFSAEGQQLAQMI.RR.KAS.......NEEFTPVFEK.IEQDA.AASG.--L....TDPAL.............ASTDAFVTSIC...WIGSKSLSHAL.A.CIE.R..CKER..LMAI...........sSAS......................................................SACRKQ...I....ITSVMDYWK.DQT...G...VGVVILDK.LLNYQILTPATVLEWALId..............................hVAR..GTL.L.A.K.T.W.C.YELVSL.TTRKVAGR.......---VRSIVGAIRQP----..........---.......--................................................................................GLAD..DRKD.ELQQALAH.E.ME...TMKNLFSIIE.........D....AVGSIRDGN..................QDEM.-M..ES.SDALRAEEE.............................................DLLKAW..GG..KW..ARVFQRKYAVE--ds...........................................................................................
H3GMP6_PHYRM/615-861                   .........................asqfyqsvttklkghppasalrswldeelprleisra----.....-----------------.--.---.......----------.-----.----.---....-----.............EAIEVVWTCIL...EAGAATFTHMR.L.LLE.K..YGRR..YELFggd.....dqsaEER......................................................DADELV...L....VKTVASVWL.KSP...Q...HIGLILNS.MLRQGLFRPSTIVTWVFT................................PDA..VQQ.Y.S.W.P.Y.V.WEILND.TLEFVHDA.......---IRAKTRQLEQAAAPR..........SAD......dQD................................................................................NEEM..PDVA.ALEDGRKR.L.QD...ELQQLLVLLF.........R....GFNRVITEH..................KAEC.DA..ED.ADPRD----.............................................NWFRSA..LA..QM..QAVG---------yrfrvp.......................................................................................
A1CM21_ASPCL/541-794                   ..............................................................FKYS.....SDTTPYATEGREIMQLI.RK.KAG.......DEEIRPLIDA.IEEQA.KALG.VD-....-EPML.............PSTDALVTSIC...YVGSKSLSHVL.S.CIE.R..NKER..LLAI...........gPKS......................................................ARARCQ...I....ITSVMEYWV.DQP...G...IAINIIDK.LLNYTIITPLSVVEWALVe..............................kMEA..GVI.L.S.K.T.H.I.FEMVSA.TVGKVTNR.......---LRQIV----AARTQP..........---.......--................................................................................GLYE..PQLS.VLDETLGR.E.KA...DMQALFRVIE.........D....SIVSVAGGSnd..............elMERG.DG..SG.NLPED----.............................................EIIRQW..SR..RW..LRVFRRKAGVEE-s............................................................................................
V8NB45_OPHHA/410-682                   ..............................................................YKYGe..esNQSLPGYNVALCLNIAI.KN.KVS.......NDDIFTILKD.VPNPN.QDND.DEG....FSFNP.............LKIDVFVQALL...HLASKSFSHSF.S.ALG.K..FREI..LKTL............AES......................................................DEGKLH...I....LRVMYEVWK.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................PEL..SHD.F.T.R.F.Y.I.WEILHS.TIRKMNKH.......VMMIQKELEEAKERLAKQ.........rKRRd....dvRSne...........................................................................rgnWPLE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LARS.EA..GG.IDVIT----.............................................PWYKNC..IE..RL..QQIFLQHHQII--qq...........................................................................................
A0A0F8BJB3_CERFI/535-804               ..............................................................FKFN.....DPETLFSAEGIDMAALL.RR.KAD.......DEAFQPIFDK.IQTAA.LDMG.---....TDPLV.............ASVDVLMTSVC...WVGSKSLSHGI.A.CIE.R..VKAK..LTEF...........aSAS......................................................EAARCQ...L....ITSIAQYWT.YHP...G...TVVALIDR.LLNIAVLTPTAVVEWALTgags........................lvcdGPT..STV.L.S.R.A.L.V.FEIVVN.TVNRVILR.......---LHQPLEASELKPTPEtld....nlfK--.......-Aiydgvdkiqadptadeegv.........................................aapetwkarwmrvfkrkeivQ---..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------kalaaekklakeikekeeeelareaqadieataaaeqd.......................................................
A6R994_AJECN/500-752                   ..............................................................FKYA.....LESTPYAAEAQEIMQLI.RK.KAP.......DAEIEPHILA.IQNAA.ANQ-.TDT....TDPLI.............PSTDAFVTSIC...YVGSKSLSHVL.S.CIE.R..SKER..LLSI...........gPQS......................................................PAARRQ...I....ITSVLSYWA.DQP...G...IGVNIIDK.LLNYTILTPLSVIEWALVd..............................hIEG..GAA.L.A.K.A.H.V.YEMVAA.TMGKVTNR.......---IRQIVVARVQR----..........---.......--................................................................................GIVE..PQLS.VIDETLRR.E.RG...EVQVMFEVIE.........G....ALEGVISGS.................gMEDV.GG..VL.VGEGE---K.............................................VIIREW..AQ..RW..LRVFKRLRAVEE-m............................................................................................
C3Y2C6_BRAFL/442-544                   ........................................sslykpkfvqevlgkcvsgsed----.....-----------------.--.---.......----------.-----.----.---....-----.............-----------...-----------.-.---.-..----..----............---......................................................------...-....---------.---...-...--------.------------------................................---..---.-.-.-.-.-.-.------.--------.......-----------------E..........MQD.......MD................................................................................GVDE..EEIE.RLQERLES.A.QS...EQKKLFLVIF.........Q....RFIMVLTEH..................LGRC.ET..SG.KDFNT----.............................................AWYRYS..SE..RL..QQIFLQHHSTV--tk...........................................................................................
L5KQH9_PTEAL/808-1083                  ..............................................................YKYGd..esSNSLPGHSVALCLAVAF.KS.KAT.......NDEIFSILKD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFMQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.T.R.L.F.V.WEMLHS.TIRKMNKH.......VLKIQKELEEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGALE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..EG.TSVLT----.............................................PWYKNC..IE..RL..QQIFLQHHQII--qq...........................................................................................
H2QXJ3_PANTR/485-760                   ..............................................................YKYGd..esSNSLPGHSVALCLAVAF.KS.KAT.......NDEIFSILKD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.T.R.L.F.V.WEILHS.TIRKMNKH.......VLKIQKELEEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGVLE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TSVLT----.............................................PWYKNC..IE..RL..QQIFLQHHQII--qq...........................................................................................
W5EKC6_WHEAT/36-180                    ......................................................fryhtdes----.....KESTEGHRISKELVSMV.RG.RKT.......TRDIILWVEE.QIVPA.NGT-.---....----K.............FAVDVVSQTLL...DIGSKSFTHLI.T.VLE.R..YGQI..ISKL............CPD......................................................EEMQLL...L....MDEVSAYWK.NST...Q...MTAIAIDR.MMGYRLISNLAIVKWVFS................................PAN..VDQ.F.H.-.-.-.-.------.--------.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------vsdr.........................................................................................
T1FTY1_HELRO/364-635                   ............................................ieickqrsallpqvglna----.....-----------------.--.---.......----------.-----.----.---....-----.............SRIDVFVQTLL...YLASKTLSHSF.S.AIT.K..YHKL..LKDSveg......atkQET......................................................TQLQVA...L....LSSLQYVWK.NRP...Q...MIEVIVDK.LLKTQIISCSSVVAWVLS................................EPM..VAH.L.N.C.F.Y.I.SHILAS.TLDKMHTQ.......LSKTLKELENLKKQSSTYk.......kpK-Rhl...gvDDyndddddrknddddern..............................................ddqddddldlgrynvkrTQFD..DEID.AEEKKAQQ.L.KQ...EIKIIHCHII.........K....NIVNVLSDH..................IHLC.EN..DG.LSHEV----.............................................PMYKIL..KD..RL..QEYLYKYH-----eftyq........................................................................................
A0A074WCR7_9PEZI/537-788               ..............................................................FKYL.....DEQTPYSQQGNAMHALI.RR.KAT.......EEEIEVVISE.IQTLA.SEQG.V--....EDVLV.............PSTDAYMTSIC...SVGSKSLSHVL.S.CIE.R..CKER..LLAI...........gPQS......................................................ELARRQ...I....ITSVIDYWA.DHP...G...TAVNIIDK.LLNYTIITPMSVIEWALHd..............................hMQH..GRA.L.A.Q.T.H.I.YEMISA.TMFKVSNR.......---MRQIV----RARAEA..........---.......--................................................................................DLSE..EQKS.LLDETLVR.E.RQ...TMRDLFNAII.........E....AVATVANAAqd..............dmIERF.--..DG.DS----AEQ.............................................TLLQQW..GA..RW..ARVWRRKMAVEE-a............................................................................................
W4Y6T9_STRPU/44-126                    ............................................................nk----.....RESLPGYAIAQTLCDLI.KK.KGS.......IEVVLEVLKD.APNPK.DVDG.MED...eTSFNA.............LKIDVFVQVLL...YLGSKSFSHSF.S.ALA.-..----..----............---......................................................------...-....---------.---...-...--------.------------------................................---..---.-.-.-.-.-.-.------.--------.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------naqyt........................................................................................
K7IVH0_NASVI/488-761                   ..............................................................YKYSs..egASSLPGTTVAHELVVAI.RR.KCT.......PEEALNVLNS.LPGPG.ENEE.NYS....--FNP.............LKIDVFVQTLL...NLGSKSFSHSF.A.AIG.K..FHYV..FKVL............AET......................................................EEAQIC...I....LRNMYALWK.NHY...Q...MMVVLTDK.FLKTGIIECSAIANWIFS................................KEM..ASE.F.T.K.L.Y.I.WEILHL.TIRKKNKH.......VIKLSKELTEAREKLRRA.........eS-Rs....gsSSdddd.......................................................................kdkgeRPSE..DAVE.RMEEKLEA.A.QA...DQKNLFLIIF.........Q....RFIMILSEH..................LVKC.DT..DG.IDYNT----.............................................HWYKWT..IG..RL..QQVFLTHHEQVQK.............................................................................................
F0UQX4_AJEC8/556-808                   ..............................................................FKYA.....LESTPYAAEAQEIMQLI.RK.KAP.......DAEIEPHILA.IQHAA.ANQT.-DT....ADSLI.............PSTDAFVTSIC...YVGSKSLSHVL.S.CIE.R..SKER..LLSI...........gPQS......................................................PAARRQ...I....ITSVLSYWA.DQP...G...IGVNIIDK.LLNYTILTPLSVIEWALVd..............................hIEG..GAA.L.A.K.A.H.V.YEMVAA.TMGKVTNR.......---IRQIVVARVQR----..........---.......--................................................................................GIVE..PQLS.VIDETLRR.E.RG...EVQVMFEVIE.........G....ALEGVISGS.................gMEDV.DG..GW.VGEGE---K.............................................VIIREW..AR..RW..LRVFKRLRAVEE-m............................................................................................
G0SWX6_RHOG2/1107-1384                 ..............................................................YAYE.....DPEHIHNAAATSFLRMI.RA.KAP.......ISEATEELDS.FQKSL.ETEH.NMT....AEAAE............nVKRDMAVQTIL...NVGSRSFSHFL.N.ALE.R..YLTL..LRNL............SSS......................................................PSARQH...L....LTTVASFWK.RHP...Q...FHLIVLDK.LLQYRLVDTRDVIAWVFApse..........................eqdGAK..TKT.W.S.D.P.D.L.WQMVKI.TLRSVTSQ.......IDSAKMRVEGLKREEEMKg.......aeN-Dt....gkQEgehalda..................................................................egdlpgrDAQN..PELD.SANSYLAE.A.ED...EQASVLVNVL.........G....HFAKLLPAD..................VDEE.--..--.---------.............................................DWETWW..IK..GW..VREFCRS------sfshka.......................................................................................
A0A0K0IMQ5_BRUMA/28-297                ............................................................sy-DLN.....DDEHPDRDFAIVLEKAF.RE.KIS.......ADGMIDLLRN.QSENQ.MDIN.---....-----.............FRLSIFFKVLL...YLARKTFSHNF.V.ALT.R..YYST..LKEF...........iGGR......................................................EDVQLT...I....LRTLYETWK.LHG...Q...MIIVLVTK.LLKMSLVDASAVVAWLFS................................DEM..KPE.F.E.R.L.W.I.WEILNI.ALEHVSGH.......VRRNRQAIEKAKLKKEEKe.......lnD-Ekd..dfdMEtneh........................................................................ddmaDPNA..MESF.VKESEFAD.L.HE...CLKNLLLDVL.........H....KFTVTLTEH..................IVNS.ES..NG.NDFQN----.............................................NWYLFV..TG..RF..KNVFLKYWRD---lfe..........................................................................................
F7H2J1_MACMU/1-110                     ..............................................................----.....-----------------.--.---.......----------.-----.----.---....-----.............-----------...-----------.-.---.-..----..----............---......................................................------...-....---------.---...-...--------.------------------................................---..---.-.-.-.-.-.-.------.----MNKH.......VLKIQKELEEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGVLE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TSVLT----.............................................PWYKNC..IE..RL..QQIFLQ-------vcge.........................................................................................
D5GA59_TUBMM/542-790                   ..............................................................FKYD.....SEDEPFCKEAKEVLHAV.AD.KKE.......DAEVDAILAK.IVELA.KESG.V--....ADPLF.............VARDAYVTAIC...HIGAKSLSHVL.S.CIE.R..CKEK..LLAI...........gNES......................................................PDARRQ...I....VGSVLSYWE.DQP...G...IGANVVDK.LLNYSIVTPLSVVEWVLH................................DAG..NKA.L.S.H.T.H.A.WEMVST.TINKVNTR.......---VRQMVAARRVMSIN-..........---.......--................................................................................DYTE..EQLA.VYAQTLNA.A.EI...EQGVLLNAVT.........D....ALTAMSDSS..................DEMN.GG..ID.-----VESK.............................................AWMQWW..AK..GW..LRAFSRKFG----vae..........................................................................................
K5X9H4_PHACS/528-832                   ..............................................................YEYD.....DPARPHYDAAQSILNLL.RG.RAK.......AEDVMSHLES.LKNTL.ETTD.-SD....TNVDS.............VIRSIAVQSLL...HIGSRSFSHFL.N.AIE.R..YLPL..LRNLasgs...isttsTSS......................................................LEARMD...I....LTAVSDFWS.SSK...H...MIIIVFDK.LMQYQIVDPTDVVSWAFTqgv..........................eriAAS..THS.S.I.G.A.L.Q.WEVIKS.ALDKANGR.......VVIARRKVSALRKEADEK..........AAMaiv.sngASmevdae....................................................................akpdvpEPES..PALT.TALKAFAT.L.TR...EQKLALSRTL.........D....GFVDCLASA..................T---.--..NP.NLTAKSVISanawhn................................ranwseaEWVTWC..TW..GW..YRHFCRLYSPYL-r............................................................................................
A0A078DUW3_BRANA/484-811               ......................................................yrysleeg----.....KEKTEEHQLSAELNRKV.KE.KQS.......ARDMMSWIEE.TIYPV.HGF-.---....----E.............VTLTVVVQTLL...EIGSKSFTHMV.T.VLE.R..YGQV..FGKL............CPD......................................................NDKQVM...L....LSQVSAYGK.NNA...Q...MTAVAMDR.MMGYRLVSNQAIVRWVFS................................PEN..VDQ.F.H.V.S.D.QpWEILGN.ALNKTYNR.......ISDLRKDISNITKNVLVA.........eKASan...arAEleaaesklslvegepvlge..........................................npgkmkrlkstvektgeaeVSLR..ESLE.AKEALLNR.A.LS...ETEALLLLLF.........Q....SFSAVLKERlpep.........akarsMEDL.--..KS.EDENSSAMEvdsengnpk...........................kkseigereQWCLST..L-..GY..LTAFTRQYAKE--i............................................................................................
H6BYI9_EXODN/537-789                   ..............................................................FKYN.....DESTPFSAEGKEIAQMI.RR.KAG.......NEEFTTIFEK.IEQDA.ASSG.--L....TEPAL.............ASADAFVTSIC...WVGSKSLSHVL.A.CIE.R..CKER..LMAI...........sTSS......................................................PTCRKQ...I....ITSVMDYWK.DQT...G...VGIAILDK.LLNYQILTPASVLEWALId..............................hVAR..GTL.L.A.K.T.W.C.YELVNN.TTRKVAGR.......---VRSIVGAIRQP----..........---.......--................................................................................GLGE..EQKA.ELQQALSR.E.LE...TMKTLFGIIE.........D....AVVSIRDGN..................QDEM.-M..ES.SDALRAEDE.............................................ALIRAW..GG..KW..ARVFQRKYAVE--ds...........................................................................................
A0A0A1SKZ6_9HYPO/535-774               ..............................................................FKYK.....NPDTPFSSEGQELANLL.RR.KAT.......DEDIQPVIDS.IESQA.AERG.---....LDPTA.............TAMDAFVTAIC...WVGSKSLSHVL.A.CID.R..SKTR..LLDA...........sVAS......................................................APARAQ...I....LSSVIAYWH.AHP...G...IALSILEK.LLNYSILTPLSVVDWTIGgtv.........................spngVDG..GAA.L.G.E.P.H.I.LEFVFR.TVSKVSSR.......---VRQLLANPEAG----..........---.......--................................................................................----..----.----DVDA.E.IT...QMRELFSTIS.........E....ALSAWADGS..................KEQI.TV..SE.ADA------.............................................ALIHRW..GQ..RW..LRMFQRHATIEE-a............................................................................................
A0A0A8LD62_9SACH/577-822               .............................................................l-YFR.....SPSFPFYESVINILDFF.HK.QPD.......TRSIAELENI.LKDVA.DVHG.SII....EDFNR.............FTVTLLIQAIV...FCGSRSLSHAN.K.YID.D..SREE..LKAI............LAQie.................................................vspEVKDQW...I....CEAVIRYWN.KNS...Q...NGYLILDS.LRYNGLVSSGAVLNFSLT................................EQYgvNMS.L.V.D.S.T.S.IESIFR.ILNELAIA.......------------------..........---.......--................................................................................----..----.--------.-.TD...KNVEPFEYVF.........N....RLVGAANDV..................VSQL.NT..S-.-DAI-VVPDldqevqat............................deelplldlAWKYES..IM..GF..LKSILRKYSDEF-s............................................................................................
A3LQD0_PICST/647-909                   ..............................................................FNFS.....LPELPLHGVASKVYDFVvAH.WKP.......NTDFDELCKE.ILEAT.KEFP.DIN....GIK--.............FMINLIFQTYA...YIGSRSIYSVV.S.ILS.R..DVNK..LKYL............SGSpieyteqepk.................................feeqeispeeiTDRQNW...I....IESIFRVWI.HQP...Q...EVFLILEY.LIEFGILKPENLVLKTLD................................LEN..NLI.L.E.N.V.S.C.MESMNR.VLFNSSIA.......------------------..........---.......--................................................................................----..----.------TD.K.GD...SFKKLILLLF.........N....AITRNLNAI..................SGEL.QE..DK.NEIIKITKDiedpeal..............................evskridqEWLFYE..YK..GL..LKSYFRRYIK---nse..........................................................................................
NCBP1_CHICK/487-763                    ..............................................................YKYGd..esNRSLPGYTVALCLTIAI.KN.KAS.......NDEIFSILKD.VPNPN.QDDD.DDE....G-FTFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVVYEVWK.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..AHD.F.T.R.F.Y.I.WEILHS.TIRKMNKH.......VLKIHKELEDTKARLARQ.........hKRRd.....sDDddrs.......................................................................sdredGPLE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMLLTEH..................LVRC.ET..GG.IDVFT----.............................................PWYKSC..IE..RL..QQIFLQHHQII--qq...........................................................................................
NCBP1_AEDAE/488-783                    ..............................................................YKYTm..egAASLPGTATAHKLVVAI.RQ.KCT.......PEDVLNELKD.LPNPR.ETSE.NDM....VESTFn...........pLKIDVFVQTLL...NLGSKSFSHTF.A.AIS.K..FHLV..FKTL............AET......................................................EEAQIC...I....LHNVFELWV.NHQ...Q...MMVVIIDK.LLKTQIVECSAVATWVFS................................KEM..VGE.F.T.K.M.Y.L.WEILHL.TIKKMNQH.......VTKLSKELSDAKERLDRN.........aE-Ss....ssESeeetapagtdavt.....................................................pqrrrkkpigdnadKPTE..EQVE.RMEEKLEA.A.YV...DQKRLFLIIF.........Q....RFIMILSEH..................LVKC.DT..DG.RDYDT----.............................................DWYRWT..VG..RL..QQVFMMHHEQVK-k............................................................................................
W6MLD3_9ASCO/663-882                   ..............................................................FLFN.....HAEHAHQSLCYSIYENL.QG.SGS.......VEDFDALIAQ.LKEEI.ANDE.T-V....ENAER.............YVITLLGQSVC...IIGSRSLTVID.G.ALD.I..FAAK..LHRAlg........qtV-Dsemdgenet...................................asepvseedqQIRRGW...L....VESVLRLWN.HEP...R...IAYLILEK.MYQHGFLVKNDIVDSLFS................................--N..LII.V.R.Q.T.H.A.VELMDR.LMDEETYK.......V--FTEKLSLKAEAAN--..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------dkwekhmlqqllkctirkfpayqa.....................................................................
G1PRS5_MYOLU/474-749                   ..............................................................YKYGd..esSNSLPGHSVALCLAVAF.KS.KAT.......SDEIFSILKD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.I.R.L.F.V.WEILHS.TIRKMNKH.......VLKIQKELDEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGALE..EQIE.RLQGKGES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TSILT----.............................................PWYKNC..IE..RL..QQIFLQHHQII--qq...........................................................................................
W5DXB9_WHEAT/5-126                     .............................................rkttrdiilwveeqivp----.....-----------------.--.---.......----------.-----.----.---....ANGAK.............FAVDVVSQTLL...DIGSKSFTHLI.T.VLE.R..YGQI..ISKL............CPD......................................................EEMQLL...L....MDEVSAYWK.NST...Q...MTAIAIDR.MMGYRLISNLAIVKWVFS................................PAN..VDQ.F.H.-.-.-.-.------.--------.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------vsdrpwev.....................................................................................
S3C9N4_OPHP1/649-983                   ..........................................................elss----.....TDESPFAVDGRELAALL.KR.KAP.......EEEIQAVIER.IHSQA.LDIG.G--....LDPLV.............TSTDVFTTAVL...WVGSKSLSHVL.A.AIE.R..TKDR..LLDA...........gAAS......................................................EAARAQ...I....LDAVMDFWA.AHP...G...VAVSIAEK.LLNYAILTPAVIVQWALKdpeassps...............ssssssspaPLS..SPN.L.A.V.N.Y.V.AELVFN.TVDKVTRR.......---VHQLVASKHASVAAVata...sdalD--.......-Aakerqrnppppvlpaaaaadan...................................ldvamdeedngasaanalaeaalAQAH..ADVE.AARAAEEA.E.TK...AMRDLFKMLN.........E....ALQPWLTSSagsg.........tsfaaT--F.ST..ST.SPDNDG--Ee..........................................eaKETKAW..AE..RW..QRVVQRRAAVEE-a............................................................................................
A0A0E0KDN4_ORYPU/444-790               ......................................................fryhsdeg----.....KESTDGHRLSKELVGMV.RG.RKT.......QGDIISWVDG.QIIPV.--NG.---....---AK.............FALDVVSQTLL...DIGSKSFTHLI.T.VLE.R..YGQI..ISKL............CPN......................................................EEMQLL...L....MDEVSAYWK.NST...Q...MIAIAIDR.MMGYRQISNLAIVKWVFS................................PAN..VDQ.F.H.V.SdR.P.WEILRN.AVSKTYNR.......IFDLRKEIQTLRKGLQAAkv.....aseK-A......aREleeaksiieivdgqpvpse..........................................npvrlrrlqvradktkaeeVTTE..ESLE.AKEALLAR.G.LE...ESKELLRLLF.........K....SFVEVLTERlppisa......dgdvpnL---.--..--.-----RAGDpnvnsaardpeattmeidneng.adndsqlngqnkkighnvgeleQWCL-C..TL..GY..LKSFSRQYATE--i............................................................................................
G4UD99_NEUT9/533-786                   ..............................................................FKFA.....DDKTPFAAEGKEIAALL.RR.KAP.......EEEIEPVIER.IHSLA.LDNN.---....LDPLV.............ASTDVFVTSVL...HVGSKSLSHVL.A.AIE.R..TKER..LTDA...........gATS......................................................EAARTQ...I....ISSVMEYWS.AHP...G...VAIAIIEK.LLNYSILTPQAVINWAITty............................agATR..GEA.L.A.K.G.F.V.YEMVFN.TVVKVTSR.......---LRQVLQKA-------..........---.......--................................................................................--TL..PEAM.IDDETIEA.E.IN...GMRSLFRAIE.........D....ALFAWASGSkd..............emLEAS.DG..LG.EGDGTSETE.............................................KLVKRW..GE..RW..LRVFKRRAAIEE-a............................................................................................
A0A0C4E5K4_MAGP6/541-787               ..............................................................FKFA.....KDDVPFAAQGREMVKLL.KS.KVP.......DEEIQPLIEQ.IQNEA.VDQG.---....RDPLV.............SSTDVFMTAVL...AVGSKSLSHVL.A.CIE.R..VKDR..LLDS...........gSAS......................................................AAARTQ...I....IAAVMAYWS.AHP...G...VALSIVEK.LLNYAILTPQVVVEWAVGa..............................eAGD..EAR.L.A.H.S.Y.L.YELVLN.TVIKVSGR.......---ARQMVAQQQTAKPTAdg.....dliM--.......-Adasngdg..................................................................aghvpyvD---..----.------TP.E.AK...DLRELFQLIE.........S....ALKARIRDA..................MEDT.--..--.---------.............................................------..--..--..-------------teddfaadvgfavnathl...........................................................................
G0WB81_NAUDC/580-826                   .............................................................l-YFL.....QENVPFETQVRDILKYM.HK.PNN.......QRDMDELQGI.LDEIR.TRYQ.SMI....REMDE.............FIVVLLTQCVT...YSGNRSLSHSN.K.YIN.D..LQQD..LHIAls.......dlnLST......................................................CTKEFI...M....IESILRFWN.NNS...Q...TGFLVVDA.FRYSGLVSSKAVIDFVLKs..............................yNGK..IYG.L.T.D.D.T.A.IECIFR.TLTRGRIT.......------------------..........---.......--................................................................................----..----.--------.-.RV...NNFLGAQYVF.........Q....KLYSVLFET..................VEEY.EK..RG.YISIEVLPTfdsslyv..............................dsfekwniKWKYNQ..TM..LL..MKSIIRRYASNL-s............................................................................................
A0A0L9SR40_9HYPO/536-778               ..............................................................FKFN.....HAETAFSAEGQEMGALL.KR.KSS.......DEEMQAVIDR.VQAQA.NEQG.---....LDPVV.............ASTDVFMTAVC...WVGSKSLSHVL.A.CID.R..SKGR..LNDA...........gEAS......................................................PAARAQ...I....MTAVMSYWR.AHP...G...VALSILDK.LLNYSILSPVSIVDWTLVag............................spGGG..VQA.L.A.Q.P.H.M.LELVRN.TVAKVSGR.......---VRDVLTSADSD----..........---.......--................................................................................----..----.--AEAREK.E.TQ...AMRNLFKAIN.........D....ALAVWAGEG..................KDQK.MM..--.DDGDAADRE.............................................AMIRRW..GS..RW..LRVFRRMAAIEE-a............................................................................................
F7GRU0_CALJA/485-760                   ..............................................................YKYGd..esSNSLPGHSVALCLAVAF.KS.KAT.......NDEIFSILKD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.T.R.L.F.V.WEILHS.TIRKMNKH.......VLKIQKELEEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGALE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TSVLT----.............................................PWYKNC..IE..RL..QQIFLQHHQII--qq...........................................................................................
A0A068XIS9_HYMMI/572-890               ................................................hptescendteggk----.....-----------------.--.---.......----------.-----.----.NEE....MDKDEplaqcl.ipgvssLELELFMAALL...LRAHKTISHTY.S.LLS.R..YVDV..FRAL............AST......................................................VDLQIE...A....LHILQVVWY.DQS...Q...MVVAISNY.MSREGMLDPESIVLWAFSpsmsaftn...............dpdfnppssVHI..RPQ.L.L.Q.S.H.V.WECLMH.TLIRVSQR.......VVQVSSGLEDVKDGMGSSrr......rsR--.......-Srsrsdgsssedehgdtdlrkkinrgr............................rhhhrdrsyqfrsrshdssddgvrrpNVSP..DRLA.HMEEVRGE.A.LR...SQLSVITLLL.........H....RNMRLINDV..................SNEM.EK..ME.SLGESQTVMrn.........................................leSVAFWI..KG..RL..MQSVLEHQDQ---ly...........................................................................................
A0A016PN93_GIBZA/532-777               ..............................................................FKFK.....NPETPFSKEGMEIAGLL.RR.KAA.......DEEFQPFIDS.IQSQA.SELS.---....LDPLV.............VSTDVFMTAIC...WVGSKSLSHVL.A.CID.R..AKGR..LLEA...........gNTS......................................................EAARAQ...I....ISALMSYWH.AHP...G...IALSITEK.LLNYSILTPLTVVDWAIVast.........................pangANG..GES.L.A.E.P.H.I.FELVSN.TLTKVATR.......---SRQVI----SSP---..........---.......--................................................................................----..---D.TDDETRAK.E.VK...SIHDLFRATN.........D....ALISWAGGS..................KDEL.ME..EG.DGS--SDRE.............................................AMIRRW..GQ..RW..LRVFNRMGAVEE-a............................................................................................
F1PUP7_CANLF/485-760                   ..............................................................YKYGd..esSNSLPGHSVALCLAVAF.KS.KAT.......NDEIFSILKD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.T.R.L.F.V.WEILHS.TIRKMNKH.......VLKIQKELEEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGALE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TSVLT----.............................................PWYKNC..IE..RL..QQIFLQHHQII--qq...........................................................................................
A0A091CMF8_FUKDA/413-542               .............................................................a----.....-----------------.--.---.......----------.-----.----.---....-----.............-----------...-----------.-.---.-..----..----............---......................................................------...-....---------.---...-...--------.------------------................................---..---.L.A.K.L.F.V.WEILHS.TIRKMNKH.......VLKIQKELEEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGALE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TSVLT----.............................................PWYKNC..IE..RL..QQIFLQHHQII--qq...........................................................................................
A0A0N5CYW2_THECL/527-792               .............................................................y-DLN.....DEEHPDHDFAATLEKAF.RD.KIP.......AEEMNDLLRD.ATVNN.MDIS.---....-----.............SKMSIFLKVLL...FLARKTFSHNF.A.ALT.R..YYLT..LKEF...........iGNR......................................................EDVQLN...I....LRSLYETWK.FHK...Q...MITVLVTK.LLKMSIVDASSVVAWVFS................................DEI..KPE.F.E.R.L.W.V.WEVLSR.ALEHVSGH.......VRRSKAALVNMKLRRKWKg........qN-R......dEDfvmet.....................................................................deqsmvHLNA..TEVP.VKENEIEV.L.DE...CLKNLLLDVL.........H....KFTVTLTEH..................IINC.EN..NG.TNFET----.............................................SWYLYV..TG..RF..KNVFLKHWND---lf...........................................................................................
I4YFG6_WALMC/517-808                   ..............................................................FIYA.....NEENPFNGIAMNMMDAL.KN.RAT.......SDQLTAQFDK.IEDEI.KVNA.SLP....LNDVSa..........kkVSRDIISQCLL...NVGSRSFSHFL.N.VIE.K..YMEI..LKKF............YQE......................................................KEDRID...L....LRSVDRFWI.KNS...Q...MKKIIVDK.LLQYRLLDPTDVINWLFKpndetf....................pneiddRNP..AIA.W.S.D.I.N.F.GELLKT.TLNKVNSR.......VYQQGLKLAENKKKDEEEas......iaKAK......sMQvddeg......................................................................amtvkNEEN..KDNS.HSQITYDN.L.KK...EQRECFVILI.........K....SFVEALEGV..................DSIA.DL..SI.EEYSN---S.............................................DWDKWL..SW..SW..YQAFLREYWPS--is...........................................................................................
W9XQM4_9EURO/539-791                   ..............................................................FKYN.....DESTPFAAEGKEIAQLI.RR.KAG.......NEEFTPIFEK.IEQDA.TASG.--L....SDPAH.............ASTDAYVTSIC...WVGSKSLSHVL.A.CIE.R..CQER..LLAL...........sSTS......................................................PTCRKQ...I....ITSVMDYWK.DQT...G...VGVVILDK.LLNYQILTPASILEWVLId..............................nVAR..GTL.L.A.K.T.W.S.YELVSH.TTSKVAGR.......---VRSIVGAIRQP----..........---.......--................................................................................GLPG..EQQG.ELQQALAR.E.LE...TMKNLFSIIQ.........D....AAVSIRDGN..................QDEM.-M..ES.SDALRAQEE.............................................DLLKAW..GG..KW..ARVFQRKYAVE--ds...........................................................................................
A0A067QQW6_9HOMO/541-846               ..............................................................YEYD.....DPLRPYHDSAQSVLNLL.RG.RAK.......PEDVIALLDT.IKNTL.SETS.DGD....VNIDS.............VIRSIAVQSLL...HIGSRSFSHFL.N.AIE.R..YLPL..LRSL...........aAPG......................................................DEARLD...I....LTACSIFWK.RNR...Q...MIAIVFDK.LMQYQIVNPTDVVGWTFNygvg........................nergSSS..GPL.S.L.N.A.H.D.WDLLKG.ALDKANGR.......VVVARRRVTALRKEEDDT..........RARv....raSDgadvtsmev..............................................................dadanqddpTVDS..PALT.SALKAFAS.L.TR...EQKAALSRTL.........T....GFIDCLAPL..................ASDR.HA..NP.ASRD-VVQEkkwhnr.................................anwgqdEWNAWE..TW..GW..YRHFCRAYAPYL-r............................................................................................
H2AU78_KAZAF/579-755                   ..............................................................FFYL.....QDDFPYQNFTERIIEYF.HL.SSK.......ERHMGKLFDI.VNTLK.ENYK.TEI....SNFDH.............FIISLLIQCLC...FSGRRSLSHAN.K.YID.D..FADD..LKAI............FKTli.................................................ldrSIIEFT...I....VQAILRFWN.TSS...Q...TGFLITNT.VKFKGLVSSKAILEFILTe..............................aENR..NFA.L.T.D.Y.T.A.VECIFK.NLDDEQ--.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------ysystkfet....................................................................................
U1MDT0_ASCSU/530-812                   .............................................................c-EFE.....NEEEPVSVLAMLLSDLI.KN.KIT.......PEELTETVTG.REVED.YSED.---....-----.............VVLSTLVAVLL...SLSKKTISYTF.A.ALT.R..YLKT..LKQL...........vGSS......................................................EESQMT...V....LKGLYSVWK.HNH...Q...MMCVIANK.MVTMTIVDSSAIVAWIFS................................DEM..KFE.F.E.R.L.W.T.WELLGD.AVEHVSGH.......LRRCRIKLEEVRKRNNAK.........rE-Evik.rgaESkvspspensda.........................................................dkdssddskdedEMNQ..EDEN.SLEIEIDD.L.RE...YLENLLLDIL.........H....KFTVKLTEY..................IVVC.DS..KG.KDFNT----.............................................SWYKYF..TD..RF..RGFFLKNWRE---mfe..........................................................................................
S7Z6B7_PENO1/534-787                   ..............................................................FKYA.....SETTPYAKEGQELMQLI.RK.KAS.......DDELQPVLTA.IEEQA.QGLG.VD-....-EPKV.............PSTDALVTSIC...FVGSKSLSHVL.S.CIE.R..NKDR..LLAI...........gAAS......................................................EKARLQ...I....ITSVMEYWR.DQP...G...VAINIIDK.LLNYTIISPMSVLEWVLTe..............................hIAA..GAI.L.S.K.S.H.I.YEMVFA.TVGKVTNR.......---MRQIVAARAQK----..........---.......--................................................................................NLYE..PQLS.VLEETLLR.E.RA...EMQNLFKFIE.........D....SLVSVASGSnd..............elMERG.DG..SG.DLPED----.............................................AILRQW..GR..RW..LRVFRRKALVEE-a............................................................................................
B2B7F2_PODAN/518-764                   ..............................................................FKFA.....NDDTPFAAEGREIAALL.KR.KAP.......DEEIDAVIQR.IQSQA.IDRD.---....LDALV.............ASTDVFVTCVL...YVGSKSLSHVL.A.AIE.R..TKDR..LADA...........gAAS......................................................DASRTQ...I....IEAVMTYWS.VHP...G...VALSIVEK.LLNYSILTPLTVINWALNvq............................agKTR..GEA.L.A.W.A.H.M.YELVFN.TVIKVTGR.......---VRQLVVKASQ-----..........---.......--................................................................................----..PDEM.VDDETRDN.E.VR...NMRELFRAIE.........D....SLGAWAGGT.................kDEML.ES..NA.RGEED----.............................................GLVRRW..GT..RW..LRVFKRRQAIEE-a............................................................................................
F6PKJ4_CIOIN/486-765                   ...................................................fkydfksglnl---S.....QEERAAYTASQRVITAI.KT.KCK.......DDELIIILEE.IHQEE.ASTD.G--....TTFCL.............PRLEVFLQSLL...FLAQKSFSHSF.S.ALY.K..FHKV..LKWA............GDG......................................................EEGKIA...I....LSITKDVWK.NHP...Q...MMLVLVDK.MIRMQIVDCASVAKWLFS................................PKM..ADD.F.T.R.L.Y.V.WEIMHS.TIRKMNKH.......VQKLEVELTEMRGKSQIS.........eK-Ks....edEEddimr......................................................................tynifAPNQ..TDLQ.RMQDQLDA.A.NG...EQKKLFLIIF.........Q....RFIMILSDH..................LVRC.ES..NK.TAFNS----.............................................PWYRNT..IQ..RL..QEIFLLHKDTV--kk...........................................................................................
A0A0N1P1T4_9EURO/543-789               ..............................................................-KYE.....KEDTPFSATFKEIVQSL.RK.RAP.......IEEVKPLLEK.VEGDA.EAAG.YDA....VQAKT.............VVLDVLITSIA...WVGSKSLSHVL.S.MVE.R..YKPV..IDEL...........iGGD......................................................LAMQSQ...L....IASFVEYWQ.FQL...G...VAITIVLK.LVNYQIVTPLGVVSWAFNp.............................agGDG..GRN.L.S.K.V.F.V.WEAVTG.VLLKVENK.......---VRELVRATRTP----..........---.......--................................................................................GLED..EERE.RVKAVLDA.EmRD...SFHGLLAQIK.........N....GLQGILQGG..................QGGL.--..--.TEEDE----.............................................ALVKVW..IA..KW..QWA----------mdrrekvl.....................................................................................
U6G7J2_9EIME/829-983                   .............................................ldrcskdmegapwctdd----.....-----------------.--.---.......----------.-----.----.---....-----.............-IIRLFVFCLL...SLGSKTQTHLH.R.LLS.N..YAET..FRLY...........tT-Qnehtp...........................................eeqqphIDVHPA...V....LQAIQKYWT.TSQ...Q...RTALTLHA.FLKTGILRRDRVLQLLCSa..............................dQGD..RDS.W.S.Y.L.E.F.IETV--.--------.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------lrgavdecetareaaveegapmptgt...................................................................
D7L031_ARALL/484-814                   .....................................................fiysleegk----.....-EKTEEQQLSAELSRKV.KE.KQT.......ARDMMVWIEE.TVYPV.HGF-.---....----E.............VTLTIVVQTLL...DIGSKSFTHLV.T.VLE.R..YGQV..FSKL............CPD......................................................TDKQVM...L....LSQVSTYWK.NNV...Q...MTAVAIDR.MMGYRLVSNQAIVRWVFS................................PEN..VDQ.F.H.V.S.D.QpWEILGN.ALNKTYNR.......ISDLRKDISNITKNVLVA.........eKASan...arVEleaaesklslvegepvlge..........................................npakmkrlkstvektgeaeLSLR..ESLE.AKEALLNR.A.LS...ETEVLLLLLF.........Q....SFLGVLKERlpdptk......vrsvqdL---.KS..IG.AEDD----Kssamdvdseng......................npkkscevgereQWCLST..L-..GY..LTAFTRQYAS---ei...........................................................................................
J9DTD6_WUCBA/2-85                      .............................................etnehnnmgdpntvesf----.....-----------------.--.---.......----------.-----.----.---....-----.............-----------...-----------.-.---.-..----..----............---......................................................------...-....---------.---...-...--------.------------------................................---..---.-.-.-.-.-.-.------.--------.......------------------..........---.......--................................................................................----..----.VKESEFAD.L.HE...CLKNLLLDVL.........H....KFTVTLAEH..................IVNS.ES..NG.NDFQN----.............................................NWYLYV..TG..RF..KNVFLKHWRD---lfe..........................................................................................
A0A0F4Z9T5_9PEZI/534-803               ..............................................................FKFN.....NSEIPFSAEGVELAGLL.RH.KAD.......DDAFQPIFDK.IQTSA.LDIG.---....VDPLV.............SCVDVLMTAVC...WVGSKSLSHGI.A.CIE.R..AKPK..LAEF...........aAAS......................................................EAACSQ...I....MTSIAKYWK.FHP...G...ITIALIEK.LLIMAVLPPTAIIQWALSmteh........................vdevSAK..DSS.L.C.K.S.L.V.FEIVLN.TIDRVIQR.......---LHQPLEGSEFTPDMD..........---.......--................................................................................----..----.--------.-.--...----DLNALL.........E....AITAAVEGI..................----.-P..SG.DEDGV----.............................................DATKTW..KA..RW..VRVFKRKAAVQ--nvlaaekqvakeikdkeeeelareaqadveakaadmeaime....................................................
A0A0N4WSI7_HAEPC/468-732               .............................................................c-KFD.....DENQPGYEAASKFLALI.QS.RSD.......DNAIMAEIRD.EENR-.--YD.---....P----.............DLFGIFFAVLL...KTSAKSFSHTF.V.ALS.R..YSTT..LKTI...........aDTS......................................................DEMQEV...L....LCCLFQCWR.NNH...L...RIIILVDK.MLKMQILDCGVVISWIFS................................ESL..KSE.T.D.R.Q.W.V.WEVLNT.ALERLSRH.......IHKVAHDVDILQKRVERQr........iEAGe.....eMEds...........................................................................dvkTREQ..EELE.QQQEKLEN.L.KD...FQKSLFLDVL.........HvsrmKFTVLLTEF..................IVHC.ET..EG.TDFRT----.............................................PYYAWI..NG..RF..KQIFLMHGAD---lhe..........................................................................................
A0A017SKH2_9EURO/532-785               ..............................................................FKYS.....VDTTPYANEGRELMQLI.RK.KAG.......DEEIQPIIAS.IEEQA.KEHG.VE-....-EPML.............PSTDAFVTSIC...FVGAKSLSHVL.S.CIE.R..NKER..LLAI...........gPQS......................................................SRARNQ...I....VTSVMEYWA.DQP...G...IAINIIDK.LLNYTILTPLSVIEWALVe..............................nLAA..GNI.L.A.R.T.E.I.YEMVAA.TIGKVTNR.......---LRQIV----AARVQP..........---.......--................................................................................GLYE..PQLS.VIDDTLHR.E.KA...DMQALFKVTE.........D....SLVSIANGSnd..............eqMERG.DG..SG.GLPED----.............................................GILRQW..GH..RW..LRVFRRKAAVEE-a............................................................................................
K1Y1E7_MARBU/538-779                   ..............................................................FKYA.....LQDTPFSQEGQEILALL.KK.KSP.......EADIQPIIDR.IHLQA.RSLA.--L....PDELV.............CSTDAYMTSIC...YIGSKSLSHVL.S.CIE.R..CKDR..LLAL...........gPAS......................................................PAARTQ...I....IDSVMLYWK.DQP...G...IGVNIVDK.LLNYTILSPASVVDWALS................................N-E..GSR.L.G.K.A.Y.V.YEMVSS.TIGKVTNR.......---VRQVVQANRVP----..........---.......--................................................................................GLSP..EAKA.LMSETVVR.E.KA...SMKELFDLME.........R....ELVGWVQGS..................KAVG.--..--.D-GEG----.............................................EMVKQW..GE..RW..LRVFRRKFAVEE-t............................................................................................
A0A094DN20_9PEZI/549-800               ........................................................ikltkl----.....--DTPFAAEGREIHTLL.KR.KAP.......EPEIQTVIDQ.IHTQA.TTIA.--I....HEPLL.............SSTDAYVTSIC...YIGSKSLSHVL.S.CIE.R..CKER..LLSI...........gNTS......................................................ETARRQ...I....ITSVMAYWV.DQP...G...IGVNIVDK.LLNYTILTPLSVVEWALLd..............................dTKA..GDK.L.A.E.P.F.V.FEMVAG.TVQKVTNR.......---LRQIV----ASRNAP..........---.......--................................................................................GLEH..EQRL.LLDETLLR.E.RV...AMKDMFKVME.........D....ALFSWAAGS..................KDQA.ME..AG.IGETT--DE.............................................AFIQRW..GE..KW..LRVFRRKMAVEE-a............................................................................................
M5BLJ3_THACB/522-724                   ..............................................................YAYE.....DSDHPHYQVAAGLLTMI.KD.RAK.......ADEVTAHCLK.LARSV.----.---....-----.............PIQHMVMQALL...HVGSRSFSHFL.N.AVE.R..YLPL..LRGE............AGSdvst..............................................seknKEKARI...I....LCAAGEYWE.RNQ...Q...MVGVVFDK.LMQYQIIEPSDVVDYAFEl.............................saKGG..GTP.G.L.S.C.E.R.WLLVEA.ALNKANGR.......VVSAKRKVATLNKQEEDR..........R--.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------araianaggigmdvdgdaqpgt.......................................................................
B6K6M4_SCHJY/513-722                   ..............................................................FPYG.....AEDHPMNVTSHKITNQL.TM.REP.......IASIEAELSS.FSQEE.----.---....-----.............-ALRLFFSCVF...HMGSKSFSHML.N.VFE.K..HIDV..IKHF...........sRAS......................................................SDSEYI...V....VSSLFEYWK.FQP...T...IAVTWADK.LLNYSIVGATAIIQWLTK................................QDD..IRL.W.S.R.I.Y.V.WDLLTT.TLNKLDAR.......VKQFDNSEATEGTEENVL..........KE-.......--................................................................................----..----.-------E.S.TT...E---------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------rravyellrtrlpelaqsaslpwsahyvqlvqay...........................................................
J5PTH5_SACK1/578-825                   .............................................................l-YFR.....QEGVPMENTVRKILDYT.HK.ANN.......SRDVTELESI.LEELK.NEHG.SII....TDFDR.............FVIILLVQAVV...DSGSRSLSHAN.K.YIS.D..LKED..LKTI............FAKie.................................................ldvEAKEYI...I....IEAVLTFWN.ANP...Q...TGFLVADA.FKYAGLITSKTIFTFIFNe..............................tGFE..NNG.L.V.E.A.T.A.IEAVFR.NLSQQISE.......------------------..........---.......--................................................................................----..----.--------.-.EN...ESENNFEFVF.........E....RLCTIVNNT..................IDLL.NV..TN.DDDIE-IPEvnnemdvd............................dveddkldlKWKCVT..AI..GF..IKSILRRYSYEY-r............................................................................................
A0A067E938_CITSI/419-764               ..............................................................FKYSme.dgRERSEEHALSAELTNKV.KG.RQT.......AREIIVWVEE.SVYPI.HGLG.---....-----.............VTIKVVVQTLL...DIGSKSFTHLI.T.VLE.R..YGQV..ISKI............CPD......................................................HDKQLM...L....IEEVSLFWK.NNT...Q...NAAISIDR.MMGYRLISNLAIVRWVFS................................PEN..IDQ.F.H.A.S.DrP.WEVLRN.AVSKTYNR.......ICDLRKEIISLKKGVTLAee.....aaaKA-.......-Kaeleaaesklslvdgepvlg........................................gnparlsrlklhaekakneeISAK..ESLE.AKEALFAR.A.VE...ENEALYLSLY.........R....NFSNVLMERl...............pdASR-.--..--.---------.............................................------..--..--..-------------agtlqdlksthadamavdleepsameldnengrpkksqsnggssgnvynigekeqwclstlgyvkafsrqyasei..................
W5PNL6_SHEEP/487-762                   ..............................................................YKYGd..esSNSLPGHSVALCLAVAF.KS.KAT.......NDEIFSILKD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.T.R.L.F.V.WEILHS.TIRKMNKH.......VLKIQKELEEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGALE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TSVLT----.............................................PWYKNC..IE..RL..QQIFLQHHQTI--hq...........................................................................................
A0A0D2XCF3_FUSO4/531-776               ..............................................................FKFQ.....NSETPFSKEGQEIASLL.RR.KAP.......DEEFQPLFES.IQTQA.SEQS.---....LDPIV.............ASTDVFMTAVC...WVGSKSLSHVL.A.CID.R..TKGR..LLEA...........gNSS......................................................EAARAQ...I....ISAVMSYWH.AHP...G...VALSIIEK.LLNYSILTPFTVVDWALVast.........................pangTDG..GDS.L.T.E.P.H.I.FELVFN.TIFKVTRR.......---SRDVV-A--------..........---.......--................................................................................----..-APE.TDEETRIK.E.IK...STRDLFRAMN.........D....ALVSWAGGS..................KDEL.ME..GG.DGS--SDRE.............................................AMIRRW..GQ..RW..LRVFKRMGAIEE-a............................................................................................
M3HQQ7_CANMX/613-791                   ..............................................................FNFT.....NSQLPFHEVGSRVYDFIlTH.WKS.......NTEFNELYKS.ILADV.-DV-.---....PNRER.............FAINLILQTYA...YIGSRSIYSVV.S.IFS.R..DINK..LKFL............SGApidyvgeeaq.................................fedlhlteeqkENRQNW...I....IESIFRIWV.HQP...Q...VVFLIMEY.LIEFGVINPKYLLSKSLE................................S--..HLI.I.D.N.V.S.C.MESINR.ILSNSQSK.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------e............................................................................................
A0A0D9Z791_9ORYZ/483-829               ......................................................fryhsdeg----.....KESTDGHRLSKELVAMV.RG.RKT.......QGDIISWVDE.KIIPV.--NG.---....---AK.............FALDVVSQTLL...DIGSKSFTHLI.T.VLE.R..YGQI..ISKL............CPN......................................................EEMQLL...L....MDEVSAYWK.NST...Q...MIAIAIDR.MMGYRLLSNLAIVKWVFS................................PAN..VDQ.F.H.V.SdR.P.WEILRN.AVSKTYNR.......IFDLRKEIQTLRKGLQAAke......asE--.......-Kaareleeaksiieivdgqpvp......................................senpgrlrrlqaradkakegeVTTE..ESLE.AKEALLAR.G.LE...ESKELLRLLF.........K....SFVEVLTERlppisad...gdvpnlraG---.--..--.--------Dpnvnssardpeattmeidneng.gdndsqlngqnkkishnvgeleQWCL-C..TL..GY..LKSFSRQYATE--i............................................................................................
A0A0A2VE17_BEABA/534-788               ..............................................................FKYK.....NPDTPFSAEGQEIGALL.RR.KAT.......DEEIQPTIDA.IQAQA.KERA.---....LDPVV.............TSTDVFVTAMC...WVGSKSLSHVL.A.CID.R..SKVR..LLDA...........gAAS......................................................PAARSQ...I....ISSVMAYWH.AHP...G...VALSIIEK.LLNYSILTPFSVADWAILads.........................ashkGSP..GAA.L.A.Q.P.H.I.YEAIFN.TVSKVTAR.......---VRQLVTAAAPS----..........---.......--................................................................................-NSE..AAAV.DEEETRAK.E.VA...DMTELFRTIN.........D....ALEAWAGGS..................KDEL.MQ..QD.GASET--DD.............................................ALIRRW..GQ..RW..LRVFRRRAAVE--aa...........................................................................................
NCBP1_DROPS/488-770                    ..............................................................FKYAs..eeAASLPGTAVAHQLVVAI.RQ.KCS.......PEEVVNILKE.IPNSG.YSGE.EMS...dGTFNA.............LKIDVFVQTLL...NLGSKSFSHSF.A.AIS.K..FHSV..FRAL............AET......................................................EEAQIC...V....LHNIYELWS.SHQ...Q...MMVVLVDK.LLKLQIVDCSAVATWIFS................................KEM..TSE.F.T.K.M.Y.L.WEILHL.TIKKMNKH.......VIKLNTELSVAKDKLSKAds......ssS--.......-Esdedaptk...............................................................rkkpithadKPSE..EAVE.RMEEKLEA.A.NV...NQKRLFLIVF.........Q....RFIMILSEH..................MLRS.DT..DG.RDPDT----.............................................DWYRWT..IG..RL..QQVFLMHHEQVQK.............................................................................................
B6GXX9_PENRW/531-784                   ..............................................................FKYS.....SEMAPYSKQGQELMQLI.RK.KAS.......DEEIQSVITA.IEDQA.KSQG.V--....EDPKI.............PSTDAFVTSLC...FVGSKSLSHVL.S.CIE.R..SKDR..LLAI...........gTES......................................................QRARCQ...I....ITSVMEYWV.DQP...G...IAINIIDK.LLNYTILTPLSVLEWALSe..............................sVAA..GTI.L.S.K.P.H.I.FEMISA.TVGKVTNR.......---MRQIV----AARAQP..........---.......--................................................................................GLYE..PQLS.VIDETLVR.E.RT...DMQSLFKYIE.........D....SIVSIAAGSnd..............qqMERG.DG..SG.TLPED----.............................................AIIRQW..GR..RW..LRVFRRKAAVEE-s............................................................................................
A0A0D3FIE9_9ORYZ/483-829               ......................................................fryhsdeg----.....KESTDGHRLSKELVAMV.RG.RKT.......QGDIISWVDE.KIIPV.--NG.---....---AK.............FALDVVSQTLL...DIGSKSFTHLI.T.VLE.R..YGQI..ISKL............CPN......................................................EEMQLL...L....MDEVSAYWK.NST...Q...MIAIAIDR.MMGYRLLSNLAIVKWVFS................................PAN..VDQ.F.H.V.SdR.P.WEILRN.AVSKTYNR.......IFDLRKEIQTLRKGLQAAke......asE--.......-Kaareleeaksiieivdgqpvp......................................senpgklrrlqaradkakegeVTTE..ESLE.AKEALLAR.G.LE...ESKELLRLLF.........K....SFVEVLTERlppisad...gdvpnlraG---.--..--.--------Dpnvnssardpeattmeidneng.gdndsqlngqnkkishnvgeleQWCL-C..TL..GY..LKSFSRQYATE--i............................................................................................
A0A090N3S9_OSTTA/512-742               .........................................lqqmlaekrqgyevvqwigse----.....-----------------.--.---.......----------.-----.---G.ATM....ASPEV.............LLRSLVVAAL-...ERGQKCITHHD.V.LLK.R..YAAP..IREL............VEK......................................................AGGEVA...-....VDAAVGIWR.GHY...Q...MAPIAVER.LLALDLVAPSAVVNWVVQ................................--R..AAV.F.G.E.D.D.T.YEIAST.VCDFVCASea...svVGKRSALVSKIRAAEAEAsg.....agrA-A.......EElsaqgrsyeaqq........................................................aaaaeaqaveeiAQHE..AELA.ATEAPIAR.A.NA...LARETCLQLC.........G....---------..................----.--..--.---------.............................................------..--..--..-------------glvkasahga...................................................................................
M9M7J7_PSEA3/633-929                   ..............................................................FTYA.....GPEHPYHAAATALLSSI.RA.KAS.......ADVILADFES.FKASI.ISQL.PQD....--GMVgsmd.....eaevVVRDLVVQCVL...QVGSRSFSHLL.N.IVE.R..YHGL..LRTL............SRS......................................................ARMRAA...M....LAAAVRFWI.RSP...Q...WLHIVVDK.LLQYRIVEPADVVEFIFNpprdep...................asiltagVSE..VGS.W.A.G.F.N.T.WGLLKL.TLDKVNGR.......VDQLRRRLEQSQRLEAEEle......rqE-Aaaa.agfEQeeskaepgmpl..........................................................fpttatlpvrpEEKA..PSAD.DARASLDA.I.RT...EQRKVLLTVV.........Q....GFLALKAEG..................----.--..--.---------.............................................-WNKWW..VD..GW..YTAFVRTFNRQ--ll...........................................................................................
C7YU08_NECH7/533-778                   ..............................................................FKFS.....NPETPFAKEGQEIGALL.RR.KAP.......DEDFQPIIDS.IQSQA.TERA.---....LDPLV.............ASVDVFVTAVC...WVGSKSLSHVL.A.CID.R..TKGR..LLEA...........gNAS......................................................EAARAQ...I....ISAVMAYWH.AHP...G...IALSIIEK.LLNYSILTPFTVVDWALGast.........................psngTNG..GDA.L.V.Q.P.H.I.FELVSN.TISKVTSR.......---ARQILV---------..........---.......--................................................................................----..-SPE.TDEETRSK.E.AK...TTQDLFRAMN.........D....ALVSWAGGS..................KDEL.ME..EG.DGS--SDRE.............................................TMIRRW..GQ..RW..LRVFKRMGAIEE-a............................................................................................
G3JGQ9_CORMM/555-803                   ..............................................................FKYK.....SSDTPFSAEGQQIGALL.RR.KAT.......DEEIQPIIDA.IQTQA.AERA.---....LDPVV.............ASTDVFVTAMC...WVGSKSLSHVL.A.CID.R..SKVR..LIDA...........gVAS......................................................PAAHAQ...I....ISSVMAYWH.AHP...G...IALSIIEK.LLNYSILTPFSVADWAILads.........................ashqGAP..GAA.L.A.Q.P.H.I.YEAIFN.TVSKVTAR.......---VRQVL----------..........---.......--................................................................................-AAP..PDSE.PDQQTRAK.E.VA...DMTELFRTIN.........D....ALESWAAGT..................KDEL.MQ..DD.GTSE--SEE.............................................ALIRRW..GQ..RW..LRVFRRRAAVE--aa...........................................................................................
Q5KMU1_CRYNJ/587-885                   .............................................................w-AYE.....KDDHPLHAEAAALLSQI.RQ.KLP.......STEIIKYITE.MPNAS.SG-P.GEP....LYP--.............AVRQMVFETIS...HLGSRSFSHFL.N.ATE.R..YSDV..LRFL............TPD......................................................FASRRI...L....LDAVNSYWR.RSS...E...MRLVTLDK.YLQYGILEGIDIVEWIFAdd...........................eaeGEE..GDG.W.T.D.G.D.K.WEVLSM.CLEKHLGR.......VKAISRRLKVIEREDEAA.........rA-Rk....agEQlergedvnv..............................................................eddtnedsrPETS..KEAR.DAQTSLDI.Q.ST...RLEKVLLATF.........K....HFIFALLPW..................TAER.--..--.EEGITTSSEglkgvlt..............................lldsdeegLWGVRA..KW..GW..YREFVRRYQAQL-m............................................................................................
T1JFR4_STRMM/1-270                     ............................................................mr----.....--SLPGTIAAHQLTTSI.KN.KCT.......AEEVFMIIKD.LPNPL.QEED.SE-....PTYNP.............LKIDVFVQTLL...FLGSKSISHTF.A.AIA.K..FHYI..FKTL............AVT......................................................EEAQIC...I....LRNAFELWR.QHQ...Q...MMTILVDK.MLKTQIVECFAVANWIFS................................KEM..VPE.F.T.K.I.Y.V.WEILHL.TIRKMNKH.......VQKLQKEVDDARDKLAKVvdlcckilqgD--.......-Ensn.........................................................................sekeRPTE..EMIE.RMEERLEA.A.QA...DQKNLFLIIF.........Q....RFIMILTEH..................IAKR.ES..EG.RDSNT----.............................................FWYRWT..IG..RL..QQVFLTHHDQVF-r............................................................................................
U3J9Q4_ANAPL/448-727                   ..............................................................YKYGd..esNRSLPGYTVALCLTIAI.KN.KAS.......NDEIFSILKD.VPNPN.QDDD.DDE....G-FTFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVVYEVWK.NHP...QkiqMIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..AHD.F.T.R.F.Y.I.WEILHS.TIRKMNKH.......VLKIHKELEETKARLARQ.........hKRRd.....sDDddrs.......................................................................sdredGPLE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMLLTEH..................LVRC.ET..GG.IDVFT----.............................................PWYKSC..IE..RL..QQIFLQHHQII--qq...........................................................................................
G8YF32_PICSO/650-914                   ..............................................................YVFS.....NSGLPLNEISKTVYDFIiAS.WKP.......NDEFKNLYDQ.ILESV.SEHP.DIN....SDK--.............FLINLIFQTYA...YIGSRSIYSVV.S.LFE.R..DIVK..LQFLsg.......veiNEErysgtdfkf...................................tklelsetqvANRQRW...I....VDSIFRIWI.RQP...Q...VAFLILEY.LIEFGILQPQYLIEKALD................................VNH..NLI.V.D.N.I.S.C.MESINR.VLSNQIKK.......-EGSDKLIL---------..........---.......--................................................................................NLFD..SIVK.NINHTLNS.L.RE...AEVDNPLKIV.........T....EFSE-----..................----.--..--.--------Eeiened................................vmeridnQWLLFE..YK..GL..LKSYLRKFG----efna.........................................................................................
H1V5N6_COLHI/541-787                   ..............................................................FKFN.....DDSTPFAAEGREIAALL.RR.KAP.......DEEFQPIIER.IHSLA.IERS.---....LDPLV.............TSTDIFVTAVC...WVGSKSLSHVL.A.CIE.R..TKDR..LLDV...........gAAS......................................................EVAKAQ...I....ITAVMSYWA.AQP...G...VAISIVEK.LLNYSILLPTTVIEWALVggn.........................hvegQSS..GDA.L.A.Q.P.H.V.FELVFG.TVAKVTGR.......---VRQLL----T-----..........---.......--................................................................................----..KEAE.ADEEAKER.E.TK...AMRDLFKSME.........D....ALVSWASGS..................KDEM.ME..EV.DGA--GQRD.............................................ALLRRW..GE..RW..LRVFRRRSAIEE-a............................................................................................
A0A067NZ14_PLEOS/550-856               ..............................................................FEYD.....EADHVHHDAAQSVLNLL.RG.RAK.......PDDVIAELET.LKSSL.ESSD.TEH....VD--S.............VVRSIVVQSLL...HIGARSFSHLL.N.AIE.R..YLPL..LRHI............ASAgvsst............................................ggsgnAEAKTD...I....LTAAATFWR.QNG...Q...LVGIVFDK.LMQYQIVDPTDVITWTFAngga........................vsdrNQH..TSK.Y.M.S.M.Y.E.WDLVKG.ALDKANGR.......VMIARRKVTALRKEDDETra......raN-Ar....vgETmevdad...................................................................gkadelpTSEN..PQLT.AALKAFAT.L.TR...EQKAALSCTL.........E....GFVGALTNP..................DQRV.QV..QQ.VVSASEWENret......................................wnseQWSAWE..TW..GW..YRNFCRMYSPYL-r............................................................................................
A0A0G4MMZ4_9PEZI/1971-2215             ..............................................................FKFS.....DETTPFSAEGRELAALL.KR.KVP.......DEEFQPVLDR.IHAAA.TEHS.---....LDALV.............TSTDVFVTAVC...WVGSKSLSHVL.A.CIE.R..VKDR..LLDI...........gAAS......................................................EAARAQ...I....ITAVMAYWR.AQP...G...VAISIIEK.LLNYSILTPLSVIEWSLVyn............................hsERE..GDA.L.A.E.A.H.V.FELVSN.TVTKVTGR.......---VRQIMTAPELD----..........---.......--................................................................................----..---A.DAEASKEL.D.KK...AMRDLFSSLK.........D....ALSSWKAGI.................kDEML.DE..PD.SEERK----.............................................AHLQRW..GA..RW..LRVFERKSAIEE-a............................................................................................
A2R4E7_ASPNC/548-801                   ..............................................................FKYS.....SDTTPYANEGREIMQLV.RK.KAS.......DEEIQPLINA.IEEQA.RSLG.V--....EDPLL.............PSTDAFVTAIC...FVGSKSLSHVL.S.CIE.R..NKER..LLAI...........gPQS......................................................AQARRQ...I....ITSVMEYWV.DQP...G...VGINIIDK.LLNYTILTPLSVIEWALVd..............................kLEA..GTV.L.A.K.S.H.V.FEMISA.TVGKVTNR.......---LRQIV----AARTQP..........---.......--................................................................................GLYE..PQLS.VLDETLSR.E.RV...DMQSLFRVIE.........D....SIVSVAGGSnd..............eqMERG.DG..SG.NLPED----.............................................EIIRQW..GQ..RW..LRVFRRKAGVEE-s............................................................................................
A0A0C4F0J7_PUCT1/370-692               ..........................................................nsni----.....--SHRDHLAALDVVQLL.KH.KEP.......VSRLLDYLTK.MQERL.AAE-.GIE....ESVQD.............VTREVAIQALL...NVGSRSFSHFL.N.ILE.R..YLEL..LRNL............TNS......................................................ASARAS...L....LQTVSKFWR.KNG...Q...FELIVIDK.LLEYRVIDPIDSLRHSFE................................TYK..TSQ.W.G.E.L.Q.F.WDGMKM.TIEKVTRR.......VKASRTKLAKLKKDEEDQr........dR-Qra...agGEileagngaanmgdinmkdgidge.................................egkkdeerteevkgetiqlkeeleTMRR..GEIA.TAERELEA.N.LT...EQVIVLAEAI.........G....RFSSARSEA..................EERL.KN..EQ.DSQPA--DEvvepsncdqkd.......................qvrkvsakdvaFWKAWW..LR..--..-------------atip.........................................................................................
A0A0F4GTG5_9PEZI/559-810               ..............................................................FKFN.....NDQTPYAKEGREVLALL.KK.KAA.......EEEIQKVLDS.VHAQA.SERG.V--....EDPLV.............PSTDIYMTSIL...SIGSKSLSHVL.S.TID.R..CKER..LLEI...........gGRS......................................................EAARRQ...I....VASVLDFWC.DHP...G...TAVNIVDK.LLNYTIITPMAVVQLAVQd..............................rIDR..GRA.L.A.S.S.Q.V.YEMVSI.TMFKVTNR.......---VRQVLRERNNI----..........---.......--................................................................................KLPF..EQRQ.QIDEALPR.E.RQ...GMRDLFAAIE.........D....AVSSVAAGAnd..............emIERY.--..DG.D----SEEQ.............................................QLIQLW..GS..RW..ARVWRRKAAIEE-a............................................................................................
U4TQ91_DENPD/16-284                    ............................................................mt----.....---LPGTAAAHQLVVTI.RQ.KCT.......PEEVLAVLKD.LPNPR.SEEE.-VD....GRFNP.............LKIDVFVQTLL...NLGSKSFSHSF.A.AIS.K..FHYV..FKIL............AES......................................................EEAQIC...I....LRNMFELWH.NHQ...Q...MMVVLVDK.MLKTQIVECSAVANWIFS................................KEI..GSE.F.T.K.N.Y.L.WEILHL.TIKKMNRH.......VTKLTGELTEAREKLARAee.....ssdS--.......-Esdeekk....................................................................kqedaeKPSE..EMVE.RMEEKLEA.A.QA...DQKNLFLIIF.........Q....RFIMILSEH..................LVRC.DT..DG.KDYNT----.............................................HWYKWT..IG..RL..QQVFLAHHEQVQK.............................................................................................
M4BIG7_HYAAE/207-459                   ............................................................ma----.....DETSPASEFYQSVTTKL.KG.HPP.......AAALHSWLNE.-ELPR.LEIS.R--....----T.............EAIEVVWTCIL...EAGAATFTHMR.L.LLE.K..YGKRgeLLGIsy.......qlgEDV......................................................TADELA...L....VKTVASVWL.KSP...Q...HIGLILNA.MLRQELFRPVAIVIWVFT................................PDA..VQQ.Y.S.W.P.Y.V.WEILRD.TLKFVQDA.......IDTKTQKMGQAAAPRSSE..........---.......-D...............................................................................rDEEM..LDVA.TLEDDRKR.L.QD...EMRQLLLLLF.........K....GFNRVLTEH..................KAEC.EA..ED.SDPHD----.............................................NWFHST..LA..QM..QAI----------ghryrvp......................................................................................
E3QAL0_COLGM/535-781                   ..............................................................FKFN.....DDSTPFATEGREIAALL.RR.KAP.......DEEFQPIIER.IHSLA.IERG.---....LDPLV.............TSTDIFVTAVC...WVGSKSLSHVL.A.CIE.R..TKDR..LLDV...........gAAS......................................................EVAKAQ...I....ITAVMSYWA.AQP...G...VAISIVEK.LLNYSILLPITVIEWALGgss.........................hvegQSS..GDA.L.A.Q.P.H.V.FELVFG.TVAKVTGR.......---VRQLL----T-----..........---.......--................................................................................----..KEAE.ADEEAKER.E.CK...AMRDLFRAMD.........D....ALISWASGS..................KDEM.ME..EM.DGA--GQRD.............................................ALLRRW..GE..RW..LRVFRRRSAIEE-a............................................................................................
G1N980_MELGA/39-270                    ..............................................................YKYGd..enNRSLPGYTVALCLTIAI.KN.KAG.......NDEIFSILKD.VPNPN.QDDD.DDE....G-FTFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVVYEVWK.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..AHD.F.T.R.F.Y.I.WEILHS.TIRKMNKH.......VLKIHKELEDTKARLARQ.........hKRRd.....sDDddrs.......................................................................sdredGPLE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....---------..................----.--..--.---------.............................................------..--..--..-------------.............................................................................................
Q7RSR4_PLAYO/828-987                   ................lffkslmffdssnvsslkrvfknhaviflsyknsgifktedeqiqf----.....-----------------.--.---.......----------.-----.----.---....-----.............-----------...-----------.-.---.-..----..----............---......................................................---EVE...L....LNIVYTYFN.-NC...A...LLNVIVNI.LIENKIVKEMSVIYFIFH................................KLS..DSN.L.D.E.Y.Y.I.VQLLYE.GVNNLIIK.......KENNENERNKLRRR----..........---.......--................................................................................-KAE..SENE.NLIKELED.E.KN...EIVN------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------kifhltnqti...................................................................................
W7AJD6_PLAVN/816-1026                  .............sililflkslmffdssnvsslkkvfknhaviflsyknsgifktedeqiq----.....-----------------.--.---.......----------.-----.----.---....-----.............-----------...-----------.-.---.-..----..----............---......................................................--FEVE...L....LNIVYTYFN.-NS...A...LLNVIVNI.LIENKIVKEMSVLYFIFH................................KLD..DSN.L.D.E.Y.Y.I.VQLLYE.GVNNLIIK.......RENNENERNKLRR-----..........---.......--................................................................................RKTE..NENE.NLINELEG.E.KN...EIVNKIFHLT.........N....QTIIMISEK..................MMAL.KN..NN.NSYMS----.............................................------..--..--..-------------kellkeslvflrtyieyididqflqqch.................................................................
G7XZ90_ASPKW/542-795                   ..............................................................FKYS.....SDTTPYANEGREIMQLV.RK.KAS.......DEEIQPFINA.IEEQA.RSLG.V--....EDPLL.............PSTDAFVTAIC...FVGSKSLSHVL.S.CIE.R..NKER..LLAI...........gPQS......................................................AQARRQ...I....ITSVMEYWV.DQP...G...VGINIIDK.LLNYTILTPLSVIEWALVd..............................kLEA..GTV.L.A.K.S.H.I.FEMISA.TVGKVTNR.......---LRQIV----AARTQP..........---.......--................................................................................GLYE..PQLS.VLDETLSR.E.KV...DMQSLFKVIE.........D....SIVSVAGGSnd..............eqMERG.DG..SG.NLPED----.............................................EIIRQW..GQ..RW..LRVFRRKAGVEE-s............................................................................................
Q0CKX2_ASPTN/541-794                   ..............................................................FKYS.....SENAPYAKEGMEIMQLI.RK.KAS.......DEEIQPFIAA.IEEQA.KSLG.V--....EDPLL.............PSTDAFVTAIC...FVGSKSLSHVL.S.CIE.R..NKER..LLAI...........gPKS......................................................PAARRQ...I....ITSVLEYWA.DQP...G...IGINIIDK.LLNYTILTPLSVVEWALVd..............................kLEA..GTI.L.A.K.L.H.V.YEMVSA.TVGKVTNR.......---MRQIV----AARIQP..........---.......--................................................................................GLYE..PQLS.VLHDTLVR.E.KA...DMQALFKVIE.........D....ALVSVAAGS..................NDEM.ME..RG.DGSGALP-E............................................dELIRQW..GR..RW..LRVFRRRAGVEE-s............................................................................................
M3VW75_FELCA/485-760                   ..............................................................YKYGd..esSNSLPGHSVALCLAVAF.KS.KAT.......NDEIFSILKD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.T.R.L.F.V.WEILHS.TIRKMNKH.......VLKIQKELEEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGALE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TSVLT----.............................................PWYKNC..IE..RL..QQIFLQHHQII--qq...........................................................................................
A9S1J0_PHYPA/495-842                   ..............................................fvyapdnntsapeaev----.....-------ALATELTSLV.RG.KKT.......VREIQVWIDE.QILPT.--QG.Q--....----Q.............ASIQIVAQTLL...YIGSKSFTHTI.T.VLE.K..YCQI..FRKI............APD......................................................MGTQIA...M....IDTVSQLWR.NSA...Q...MTAIVIDR.MMGYRMVSNLAIVAWVFS................................PQN.vQQF.H.T.S.D.Q.V.WEILRN.AINKTNNR.......TVDLRKEISAAEKVLKLAaa.....gtvK--.......-Ahskweaavaalnaaeakseds.....................................rnslsakvdwaktvadkaqdeeTSAQ..DSLE.SKGALLDR.A.LR...EQEALFLAVY.........Q....SFADLLTDR..................LSKP.LP..EP.QEVSNSLEDaegegadveapvameadeen....dedgtkqrnqkrttsadpqeeEQWRKC..TL..GY..LRAISRQY-----cdev.........................................................................................
K1Q4J3_CRAGI/488-760                   ..............................................................FKYEk..egAGSMPGTMVAHQLISAI.KS.KCT.......PEEAMVLLKD.LPNPL.SEEE.SD-....PTYHP.............LRIDVFVSVLL...HLGNKSFSHSF.A.AIA.K..FHHI..LKLL............ADT......................................................EEGQIW...L....LRTMFEVWS.SHQ...Q...MMVVLVDK.LLKTQIVEPSAVANWLFS................................SEM..QPE.F.T.K.F.Y.V.WEIMHA.TIRKMSKQ.......VDKLQQDVEDAKDKLDAA.........kR-Kqa..dglMDde...........................................................................deeIPTD..DIIE.RMEERLEA.A.QN...QQKRLFLIIF.........Q....RFIMILTDH..................LAKC.EG..NS.IDYNT----.............................................PWYKWV..IE..RL..QQIFLLHHELV--fr...........................................................................................
A0A059D9L3_EUCGR/68-412                ................................................ygidegseqteeqr----.....--------LSAELSKMV.KG.RQT.......ARELISWIEE.SVSPT.--HG.---....---LE.............STLKVVVQTLL...DIGSKSFTHLI.T.ILE.R..YGQV..IAKI............CPD......................................................DERQAM...L....IEELSSYWK.NNP...Q...MRAITIDR.MMGYRLISNVAIVRWVFS................................PVN..IDQ.F.HiS.D.H.P.WEILRN.AVSKTYNR.......IVDLRKEISSLKKDVISAee.....vsaKARa....dlESaeqklmlvdgeptvgen.............................................parmkrlksyaekakekeV--SirENLE.VKEALLGR.A.YN...ENEALFLALY.........K....KLSSVLKERlpep.........skartLREL.KS..I-.--------Hadetaveleepsamemdden.....grakeshsngekasdvykvgEEEQWC..IStlGY..VKAFSRQYAS---efh..........................................................................................
R4X9M8_TAPDE/503-766                   .............................................................f-PCN.....TTGHPYYEETSTLLTEL.TA.TAA.......LERVNEQLSA.IRRKA.IDEG.SD-....--PEE.............QELHILVSCIL...QLGHQSFSHAL.N.TIE.R..NLQL..LQTK...........cDSS......................................................PTSRRT...T....VATVMAFWS.GRP...F...IASTLLQK.LLNYRLISPMSILQNLLL................................DSP..SAV.F.T.R.S.T.T.WELVRT.TIEKVNAR.......VTQVRARLDKLTNESNDNe.......stE-N......aMDtaet........................................................................tttePETV..SELD.KLRKTWVD.V.QE...EQRDVFTFTI.........S....QLSTRVADL..................KRDA.--..--.--GDD----.............................................PWALYW..IR..GL..YRSILRRNKAQ--iv...........................................................................................
A0A0G2GV22_9PEZI/613-867               ..............................................................FKYE.....SDQTPYAPEGRELLALL.KK.KAA.......EDEIQEVINK.IHQQA.AEHN.V--....ADVLI.............PSTDAYVTCIC...YIGSKSLSHVL.S.CIE.R..CKER..LLAI...........gPAS......................................................ETARRQ...I....ITSVAEYWK.DQP...G...IAVNIVDK.LLNYTILSPMGVVQWALGd..............................rLGA..GGT.L.S.E.S.W.I.FEMVAG.TVGKVTNR.......---VRQIV----SARLQK..........---.......--................................................................................GLPE..EQLQ.LLDDTLTK.E.RD...AMRQLFQVID.........D....VTTGVSQGAad..............gfIEAD.GS..KG.MDE---EQG.............................................KLIKAW..GE..RW..SRVFRRKAAVEE-a............................................................................................
A1DM04_NEOFI/529-782                   ..............................................................FKYS.....SDTTPYAKEGREIMQLI.RR.KAG.......DEEIQPLITA.IEEQA.KALG.V--....DDPML.............PSTDAFVTSIC...FVGSKSLSHVL.S.CIE.R..NKER..LLAI...........gPKS......................................................ARARCQ...I....ITSVMEYWV.DQP...G...VAINIIDK.LLNYTILTPLSVIEWALVe..............................rLQA..GTI.L.S.R.T.H.I.FEMISA.TVGKVTNR.......---LRQIVAARTQA----..........---.......--................................................................................GLYE..PQLS.VLDETLSR.E.KA...DMQALFRVIE.........D....SIVSVAGGSnd..............glMERG.DG..SG.NLPED----.............................................EIIRQW..GR..RW..LRVFRRKAGVEE-s............................................................................................
W2QF76_PHYPN/604-857                   ...................pdsaspasdfyqsvttklkghppasalrswlneelprleisra----.....-----------------.--.---.......----------.-----.----.---....-----.............EAVEVVWTCIL...EAGVATFTHMR.L.LLE.K..YGKR..NELFgge.....dqsaEET......................................................EADELV...V....VKTVASVWL.KSP...Q...HIGLILNS.MLRQGLLRPLTIVTWVFT................................ADA..VQQ.Y.S.W.P.Y.V.WEILND.TLKFVQDA.......IGAKTKQLEQASTPRSSD..........--D.......RD................................................................................NEEM..PDVA.ALEDSRKR.L.QD...ELRQLLVLLF.........R....GFNRVITEH..................KAEC.DS..EG.SDPRD----.............................................NWFRSA..LA..QM..QAVGHR-------yrvpl........................................................................................
E9CS92_COCPS/532-785                   ..............................................................FKYA.....QETTPYSKEGQEILQLI.RK.KAS.......DEEIAPVIAS.IEEQA.KAHG.--L....ADPSI.............PSTDAFVTSIC...CVGSKSLSHLL.S.SIE.R..CKER..LLAI...........gPRS......................................................AAARRQ...I....ITSVMEYWV.DQP...G...NAVNIVDK.LLNYTILTPLSVIEWALVd..............................nLAA..GSI.L.A.K.P.H.I.FEMISA.TMGKVTNR.......---IRQIVAARTQP----..........---.......--................................................................................TLVE..PQLS.VIQDALTR.E.SA...DMRAMFRLID.........D....SIVPVASGT..................NDVM.ME..RD.DDSAL-APE............................................nELIREW..GK..RW..LRVFRRKAAVE--da...........................................................................................
A0A067JRI3_JATCU/485-830               ...................................................fkymtedgkei----.....---TEQHALSAELSNKV.KG.RQT.......AREIISWVEE.SVFPH.--H-.G--....---LE.............VTLTVVVQTLL...DIGSKSFTHLI.T.VLE.R..YGQV..IARL............CHD......................................................HDKQMM...L....IAEVSSYWK.NNA...Q...MTAIAIDR.MMGYRLLSNLSIVKWVFS................................PAN..IEQ.FhT.S.D.R.V.WEVLRN.AISKTYNR.......ISDLRKEILSLKKSVVSAee.....aaaK--.......-Akaeldaaeskltlvdgepvl.......................................genpvkmkplkskaektneeaISVR..DSLE.AKAALLAR.A.LD...ENEALFLSLY.........K....NFSNVLMERlpdp.........skapaL---.--..--.---------.............................................------..--..--..-------------ralksgqvdqmavdidetsemeldnengrpkksqsngekgstaynigekeqwclstlgyvkafsrqyasei......................
F0XRE3_GROCL/583-838                   ..............................................................FKFQ.....TDDTPFAAEGRELAALL.KR.KAP.......DEEVQTVIGR.IQDLA.LDSG.R--....DEPLV.............ASMDVFTTAVL...WVGSKSLSHVL.A.CIE.R..TKDR..FLDA...........gAAS......................................................EAARSQ...I....LEAVMTFWA.AHP...G...IAVSITEK.LLNYAILSPETVVKWALDkkeee.....................adkaetAET..APR.L.S.Q.A.F.V.AELVFN.TVAKVTRR.......---MRQVVVTSQAASATV..........---.......--................................................................................----..---V.AAYAAVDA.A.RE...QQQNPGSLAV.........A....AVSKLFQRV..................AEAV.EP..WA.AASSP----.............................................LVVRAW..AE..RW..QRVVRRRQAIEE-a............................................................................................
E1G006_LOALO/528-796                   ............................................................sy-DLN.....DDEHPDRDFAITLEKAF.RE.KIS.......ADEMIDLLRS.KTGNR.MDIN.---....-----.............SRLSIFFKVLL...YLARKTFSHNF.A.ALT.R..YYST..LKEF...........iGGR......................................................EDGQLT...I....LRTLYETWK.LHG...Q...MVIVLVTK.LLKMSLVDASAVVAWLFS................................EEM..KPE.F.E.R.L.W.I.WEVLNR.ALEHVSGH.......VHRSRQAIENAKLKKEQKe.......ldH-Ekd..dfdMEtde.........................................................................hdmtDPNT..VEPT.VKESEFAD.L.HE...CLKNLLLDVL.........H....KFIVTLAEH..................IVNS.ES..SG.SDFQN----.............................................NWYLYV..TG..RF..KNVFLKHWKD---lfe..........................................................................................
A0A0D3E2U7_BRAOL/301-596               ......................................................ymysleeg----.....KEKTEEHELSAELNRKV.KE.KQY.......ARDMMSWIEE.TIYPV.HGF-.---....----E.............VTLTVVAQTLL...DIGSKNFTHLV.T.VLE.R..YGQV..FAKL............CPD......................................................NDKQVM...L....LSQVSTYW-.---...-...--------.MMGYRLVSNQAIVRWVFS................................PEN..VDQ.F.H.V.S.D.QpWEILGN.ALNKTYNR.......ISDLRKEISSIKKNVLVA.........eKAS......aNArveleaaesk............................................................lllvegepvlGDDP..LKMK.RL-KNDGG.E.DR...GGRVLLLQMF.........Q....SFSAVLKERlpep.........tkarsLQDL.KS..TG.AEDKNSSAMevdsengnt..........................kkrseigerqQWCLST..L-..GY..LTAFTRQYAKE--m............................................................................................
K4CX85_SOLLC/485-827                   ...............................................fkysaedgtdptera----.....--------LSLELKDMV.KG.RKT.......AREMISWVEE.NVFPA.HGFD.---....-----.............ITLGVVVQTLL...DIGSKSFTHLI.T.VLE.R..YGQV..IAKM............CTD......................................................DDQQVK...L....ITEVSSYWQ.NSA...Q...MTAIAIDR.MMSYRLISNLAIVRWVFS...............................pLNL..DRF.H.V.S.D.S.S.WEILRN.AVSKTYNR.......ISDLRKEISSLERSVVLA.........eKAAsr...arEElesaesklsvidgepvlge..........................................npvrikrlksyaekakeeeVSVR..DSLE.AKEALLAR.A.VD...EIEALFLSLY.........K....SFLTALAEP..................LHDA.SR..DG.TLRPSGHVDdmtidledssvmeldkdder....skkshpngsgerkgynldekqQWC-LT..TL..GY..LKAFTRQYASE--i............................................................................................
U5HA64_USTV1/693-970                   .......................................................qdlvave----.....-NASPYAALAGRIFDLL.RA.KAS.......TSQIETELKG.IDATL.QTDH.TLT....ADESR............aLILDMTVQSIL...SIGSRSFSHFL.N.VLE.R..YLVL..LRNL............TPS......................................................VSTRSE...L....LKSVAKFWT.HHR...Q...FHLIVLDK.LLQYRLVDGADVISWVFD................................PTR..NGV.W.S.D.M.D.D.WLALNA.TISTLKGR.......VKAAQGRLEGLLTEADTH..........RAReq..lgsNNnnndledstm...........................................................evndsigvvvvVVDT..TEIS.LARTQLST.Q.NE...DLSNCLLNVL.........E....HFSNLLPEA..................R---.--..--.------KLD.............................................DWTGFW..IE..GW..FREFVR-------llie.........................................................................................
W7MK74_GIBM7/531-776                   ..............................................................FKFQ.....NPETPFSKEGQEIASLL.RR.KGP.......DEEFEPLFRS.IQTQA.SEQS.---....LDPIV.............ASTDVFMTAIC...WVGSKSLSHVL.A.CIE.R..TKGR..LLEA...........gNSS......................................................DAARAQ...I....ISAVMSYWH.AHP...G...VALSIIEK.LVNYSILTPFTVVDWALVast.........................pangTDG..GDS.L.T.E.P.H.I.FELVFN.TIFKVTRR.......---SRDVV-AA-------..........---.......--................................................................................----..--PE.TDEETRFK.E.MK...STQDLFRAMK.........D....ALVSWAGGS..................KDEL.ME..GG.DGS--SDRE.............................................AMIQRW..GQ..RW..LRVFKRMGAIEE-a............................................................................................
A0A0B0NP59_GOSAR/483-829               .............................................................f-KYSgaddqEKTEQEQALSAELSNKV.KG.RQS.......AREIILWIEE.NVYPI.HGQ-.---....----E.............ITLSVVIQTLL...DIGSKSFTHLI.T.VLE.R..YGQV..MAKL............CSD......................................................QDKQVM...L....ISEVGSYWK.NNA...Q...MTAIAIDR.MMGYRLISNLAIVRWVFS................................PEN..IEQ.F.H.I.SdR.P.WEVLRN.AVSKTYNR.......ITDLRKEISSLKKSVVSAee.....aasK--.......-Akadleaaeskltlvegepvl.......................................genptklkhlksvaektkeetVSMH..DSLE.AKEALLAR.A.LD...ENEVLFLSLY.........K....NFSNVLMER..................LPDA.SR..D-.---------.............................................------..--..--..-------------gtlqslksvngdsmavdieepstmevddenerpkksqsngskttngynvrekeqwclstlgyvkafsrqyasei...................
M7BPB3_CHEMY/114-291                   .............................................................g----.....-----------------.--.---.......----------.-----.----.---....-----.............-----------...-----------.-.---.R..FHEV..FKTL............AES......................................................DEGKLH...V....LRVVYEVWK.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................PEL..AHD.F.T.R.F.Y.I.WEILHS.TIRKMNKH.......VVKIQKELEETKARLARQ.........hKRRds...ddEDedddr.....................................................................ssgredGPLE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....HHQI-----..................----.--..--.---------.............................................------..--..--..-------------iqqymltlenllftaeldhh.........................................................................
A0A0G2FZI4_9PEZI/575-841               ..............................................................FKFE.....KDDTPFAQEGRELAQLL.KR.KAS.......DEDIQPVIER.IHSLA.IDQG.---....LDPLV.............ASTDVFTTAVL...SIGSKSLSHVL.A.AIE.R..TKER..LMDA...........gATS......................................................EPARAQ...I....ITAVMDFWS.AHP...G...VAITIIEK.LLNYSIISPSAVVQWALVrh............................agETR..GEA.L.A.R.S.H.I.YELVFN.TIAKVTKR.......---MREVVASSSSSAAAA..........PQA.......AE................................................................................GEDT..DMSS.ELEDAKKR.E.AQ...AARELFRTTQ.........D....ALIAWASGAkd..............elMEDA.GG..-L.SDAEREERD.............................................RLVKRW..GD..RW..LRVVRRRAAIEE-t............................................................................................
L8GQR7_ACACA/416-673                   .............................................................l-KYA.....DVAAEDHEAYASLLAKV.RA.KEK.......SEQLRPWLDS.LTSIS.TER-.---....-----.............-RLDLALHALL...EAGCKSFSHLL.N.VLE.R..YHAL..LRSL............AGT......................................................VQARLA...V....TTAVGEFWK.HSP...Q...HIIITLEK.LMTYRIVDAHSIVQWIFS................................HQV..LPF.F.T.Q.G.Y.L.WDILRN.TIDKTVMR.......TEVMRKELKAVQPDQQPAl........aEAS......gAStt............................................................................atAVDD..VRLQ.QARESYQT.A.LR...DQNDLLLLVF.........Q....SFVVVLANH..................LANS.RE..RD.ADPYD----.............................................AWYRSA..MG..HF..KEVARRYHRE---aka..........................................................................................
A0A074XXI9_9PEZI/537-788               ..............................................................FKYL.....NEQTPYAQQGNAMHALI.RR.KAP.......EEEIEAVINE.IQALA.SEHG.V--....EDVLV.............PSTDAYMTSIC...SVGSKSLSHVL.S.CIE.R..CKER..LLAI...........gPES......................................................ELARRQ...I....ITSVIDYWA.DHP...G...TAVNIIDK.LLNYTIITPMSVIEWALHd..............................hLQH..GRA.L.A.Q.T.H.I.YEMISA.TMFKVSNR.......---MRQIV----RARDET..........---.......--................................................................................DLSE..EQKN.LLDETLVR.E.RQ...TMRDLFNAII.........E....AVETVANAAqd..............dmIERF.--..DG.DS----AEQ.............................................TLLQQW..GA..RW..ARVWRRKMAVEE-a............................................................................................
A0A094F7J6_9PEZI/549-800               ..........................................................iklt----.....NLDTPFAAEGREIHTLL.KR.KAP.......EPEIQTVIDQ.IHTQA.TTIA.--I....HEPLL.............SSTDAYVTSIC...YIGSKSLSHVL.S.CIE.R..CKER..LLSI...........gNTS......................................................ETARRQ...I....ITSVMAYWV.DQP...G...IGVNIVDK.LLNYTILTPLSVVEWALLd..............................dTKA..GDK.L.A.E.P.F.V.FEMVAG.TVQKVTNR.......---LRQIV----ASRNAP..........---.......--................................................................................GLEH..EQRL.LLDETLLR.E.RV...AMKDMFKVME.........D....ALFSWASGS..................KDQA.ME..AG.IGETT--DE.............................................AFIRRW..GE..KW..LRVFRRKMAVEE-a............................................................................................
A0A0P7WT97_9TELE/450-693               ........................................................iykyed----.....-----------------.--.---.......----------.-----.-ENS.NEG....ESFNP.............LKIDVFLQTLL...SLAAKSFSHSF.S.ALA.K..FHEV..LKTL............TES......................................................DEGKLH...I....LRVVCDVWK.NHP...Q...MISVLVDK.MIRTQIVDCVAVANWIFS................................QDM..THE.F.T.R.F.Y.V.WEILHS.TIRKMNKH.......VQKIQKELEDSKEKLEKQh........qK-Kds...gdEEdm...........................................................................eedSQLE..EQIE.RLQEKVES.A.QS...EQKNLFLVIFqmplsasseQ....RFIMMLTEH..................LARC.ET..GG.TDLNT----.............................................PWYKNC..IE..RL..QQIFLMHHATIQ-q............................................................................................
G0WF93_NAUDC/582-835                   ............................................................lf--FK.....LDSVPMEAQVRQILDYI.HK.PNN.......QRELKDLEEI.INTIK.EEYG.NEI....TDFTR.............FVIIVIMQAVV...HSGSRSLSHAN.K.YIN.D..LRDE..LLEIfs.......kleMDQ......................................................DLKEYT...M....IEAVLRYWN.TNS...Q...NGFLIVDA.LKFAKLVSTKSIYDFCFDes...........................nlnDGI..NHG.L.I.E.S.T.A.IEAIFR.NLSQELIS.......------------------..........---.......--................................................................................----..----.--------.-.NP...QSVADFEIVF.........E....KLCIIVNGT..................IKDL.GV..QE.DEDI-VVPNvssdmdidft.........................dvnesrrfnlSWKYAT..VT..SF..IKSLLRKYSDEYR.............................................................................................
M1URS2_CYAME/726-1017                  ........................gspaasllasipepvkvelaqrlvasaydavpylnehv----.....-----------------.--.---.......----------.-----.----.---....--PKE.............LRPAVFLQALL...RGGYGAPSFFA.N.LVE.R..WGGV..LRELc.........rdPGA......................................................AAAGLQ...L....VSVVLQVWE.SSH...Q...HALLSLNC.LSSAGILDPSTVVTGVYRqllnr.....................yptsddL-S..FAA.L.N.DlR.F.P.FETVRF.FLNQYRDR.......LRRIQTDIEMLLLAISRA..........P--.......-Er.............................................................................dlDTME..AALT.RARQMLQQ.H.RQ...GLKRFLAATL.........D....SLAQILRHYhg.............ssgG---.DR..GD.RDHHE-T-Ddhedhggtasats...................astgdtapaalvrGWLLER..SL..GL..VQELLRT------qldqt........................................................................................
W4KGI1_9HOMO/537-838                   ..............................................................YDYD.....DPATPHHDAAQSVLNQL.RA.RAK.......PEDVMSNLES.IRNAI.AETS.EGD....VNVDS.............VVRSIAVQSLL...HIGARSFSHFL.N.AIE.R..YILL..LRNL............AAGgiaag...........................................sgglasAEAKAD...I....LTIAATFWR.RSH...Q...MVGIVFDK.FMQYQIVDPTDIVRWAFM................................H--..-QQ.R.G.D.G.L.D.WDVLKA.AIDKANGR.......VVVARKRVAALRKEEDDSr........aR-Ak....agDStamevdt.................................................................eakqdetpAVDS..PALV.TALKAFAS.L.TR...EQKSMLSQVL.........E....GFVESLHSP..................T---.AE..RP.NPCASEVITekawhn................................ranwgddQWKAWT..TW..VL..YKHFCRTYSPYL-r............................................................................................
NCBP1_DROME/488-770                    ..............................................................YKYAn..eeAANLPGTTVAHQLVVAI.RQ.KCT.......PEEVVNILKD.IPNSG.YSGE.EMS...dGSFNA.............LKIDVFVQTLL...NLGSKSFSHSF.A.AIS.K..FHSV..FRAL............AET......................................................EEAQIC...I....LHNIFELWS.SHQ...Q...MMVVLIDK.LLKLQIVDCSAVATWIFS................................KEM..TGE.F.T.K.L.Y.L.WEILHL.TIKKMNKH.......VIKLNTELSEAKEKLAKAds......ssS--.......-Dseddsshk...............................................................rkkpithadKPSE..EVVE.RMEEKLEA.A.NV...NQKRLFLIVF.........Q....RFIMILSEH..................LLRS.DT..DG.RDPDT----.............................................DWYRWT..IG..RL..QQVFLMHHEQVQK.............................................................................................
F6VFW6_MONDO/484-756                   ..............................................................YKYGd..esSNSLPGHSVALCLAVAF.KS.KAS.......NDEIFSILKD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFVQTLL...HLASKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.T.R.L.F.I.WEILHS.TIRKMNKH.......VVKIQKELEETKEKLARQ.........hKRRd....drSSdr............................................................................ddGALE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TNILT----.............................................PWYKNC..IE..RL..QQIFLQHHQII--qq...........................................................................................
K1VU75_TRIAC/513-813                   .............................................................w-VYE.....SSENPLHAEATELLRLM.RQ.KVP.......ANEVKSYLDN.LPGAR.TEGS.EVL....S---A.............PILTMAVETIQ...HLGARSFSHFL.N.ATE.R..YLDV..LRHM............TPD......................................................AASRRV...L....LDAVASFWR.QSA...Q...MRLITTDK.YLQYGILEPMDVVSWVFAedps........................sssgTDA..ADG.W.T.D.G.D.K.WELLRM.TLDKVQGR.......VKAVSRRLAAVEKADEVA.........rA-Rraa.erlESgegvgd....................................................................deedetLERS..REAR.DVQASLDL.Q.SE...RADKVFVATT.........Q....AFVSELLPWa................fPAEG.AE..EG.EDAG----Sglkavfa..............................lqdagetgAWSTRA..KW..GW..YREFARRYAT---gir..........................................................................................
A0A067R587_ZOONE/487-775               ..............................................................FKYAa..egAGSLPGTTSAHKLVVSI.RA.KCK.......PEEVLHVLQD.LPNPR.QDED.-VD....PRFNP.............LKIDVFVQTLL...NLGSKSFSHSF.A.AIS.K..FHYV..FKEL............AES......................................................EEAQIC...I....LRNMFDLWH.GHQ...Q...MMCVLIDK.MLKTQIIECSAVANWIFS................................KDM..SGE.F.T.K.L.Y.L.WEILHL.TIKKMSKH.......VNRLGRELAEALERLRHAes......dsD--.......-Esedgdgegnnns.......................................................gqrgksggaddheKPSE..DMVD.RMEERLEA.A.QA...DQKNLFLIIF.........Q....RFIMILSEH..................LVRS.DT..DG.RDFNT----.............................................HWYKWT..IG..RL..QQVFLVHHEQVQK.............................................................................................
G3WTF4_SARHA/477-708                   .................................................fftvkhfsdegfs----.....-----------------.--.---.......----------.-----.----.---....--FNP.............LKIEVFVQTLL...HLASKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.T.R.L.F.I.WEILHS.TIRKMNKH.......VVKIQKELEETKEKLARQ.........hKRRd....drSSdr............................................................................ddGALE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TNILT----.............................................PWYKNC..IE..RL..QQIFLQHHQII--qq...........................................................................................
F6ZXS3_ORNAN/474-623                   ..............................................................YKYGd..esSNSLPGHSVALCLAVAF.KS.KAT.......NDEIFSILKD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.T.R.-.-.-.------.--------.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------.............................................................................................
T1HND5_RHOPR/491-769                   ..............................................................YKYTa..egSSSLPGTQVAQQLMTAI.KN.RCS.......PEDLLAILKE.LPNPL.EDDE.GPE....ARYNP.............LKIDVFVQTLF...FLGSKSFSHSF.A.AIG.K..FNQV..FKLL............ADG......................................................EEAQLC...I....LRSIYELWR.NHQ...Q...MVCVLIDK.MLKIQLLECSAVANWIFS................................KEM..SHD.F.T.K.L.Y.I.WEILHL.TINKMSKY.......VSRLSRELSEAREKLARSgag....sssG--.......-Desddsl....................................................................tgrgddKPTE..EMVE.RMEERLET.A.QG...DQKNLFLIIF.........Q....RFIMILSEH..................LVRC.DT..DN.KEFDN----.............................................YWYRWT..IG..RL..QHVFLAHHEQVQK.............................................................................................
A0A0G2IYJ0_9EURO/566-823               ..............................................................FKYA.....LETTPYATEAQEIMHLI.RK.KAP.......DAEIQPHILA.IQQAA.ASQP.D-T....TDPLI.............PSTDAFVTSIC...YVGSKSLSHVL.S.CIE.R..SKER..LLSI...........gPQS......................................................PAARRQ...I....ITSVLAYWA.DQP...G...IGVNIIDK.LLNYTILTPLSVIEWALVd..............................hIDG..GAA.L.A.K.A.H.V.YEMVAA.TMGKVTNR.......---IRQIV----AARAQG..........---.......--................................................................................GIVE..PQLS.VIDETLRR.E.RG...DVQVMFEVIE.........G....ALEGVINESngn............esgMEDV.--..--.-------GEgvgw.....................................eeekGIIREW..GR..RW..LRVFKRLRAVEE-a............................................................................................
A0A0K8L8H3_9EURO/529-791               ...............................................fkyssdrftnilipt----.....--ATPYAKEGREIMQLI.RK.KAG.......DEEIQPLITA.IEEQA.KALG.V--....DDPML.............PSTDAFVTSIC...FVGSKSLSHVL.S.CIE.R..NKER..LLAI...........gPKS......................................................ARARCQ...I....ITSVMEYWV.DQP...G...VAINIIDK.LLNYTILTPLSVIEWALVe..............................rLEA..GTI.L.S.R.T.H.I.FEMISA.TVGKVTNR.......---LRQIV----AARTQP..........---.......--................................................................................GLYE..PQLS.VLDETLSR.E.KA...DMQALFRVIE.........D....SIVSVAGGSnd..............glMERG.DG..SG.DLPED----.............................................EIIRQW..GR..RW..LRVFRRKAGVEE-s............................................................................................
A0A087HCT4_ARAAL/484-815               ......................................................ymysleeg----.....KEKTEEHQLSAELNRKV.KE.KQT.......ARDMISWIEE.TIYPV.HGF-.---....----E.............VTLTVIVQTLL...DIGSKSFTHLA.T.VLE.R..YGQV..FAKL............CPD......................................................NDKQVM...L....LTQVNTYWK.NNT...Q...MTAVAIDR.MMGYRLVSNQAIVRWVFS................................PDN..VDQ.F.H.V.S.D.QpWEILGN.ALNKTYNR.......ITDLRKEILNLTKNVLVAek.....tsaN--.......-Arvelesaesklmivdgepvig......................................sdnpakmkrlkstvekageaeLSLR..ESLE.AKEALLNR.A.LS...ETEVLLLQLF.........Q....SFSAVLKERlpep.........tkarsLQDL.KS..TG.AEDKNSSAMevdsengnp..........................kkkseigereQWCLST..L-..GY..LTAFTRQYAN---ei...........................................................................................
W9R4S8_9ROSA/127-468                   ..............................................................FEFG....aQDNSERHALSAELKNLV.KG.RAA.......AREIILWIEE.NVFPV.HGF-.---....----E.............VTLKVVLQTLL...DIGSKSFTHLI.T.VLE.R..YGQV..IAKM............SSD......................................................QDKQVM...V....IAEVGSYWK.NNL...Q...MTAIAIDR.MMGYRLLSNLSIVRWVFS................................SEN..IEQ.F.H.T.SdR.P.WEILRN.AVNKTYNR.......ICDLRKEISSLKKTFVSAea.....aaaKA-.......-Kaeldaaetkltlvdgepvlg........................................dnptklkrlkssaekakeeeVSVQ..ESLE.AKDALLAR.A.LD...EIEALFLSLY.........K....NFSSVLMERlpea.........srvgtLQEL.KS..SS.AD------Amavdleelstmevddengr......pksqlngrktgsvynigekeQWCLS-..TL..GY..LKAFSRQYAS---ei...........................................................................................
M8A6M1_TRIUA/684-1030                  ......................................................fryhtdes----.....KESTEGHRLSKELVSMV.RG.RKT.......TRDIILWVEE.QIVPA.NGA-.---....----K.............FAVDVVSQTLL...DIGSKSFTHLI.T.VLE.R..YGQI..ISKL............CPD......................................................EEMQLL...L....MDEVSAYWK.NST...Q...MTAIAIDR.MMGYRLISNLAIVKWVFS................................PAN..VDQ.F.H.V.SdR.P.WEILRN.TVSKTYNR.......ISDLRKEIQTLRKSIQVA.........kE-Asa..kaiKEleeaksileivegqpvpse..........................................rpgrlrrlqgfadkakeeeVTIE..ESLE.AKQALLAR.G.LE...EGKELLRLLF.........K....SFLDVLTERlppvsa......dgdvpnL---.--..--.-----RAGDpnvtfpasdpeaatmeidneng.adnnsqvnrenteagytigeleQWCL-C..TL..GY..LKSFSRQYATE--i............................................................................................
G8BCS6_CANPC/643-904                   ..............................................................YNFT.....NPELPLSNVASQVYEFLvSH.YKS.......NKEMNELYNS.VLEQI.QQVQ.SGQ....LDAMVsvdi....pnpvkFVINLFFQTYA...YIGSRSIYSEV.S.ILD.R..DVDK..LKFL............SGQpitsakkvanpd.............................defeklylsddevTNRQNW...I....IDAIFRIWV.HQS...Q...VIFLILEY.LIEFEILDPKYLIDKAFK................................T--..NLI.I.D.N.V.S.C.IESVNR.ILETSKPP.......------------------..........---.......--................................................................................----..----.-------V.L.KQ...LMIEIFTIVV.........S....KLNELDLGVd................dVVHI.DE..LN.EDNSSEVDK.............................................QWLFYE..YL..GL..LKSYFRKYIKN--qa...........................................................................................
U6N3Z9_9EIME/129-344                   ..........................................tsiletccrdtagapwsfee----.....-----------------.--.---.......----------.-----.----.---....-----.............-ALKLFVFCLL...SFGSKTQTHLN.R.ILS.N..YLQT..FVCF............ATQs....................................................eVDIHPA...V....LQAVRKFWS.TSQ...Q...RTALTLHA.FLKTGILQRIRVLQELCG................................-ED..ADT.R.D.S.W.G.Q.LELVET.VLRGALDA.......CENAREEAAAASA-----..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------pmptdteaeqllhflmvhliedliketsparsrflflrciffgrkyaefinlkklkeevemvmsgtedrrvsn....................
A0A0L0NHN1_9HYPO/531-776               ..............................................................FKFN.....NPDTPFSKEGQELGALL.RC.KAL.......DEEFQAVIDS.IQSQA.SERA.---....LDPVA.............ASTDVFMTAVC...WVGSKSLSHVL.A.CID.R..TKGR..LIDA...........gSAS......................................................AAARAQ...I....VSAVMSYWQ.AHP...G...VALSIIEK.LLNYSILTPFSIVDWTLVast.........................pangTNG..GES.L.G.Q.A.H.I.FELVSN.TVAKVSGR.......---VRQVLTSHD------..........---.......--................................................................................----..----.ADDEAREK.E.TK...AMKDLFRAIN.........D....SLASWAGGN..................KDQM.ME..DG.DGSG--DKE.............................................ARIHRW..GQ..RW..LRVYQRMAAIEE-a............................................................................................
A0A0A2JUZ3_PENEN/531-784               ..............................................................FKYS.....SEMAPYSKEGQELMQLI.RK.KAS.......DEEIQPVITA.IEDQA.KSQG.VD-....-DPKI.............PSTDAFVTSLC...FVGSKSLSHVL.S.CIE.R..SKDR..LLAI...........gTES......................................................QHARCQ...I....ITSVMDYWV.DQP...G...IAINIIDK.LLNYTILTPLSVLEWALSe..............................sVAA..GTI.L.S.K.P.H.V.FEMISA.TVGKVTNR.......---MRQIV----AARAQP..........---.......--................................................................................GLYE..PQLS.VIDETLAR.E.RT...DMEALFKYIE.........D....SIVSVAAGSnd..............eqMERG.DG..SG.TLPED----.............................................GIIRQW..GR..RW..LRVFRRKAAVEE-s............................................................................................
S3E6W8_GLAL2/538-786                   ..............................................................FKYN.....DDAVPFAQEGRAILALL.KR.KAP.......EDEIQPVIDQ.IRQLA.LDMN.--L....PDPLV.............PSTDAYMTSIC...YIGSKSLSHVL.S.SIE.R..CRER..LLAI...........gPRS......................................................SDARKQ...I....IDSVMDYWK.DQP...G...IGVNIVDK.LLNYTILSPGSVIEWAVS................................Q-H..GNR.L.S.M.S.Y.V.YEMVSL.TIGKVTGR.......---TRQVV----RSSKVP..........---.......--................................................................................GLTA..EQRT.LVVQSMQA.E.RK...SMKDLFALME.........D....SLVSWATGS..................KDQV.MQ..SG.D--GTSDEE.............................................AVIRQW..GE..RW..LRVFRRKYAVEE-a............................................................................................
T1GNS5_MEGSC/1-42                      ..............................................................----.....-----------------.--.---.......----------.-----.----.---....-----.............-----------...-----------.-.---.-..----..----............---......................................................------...-....---------.---...-...--------.------------------................................---..---.-.-.-.-.-.-.------.--------.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---MILSEH..................LVRS.DT..DC.RDYDT----.............................................DWYRWT..IG..RL..QQVFLMHHEQVQK.............................................................................................
G4YES6_PHYSP/618-871                   ............................................................aa----.....EESSPASEFYQSVTTKL.KG.HPP.......ASALRSWLNE.-ELPR.LEIS.R--....----A.............EAIEVVWTCIL...EAGAATFTHMR.L.LLE.K..YGKR..NELFgae.....dqpiEEA......................................................DADELV...L....VKTVANVWL.KSP...Q...HIGLILNA.MLRQGLFRPSTIITWVFT................................ADA..VQQ.Y.S.W.P.Y.V.WEILND.TLKFVQDA.......ILAKTRQLEQASAPRASD..........--D.......RD................................................................................NEDM..PDVA.ALEDGRKR.L.QD...ELRQLLVLLF.........R....GFNRVIGEH..................KAEC.DS..EG.SDPRD----.............................................NWFRSA..LA..QM..QAVG---------hrfrvp.......................................................................................
C5DI24_LACTC/581-829                   ............................................................lf--FT.....ESSLPFSDLVQQIVNYF.HK.QPL.......DRNISELVSI.LEKMK.VDNE.TIV....VDFNR.............LAVTTLVQVLV...FSGNRSISHAN.K.YIG.D..ARTE..LLEIlg.......kieASQ......................................................EQKERW...I....VEAIIRYWN.CNS...Q...NGYLIADT.CKNFDLISSKSILDFSFLd..............................dKGR..NWG.L.V.D.A.T.S.IESTFR.VLSELSSR.......------------------..........---.......--................................................................................----..----.--------.-.RD...TSVETFIFVF.........E....RLVEIASNV..................VEEL.GL..SV.DSELSASMAdpdemqde............................sadlqkldcSWKYEG..CM..GF..VKSVLRKYADEY-a............................................................................................
S6ENQ0_ZYGB2/585-755                   .............................................................l-YFR.....QESFPAHEKVRQLLDYV.HK.QND.......VRDVSELDAI.IDSIR.QEFG.SII....SNFHQ.............FIIVLLVQVVV...QSGSRSLSHAN.K.YIG.D..LKDD..LTHV............FSKle.................................................mddVEKQYI...I....VEAILRFWN.SNS...Q...NGFLVADS.FKFAGLVSPLSIFQFSFKe..............................qDGK..NYG.L.V.D.G.T.S.IESTFR.NLSQH---.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------ldnh.........................................................................................
I1MLB1_SOYBN/485-828                   .....................................................fsfgaeddk----.....--ESNEHVLSGQLNNMV.KG.KAP.......VREIISWIDE.SVLPN.---N.G--....---LE.............VTLRVVVQTLL...NIGSKSFTHLM.T.VLE.R..YGQV..FAKL............CPD......................................................QDKQVM...L....IAEVSSFWK.SNT...Q...MTAIAIDR.MMGYRLVSNLAIVRWVFS................................AEN..IEQ.F.H.M.S.DrP.WEILRN.AVSKTHNR.......ISDLRKEILSLKKNISSSee.....aakE--.......-Akaeldaaeskltlvdgepvi.......................................gdnparlnrlkshaektkeevVSLQ..ESLE.AKEALLSR.A.IE...ENEALFLLLY.........K....SFSNVLTER..................LPEG.SR..TL.HELKSAQVDvvmavdpeepssmeldnqn......qrpqnshtngekkggaynvgE-----..--..--..-------------keqwcittlgyvkafsrqyaaei......................................................................
A0A094CF23_9PEZI/534-785               ..............................................................FKYN.....DEDTPFAAEGREIHTLL.KR.KAP.......EPEIQTIIDQ.IHTQA.TTIA.--I....HEPLL.............SSTDAYVTSIC...YIGSKSLSHVL.S.CIE.R..CKER..LLSI...........gNTS......................................................ETARRQ...I....ITSVMAYWA.DQP...G...IGVNIVDK.LLNYTILTPLSVVEWALLd..............................dTKA..GDK.L.A.E.P.F.V.FEMVAG.TVQKVTNR.......---LRQIV----ASRNAP..........---.......--................................................................................GLEH..EQRL.LLDETLLR.E.RV...AMKDMFKVME.........D....ALFSWAAGS..................KDQA.ME..EG.TGET--PDE.............................................AFIRRW..GD..KW..LRVFRRKMAVEE-a............................................................................................
I2FPC6_USTH4/662-980                   .............................................................w-TYQ.....SESHVYKTQAERLINSI.KA.KAS.......AEVILADFET.FKSSI.LPSS.STI....PGEEEqagmvgnaieaeiVVRDLTIQCVL...QVGSRSFSHFL.N.IVE.R..YHAL..LRQL............SRS......................................................ARMRAA...I....LAGAVRFWS.RSH...Q...WVLIVVDK.LLQYRIVEPADVVEFIFNppkdep...................rtiepqtPVQ..QEG.W.A.G.F.N.T.WSLLRM.TLEKVNGR.......VDQLKKRLEESERKEAYEr.......erK--.......-Eaalaaglpldsegeksee...........................................kllplfptsatlpirpkeeTKTE..LSST.EALASLEA.I.KT...EQRKVLITAV.........N....GFKNLILHP..................K--I.QT..--.-PHT----P.............................................QYQSWW..ID..GW..YTVLLRTFNKH--ll...........................................................................................
A0A0D2W9D3_GOSRA/483-829               .............................................................f-KYSgaddqEKTEQEQALSAELSNKV.KG.RQT.......AREIILWVEE.TVYPI.HGQE.---....-----.............ITLSVVIQTLL...DIGSKSFTHLI.T.VLE.R..YGQV..MAKL............CSD......................................................QDKQVM...L....ISEVGSYWK.NNA...Q...MTAITIDR.MMGYRLISNLAIVRWVFS................................PEN..IEQ.F.H.I.SdR.P.WEVLRN.AVSKTYNR.......ITDLRKEISSLKKSVVSAee.....aasK--.......-Akadleaaeskltlvegepvl.......................................genptklkhlksvaektkeetVSMH..DSLE.AKEALFAR.A.LD...ENEVLFLSLY.........K....NFSNVLMER..................LPDA.SR..D-.---------.............................................------..--..--..-------------gtlqslksvngdsmavdieepstmevddenerpkksqsnggkttngynvrekeqwclstlgyvkafsrqyasei...................
A7ST09_NEMVE/485-774                   ..............................................................YRFS.....KDGLPGGDIAKQLTEAI.RA.KKD.......PEELQALLNE.ISTSS.GGAT.GDD....DDNDDvpkae...aafssLRIDVFLQTIL...YLGSKSISHSY.S.ALT.K..FHKI..LKSL............IPT......................................................EEAQIH...A....LKTLKEFWC.NSP...Q...MTIILVDK.LIRMQVVECTAVINWLLC................................KDM..SQD.F.T.K.S.Y.T.WELMTT.TIRRMNMQ.......VNKVREESREAKDQLTKL..........EERskk.lalNEsempkg...................................................................paladdiEKKQ..QHLE.EVNERLEN.A.QR...EQKQFYLILF.........Q....RFILMLTEH..................MVRC.EQ..QQ.IEFNT----.............................................LWFRYS..IE..RF..REVLLGNN-----tavfq........................................................................................
G9MDX5_HYPVG/533-778                   ..............................................................FKFS.....NPDTPFSSEGQEIGALL.KR.KAP.......DEEFQPIIDK.IQAEA.GERA.---....LDPVV.............ASTDVFMTAIC...WVGSKSLSHVL.A.CID.R..SKER..LLKA...........aNSS......................................................PAAQTQ...V....LAAVMAYWH.AHP...G...IALSIVEK.LLNYSILTPSSVVRWALTdvs.........................lvdgASA..GEA.L.A.Q.P.H.I.FELVLN.TVTKVSFR.......---VRQLL----TSP---..........---.......--................................................................................----..---D.ADEETRNG.E.TK...AMQDLFGLLN.........D....LLVSWAGGN..................KDEL.ME..MG.DGS--SEPE.............................................ALIRRW..GQ..RW..LRVFKRLGAIEE-a............................................................................................
A0A0F0I9Q9_ASPPA/529-782               ..............................................................FKYS.....LDTTPYANEGTEIMQLI.RK.KAT.......DDDILPIINA.IEEQA.RAMG.V--....EDPML.............PSTDAFVTAIC...FVGSKSLSHVL.S.CIE.R..NKER..LLAI...........gPKS......................................................TRARRQ...I....ITSVMEYWT.DQP...G...IGINIIDK.LLNYTILTPLSVIEWALVd..............................kLEA..GTI.L.A.R.T.H.V.FEMISA.TVGKVTNR.......---LRQIV----AARTQP..........---.......--................................................................................GLYE..PQLS.VLDETLNR.E.KA...DMQALFKVIE.........D....SIMSVAEGH..................NDEL.ME..RG.DGSGELPED.............................................EIIRQW..GR..RW..LRAFRRKAGVEE-s............................................................................................
B7Q634_IXOSC/481-749                   ..............................................................YRYAk..egAESIPGAATAARLSTSI.RE.KCT.......PEEALEVLAD.LPNPL.QEDD.VE-....PAHNP.............LKIQVFVETLL...HIASKSFSHSF.A.GIA.K..FHYV..FKSL............AST......................................................EEAQIC...V....LRSTFN---.---...-...MMIGLVDK.FLKTQIVECSAVANWIFS................................KDL..AAE.F.T.R.S.Y.V.WEILHL.TIRKMIKHepptdlmVERMEEKLEATQSDLKNLfl.....iifQ-Se.....dKE................................................................................PPTD..LMVE.RMEEKLEA.T.QS...DLKNLFLIIF.........Q....RFIMSLTEH..................IAHC.EA..EG.TNFQT----.............................................HWFRWT..LG..RL..QEVFFQHHEHVFK.............................................................................................
A0A010Q1H3_9PEZI/545-791               ..............................................................FKFS.....DESTPFSAEGREIAALL.RR.KAP.......DEEFQPIIER.IHSLA.IERT.---....LDPLV.............TSTDVFVTAVC...WVGSKSLSHVL.A.CIE.R..TKDR..LLDV...........gAAS......................................................EAAKSQ...I....ITAVMSYWA.AQP...G...VAISIVEK.LLNYSILLPISVIEWALSggs.........................hvqgQSS..GDS.L.A.Q.P.H.V.FELVFG.TVSKVTGR.......---VRQLLAKEAEA----..........---.......--................................................................................----..----.-DEDLKER.D.TK...AMRDLFKAME.........D....ALVSWASGS..................KDEM.ME..EM.DGA--GQRD.............................................ALLRRW..GE..RW..LRVFRRRSAIEE-a............................................................................................
G7YES0_CLOSI/524-852                   ...............................................egelmsstetasqlt----.....-----------------.--.---.......----------.-----.----.DLS....HGVTS.............LLTELFFSALF...IAGHKTISHTF.S.YIK.K..YASA..IRTI............AST......................................................VEIQVE...A....LHVLQAVWI.NHP...Q...MIVIITEH.MCRSGLIDPEAIVRWAYSpimtslt.................eipigynpAGA..RPR.I.L.D.F.Y.V.WECLNR.TFMRVGRR.......VTRITNRLNAAKELMETEglrs.vspgsE--.......-Rrdkspdddddddendkrqrlgstrrpd..........................rrnamagyemvsseneededdalfggkGSSG..SRVA.RLEEARCE.A.VR...SQCAVITLLL.........H....RHACLTSEL..................AAEI.AG..DD.LDISSVSRSstallhssgl.........................klglskqalqHIAFWL..KG..RL..VQVVLEHC-----dqlm.........................................................................................
U7PJE0_SPOS1/607-939                   ................................................fkyaepkegaaata----.....ADDVPFAAEGRELAVLL.KR.KAA.......DEDVQAVIER.IHSQA.LDAG.---....LDPLV.............TSTDVFTTAVL...WVGSKSLSHVL.A.AIE.R..TKDR..LLDA...........gAAS......................................................EAARTQ...I....LVAVMAFWG.AHS...G...VAVSITEK.LLNYAILTPDTIVQWALSkn............................dqKGA..SAS.L.A.V.N.Y.V.AELVFN.TVDKVTRR.......---VHQLVGASQTAATAVaaa...tqavE--.......-Aarerqrnppppppppsaavaapkdgdldvamdeda..........gaassthaaasamaeavaaaaadadaaveaaeaarVQVT..ADLE.AARAAEAA.E.TK...AMRDLFRLLG.........E....ALQPWLAGD..................D---.--..--.----S----.............................................GLAKAW..AV..RW..QRVVQRRAAVEE-a............................................................................................
D4AJ42_ARTBC/547-800                   ..............................................................FKFS.....QETTPYSKEGQELMKLI.RQ.KSS.......DEEIEAVITS.IEEQA.KTHG.--L....TDPLI.............ASTDVYMTSIC...YVGSKSLSHFL.S.CIE.R..CKDR..LLAI...........gPKS......................................................DAARRQ...I....INSVMEYWV.DQP...G...IGINIIDK.LLNYTILTPLSVLEWALVd..............................nLAA..GST.L.A.K.P.H.I.FEMISA.TMRKVTNR.......---MRQIVAARTQP----..........---.......--................................................................................TLYE..PQLS.ILDETLKK.E.KA...DMLSMFQLIE.........D....TLVPVAGGYsd..............gmMER-.--..--.TEDDSLQPE............................................nVMIQQW..GS..RW..LNVFRRKVAVE--ra...........................................................................................
A0A078A463_STYLE/472-727               .........................................................lkycn----.....--ESQDNPDAQIILDKL.NS.KET.......PKNLFEALVG.EQSKL.EATG.E--....-----.............QLKEIFLECIM...ARTKKSLEHLK.R.FIEiY..YHEI..IKPFf.........lgTTI......................................................AESQIT...L....MKSVCQMWI.NNP...R...KNLQIIDK.LFSLGLVIPKYAVQYCLDsli..........................rkiSEN..EEL.S.Q.D.L.I.E.FKILNN.LSQLVNQR.......QQQMFTLY----NQKDMPq.......ssKEK.......MSidegasth...............................................................qhldlsyskRVQI..KNNE.DFIKEFEQ.G.QK...EKEETLTLIQ.........K....GLFDLVDNS..................ENK-.--..--.---------.............................................------..--..--..-------------ivadqsiill...................................................................................
A0A061GTR0_THECC/484-830               ..............................................................FKYSve.dgGERTEQHAISAEISNKV.KG.RQT.......AHEIISLIEE.NIYPA.--HG.---....---LE.............ITLSVVVQTLL...DIGSKSFTHLI.T.VLE.R..YGQV..IAKI............CPD......................................................QDKQVM...L....IAEVSSYWK.NNA...Q...MTSIAIDR.MMGYRLISNLAIVRWVFS................................PEN..IGQ.F.HiS.D.R.P.WEILRN.AVSKTYNR.......ITDLRKEISSLKKGVISAee.....aasK--.......-Akaaleaaeskltlvegepvl.......................................genparlkslktqaekakeeeVSIH..DSLQ.AKEALLAR.A.LD...ENEVLFLSLY.........K....NFSNVLVER..................LPDA.--..--.---------.............................................------..--..--..-------------sragtlqalksihgdsmavdleesstmevddengrpkksqpngskatniynvgekeqwclstlgyvkafsrqyasesn...............
J3P394_GAGT3/538-792                   ..............................................................FKFA.....KDDVPFARQGREMVKLL.KS.KVP.......DEEIQPLIEQ.IQNEA.VDQG.---....RDPLV.............SSTDVFMTAVL...AVGSKSLSHVL.A.CIE.R..VKDR..LLDS...........gSAS......................................................AAARTQ...I....MAAVMSYWS.AHP...G...VALSIVEK.LLNYAILTPQVVAEWAVSg..............................eASD..EAR.L.A.H.A.Y.L.YELVLN.TVIKVSGR.......---ARQIVAQQEAAKPAA..........--Dgd..lamTD................................................................................ASNG..DGPD.HVPYADTP.E.AK...DLRELFQLIE.........S....AVKARSASS..................VLAA.--..--.--AGD----.............................................PLARQW..VD..RW..LRAFQRRAAVEE-n............................................................................................
A0A0C2N1X6_THEKT/490-731               .......................................................ifdyagk----.....----PEKVVITTFATCI.RE.KKS.......NDQIIESLEQ.LAGEN.PSL-.---....-----.............SLLTAIIHFVF...KTGSKTLTHTG.L.MFE.K..YLAI..INHF...........iKKS......................................................DDSAEK...I....IESVYSFWQ.NNP...I...RLKHALSL.FYQNDLLKEIDVISWFMN................................L-Q..KSN.A.E.S.L.F.P.WEVILE.YFSLINCC.......----KKKSAKRKKGDANK..........---.......GE................................................................................KAAS..ISID.VGDNDAKKrS.KE...QRKEILFKMT.........S....HMAEFIHRH..................VSEC.GE..TP.TD--T----.............................................SWFTYI..LQ..RF..QQLLFQNH-----dffv.........................................................................................
T1KXW2_TETUR/489-765                   .....................................................kyavtdesi----.....--KIPGSGLSNQLNELI.KN.KTP.......IEEIMKTLDD.LDNST.NAGD.AE-....FTPHS.............LKIDVFLTVLL...NAASKSFSHLF.S.ALL.K..YNQI..LLSL............NNS......................................................EDAQRC...I....LNAIYEVWR.RHP...Q...LLVVLTDK.LLKAGIVDFPAVANWIFS................................KEL..AND.F.T.R.S.Y.I.WEILHS.TIRRHIKQ.......VENLQKKLQELKEAKEKS.........eKAQs....tdKDekdik.....................................................................eekevePSNE..EAIE.SLEEKVET.A.LS...DQKNLFLIVF.........Q....HFIMILSEH..................IQTC.EA..KG.RSFKN----.............................................HWFRWC..IG..RL..QQVFE-HHQH---vfk..........................................................................................
A0A0B2WQP4_9HYPO/534-780               ..............................................................FKYM.....NSDTPFAKEGQEISGLL.RR.KAP.......DEEIQPLMDS.IQAQA.REQA.---....LDPVV.............ASTDVFVTAVC...WVGSKSLSHVL.A.CID.R..VKGR..LIDV...........gSAH......................................................PGARAQ...I....ISSIMDYWA.AHP...G...VAIIIIEK.LLNYSILTPLSIVDWTLVaast........................apngARG..GAA.L.G.D.A.H.M.LELVAN.TVAKVSGR.......---VRQLL----TSPD--..........---.......--................................................................................----..----.ADGGTCDK.E.VS...SMRDLFAAVN.........D....ALASWASGT..................KDQL.ME..DG.DGSS--ERE.............................................AMIRRW..GQ..RW..LRVFQRLAAMEE-t............................................................................................
W5DXU4_WHEAT/1-200                     .............................................................q----.....-----------------.--.---.......----------.-----.----.---....-----.............-----------...-----------.-.---.-..----..----............---......................................................------...-....---------.---...-...--------.------------------................................---..---.-.-.-.-.-.-.--ILRN.TVSKTYNR.......ISDLRKEIQTLRKSIQVA.........kE-Asa..kaiKEleeaksileivegqpvpse..........................................rpgrlrrlqgfadkakeeeVTIE..ESLE.AKQALLAL.G.LE...EGKELLRLLF.........K....SFLDVLTERlppvsa......dgdvpnL---.--..--.-----RAGDpnvtfpasdpeaatmeidneng.adnnsqvnrenteagytigeleQWCL-C..TL..GY..LKSFSRQYATE--i............................................................................................
G2YWH9_BOTF4/338-585                   ..............................................................FKFD.....DPSTPFSAEGQEILALL.RK.KAT.......EEEIQPVVDR.IHALA.VEQA.--L....PDPLV.............PSTDAYVTSIC...YIGSKSLSHVL.S.CIE.R..CKDR..LLAI...........gPVS......................................................PVARRQ...I....ITSVMQYWK.DQP...G...IGVNIIDK.LLNYTILSPQSVVQWAIG................................S-E..GKR.L.S.Q.S.F.V.YEMVEA.TVGKVTGR.......IRQVQLSL-------RVP..........---.......--................................................................................GLLE..EQKQ.LIEKTVEM.E.RI...NMRELGREMD.........E....LLTAWANGS.................kDQEI.EM..DG.REEDR----.............................................ALVRGW..GE..RW..LRVFRRKFAVEE-a............................................................................................
M2T3B7_COCH5/564-819                   ..............................................................FKYDn...pALDTPYAVEGQTLLNQL.RK.KAT.......AEEVQVTIDS.IHEKA.VAQG.V--....GEVLV.............PSTDAFVTAIC...RLGAKSLSHVL.S.CIE.R..GKDR..LLEI............SQN......................................................ETARRQ...I....VASVVEYWK.DQP...G...VAVRIIDI.LLNYTILAPMTVVQWVFGs..............................hMGA..GEA.L.T.E.S.W.V.FEMVSN.TVAKVTNR.......---NRQIA----SARLQK..........---.......--................................................................................GLPQ..EQIE.MVEATLAK.D.RD...NARELFKYIE.........D....STRGVAEGS.................aDTML.EK..SS.SGALTEEEV.............................................ELIKSW..GK..RW..HTVFIRKAQVEE-s............................................................................................
D0MS56_PHYIT/605-857                   .....................aaspasdfyqsvttklkghppasalrswlneelprleisra----.....-----------------.--.---.......----------.-----.----.---....-----.............EAVEVVWTCIL...EAGAATFTHMR.L.LLE.K..YGKR..SELFggd.....eqsaEET......................................................EADELV...V....VKTVASVWL.KSP...Q...HIGLILNS.MLRQGLLRPATIVTWVFT................................PDA..VQQ.Y.S.W.P.Y.V.WEILND.TLKFVQDA.......IAAKTQQLEQASAPRSSD..........--D.......RD................................................................................NEEM..PDVA.ALEDGRKR.L.QD...ELRQLLVMLF.........R....GLNRVITEH..................KAEC.DS..EG.SDPRD----.............................................NWFRSA..LA..QM..QAVGLRHR-----vple.........................................................................................
A0A0J9Y663_BRUMA/496-755               .........................................................qeeke----.....--------LVAEIERAF.RN.KAE.......PKEITEMLRE.FDKEG.NSL-.---....-----.............ATLSTFFSVML...NAAQKSFSHNF.V.ALT.R..YHET..LKEL...........sGVD......................................................DESSTA...L....LRTLYDVWK.HNR...Q...MMVVLITK.MFRMTLLNANAVVSWLLS................................SYV..DQE.L.H.R.F.W.L.WEALFI.IVKHVCGH.......MNRCKTKLQQMQEKRIKM..........ERS......sGNvcqlfcs..................................................................nkddglwMILD..DDIE.MKKKELKE.L.QD...MLKNLFLNIL.........H....KLVLFLSEH..................LVKS.EM..TE.KNHDT----.............................................YWYRYM..MG..RF..KEMLLKY------wcelf........................................................................................
S8FY88_FOMPI/543-854                   ..............................................................YDYD.....DPSKPYHDSAQSLLSLL.RG.RTK.......AEDVVAHYES.LKNTI.SETA.EVD....VNVST.............VVRSIAVQSLL...HIGNRSFSHFL.N.AIE.R..YLPL..LRNI............ASSgg.................................................tanIDARMD...I....LNAVASYWK.RLK...N...MVVIVFDK.LMQYQIVDPTDVVAWTFLhgk..........................aptGAV..GDS.T.F.D.A.F.Q.WDVLKG.ALDKANGR.......VTIARKKVTALRKEADDT..........AAKa....iaTEgaamdvdadakp.......................................................gelyaystadvmhAAES..PQLT.TALKAFAT.L.TR...EQKAALSRTV.........D....GFVDYLVAA..................D-KS.NQ..KA.GEVIT---Ekewhnr.................................vnwneeQWETWE..TW..CW..FRHFCRAYSPYL-r............................................................................................
M5WNM4_PRUPE/485-830                   ......................................................fkfsveet----.....SEGNGQHALSVDLRTMV.KG.RAS.......AREMIVWIEE.SVFPV.HGME.---....-----.............GTLNVVVQTLL...DIGSKSFTHLI.T.VLE.R..YGQV..IAKL............CGD......................................................QDKQVM...L....ITEIDSYWR.NNS...Q...MSAVAIDR.MMGYRLLSNLAIVRWVFS................................PAN..IEQ.F.HlS.D.R.P.WEILRN.TVSKTYNR.......VCDLRKEILSLKKSIVSAe........eA-Aat...akAElvaaesklslmdgepvlge..........................................npvrlkrlksyaekakeeeLSVR..ESLE.AKEALLAR.A.LD...EFEALFLSLY.........K....NFLNVLTERlps............astC---.--..--.---------.............................................------..--..--..-------------vtlqglksihadsmavdveessamevddengrpkksqlnggrmssvynvgekeqwclstlgylkafsrqyasei...................
A0A068YAH4_ECHMU/628-946               ..........................................gksrpakneltsskrarnke----.....-----------------.--.---.......----------.-----.-KME.DNE....DDFDNclvp.....gvtnRELELFMTALL...YRAHKTISHTC.S.LLN.R..YSEA..FKTL............AST......................................................VELQVE...A....LHILQAVWC.NQS...Q...MVVAISDY.MSRQGMLDPESVVGWAFSpfmsafcg................plapppstVHV..CPR.M.L.Q.S.H.V.WECLMH.TLVRVGQR.......IAQITPRLEAVKDQAGVHh........rK-Sas...gsRSdgsssdldndygdgdlrtkivr....................................vrrrhqrhcrvgshgsssggggGTSP..DRLA.RLKEERGE.A.VR...SQCAVITLLL.........H....RHVRLVATVea..............kaTEEM.GG..PD.NPSDLVDLA.............................................SVAYWL..KG..RL..MQTVLEHQD----qll..........................................................................................
C5DQ64_ZYGRC/755-834                   ...........................................................hig----.....-----------------.--.---.......----------.-----.----.---....-----.............-----------...-----------.-.---.-..----..----............---......................................................------...-....---------.---...-...--------.------------------................................---..---.-.-.-.-.-.-.------.--------.......------------------..........---.......--................................................................................----..----.--------.-.--...-DQECLTFIF.........E....KLINITNEC..................ITQL.AL..QP.EEAV-NIPDvndtnieid..........................wqndlpkldlLWKYET..TM..SF..FKSILRKYVDEYR.............................................................................................
A0A0F2M4P4_SPOSC/607-939               ................................................fkyaepkegaaata----.....ADDVPFAAEGRELAVLL.KR.KAA.......DEDVQAVIER.IHSQA.LDAG.---....LDPLV.............TSTDVFTTAVL...WVGSKSLSHVL.A.AIE.R..TKDR..LLDA...........gAAS......................................................EAARTQ...I....LVAVMAFWG.AHS...G...VAVSITEK.LLNYAILTPDTIVQWALSkn............................dqKGA..SAS.L.A.V.N.Y.V.AELVFN.TVDKVTRR.......---VHQLVGASQTAATAVaaa...tqavE--.......-Aarerqrnppppppppsaavaapkdgdldvamdeda..........gaassthaaasamaeavaaaaadadaaveaaeaarVQAT..ADLE.AARAAEAA.E.TK...AMRDLFRLLG.........E....ALQPWLAGD..................D---.--..--.----S----.............................................GLAKAW..AV..RW..QRVVQRRAAVEE-a............................................................................................
G8BW33_TETPH/542-781                   ............................................................mi--FN.....HEDMPMNDIVSGIIDYF.HE.DIK.......TKNVSSLETL.LETLR.KDHM.SII....KDYDE.............FVTILLTHCLL...YSGRRSLSHTN.K.YIS.D..FYDD..FTHIfn.......trnTDK......................................................SKTEFW...I....IKSTLMFWN.SNS...Q...TAFLTLDG.FRQYGLVSSNALIRFCLKd..............................eDGK..IPA.I.I.D.S.T.A.TEATLR.VLHQDVSH.......------------------..........---.......--................................................................................----..----.--------.-.TE...DIFDELLGIF.........D....ELCKIIKNSfdkkg........dihglK---.--..--.--D-----Tglmtld.................................enienmYWKYSM..SL..RF..LKTILRMFTEEY-k............................................................................................
A0A0F9ZCP9_9MICR/296-389               ...................................yevgsinsikkedldfnknkkdfyrdf----.....-----------------.--.---.......----------.-----.----.---....-----.............----------C...LLGSPSVSHFL.S.YLE.I..YKNE..MK--............-MD......................................................EEQQKI...F....LEIFCEIFS.NRT...S...FKKIVIDK.MVKFNFIKSE--------................................---..---.-.-.-.-.-.-.------.--------.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------lllk.........................................................................................
A0A0E0KDN5_ORYPU/442-788               ......................................................fryhsdeg----.....KESTDGHRLSKELVGMV.RG.RKT.......QGDIISWVDG.QIIPV.--NG.---....---AK.............FALDVVSQTLL...DIGSKSFTHLI.T.VLE.R..YGQI..ISKL............CPN......................................................EEMQLL...L....MDEVSAYWK.NST...Q...MIAIAIDR.MMGYRQISNLAIVKWVFS................................PAN..VDQ.F.H.V.SdR.P.WEILRN.AVSKTYNR.......IFDLRKEIQTLRKGLQAAkv.....aseK-A......aREleeaksiieivdgqpvpse..........................................npvrlrrlqvradktkaeeVTTE..ESLE.AKEALLAR.G.LE...ESKELLRLLF.........K....SFVEVLTERlppisa......dgdvpnL---.--..--.-----RAGDpnvnsaardpeattmeidneng.adndsqlngqnkkighnvgeleQWCL-C..TL..GY..LKSFSRQYATE--i............................................................................................
A0A074W1V9_9PEZI/537-788               ..............................................................FKYL.....NEQTPYAQQGNAIHALI.RK.KAT.......EEEIEAVINE.IQALA.SEHG.V--....EDVLV.............PSTDAYMTSIC...AVGSKSLSHVL.S.CIE.R..CKER..LLAI...........gPQS......................................................ELARRQ...I....ITSVVDYWA.DHH...G...TAVNIIDK.LLNYTIITPMSVIEWALHd..............................hLQH..GRA.L.A.Q.T.H.I.YEMISA.TMFKVSNR.......---MRQIVRARAES----..........---.......--................................................................................DLSE..EQKS.LLDETLVR.E.RQ...TMRDLFNAII.........E....AVSTVANAAqd..............dmIERF.DG..DN.T------EQ.............................................TLLQQW..GA..RW..ARVWRRKMAVEE-a............................................................................................
F2TS60_AJEDA/559-818                   ..............................................................FKYA.....LETTPFATEAQEIMQLI.RK.KAP.......ETEIEPHILA.IQHAA.ASQP.D-I....ADPLI.............PSTDAFVTSIC...YVGSKSLSHVL.S.CIE.R..SKER..LLAI...........gPKS......................................................PAARRQ...I....ITSVLSYWA.DQP...G...IGVNIIDK.LLNYTILTPLSVVEWALVd..............................hIEG..GAA.L.A.K.A.H.V.YEMVAA.TMGKVTNR.......---IRQIVAARVQA----..........---.......--................................................................................GIVE..PQLS.VIDETLRR.E.RG...DVQVMFEVIE.........G....ALEGVINGS..................NESG.SG..SG.SGME-DVGEgvv.......................................eekGLIREW..AR..RW..LRVFKRLRAVEE-a............................................................................................
I2K0B9_DEKBR/369-652                   ..............................................................YLFN.....NEDHIFHEICHSIYTNM.QE.GES.......LQSFNDLIAE.LTSQI.KEAD.ESE....QPK-Cgi.........arYIVVLVTQSVC...VIGSRSLSVIDgG.ALE.L..CGDK..IRKXlgl......elkD-Kdtdaedidn....................................dqfxdvsdtQQRQKW...V....IEAVLRLWN.REP...R...IGYLILEK.MRNKELVTSSQIVESLFTa..............................hGTK..IPA.L.T.E.L.Y.A.DELLDR.LLLQRNLG.......------EGEDDEAE----..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------xdhndqkwtxfaksclktlntlisdykdeaeekgtidiksseklacedatvtkkstdllwaidgllqlvesklkkxesrkekle.........
A0A0K0JCB8_BRUMA/501-770               ............................................................sy-DLN.....DDEHPDRDFAIVLEKAF.RE.KIS.......ADGMIDLLRN.QSENQ.MDIN.---....-----.............FRLSIFFKVLL...YLARKTFSHNF.V.ALT.R..YYST..LKEL...........iGGR......................................................EDVQLT...I....LRTLYEIWK.LHG...Q...MIIVLVTK.LLKMSLVDASAVVAWLFS................................DEM..KPE.F.E.R.L.W.I.WEILNI.ALEHVSGH.......VRRNRQAIENAKLKKEEKe.......lnD-Ekd..dfdMEtneh........................................................................ddmaDPNA..VESF.VKESEFAD.L.HE...CLKNLLLDVL.........H....KFTVTLTEH..................IVNS.ES..NG.NDFQN----.............................................NWYLYV..TG..RF..KNVFLKYWRD---lfe..........................................................................................
M2SZS5_COCSN/564-817                   ..............................................................FKYD.....SPDTPYAVEGQTLLNQL.RK.KAT.......AEEVQVTIDS.IHEKA.LAQG.V--....GEVLV.............PSTDAFVTAIC...RLGAKSLSHVL.S.CIE.R..GKDR..LLEI............SQN......................................................ETARRQ...I....VASVVEYWK.DQP...G...VAVRIIDI.LLNYTILAPMTVVQWVFGs..............................hMGA..GEA.L.T.E.S.W.V.FEMVSN.TVAKVTNR.......---NRQIA----SARLQK..........---.......--................................................................................GLPQ..EQIE.MVEATLAK.D.RD...NARELFKYIE.........D....STRGVAEGS.................aDTML.EK..SS.SGALTEEEV.............................................ELIKSW..GK..RW..HTVFIRKAQVEE-s............................................................................................
A0A0A0M082_CUCSA/485-828               ......................................................fkfstedd----.....GEKSEQHALSAELYNMV.KG.RAP.......ARELISWLDE.SVIPK.--HG.---....---LD.............VSLVVVVQTLL...DIGSKSFTHLI.T.VLE.R..YGQV..ISRI............CHD......................................................QDKQVL...L....ISEVGSYWK.NNT...Q...MTAIAIDR.MMGYRLISNLSIVKWIFS...............................pENL..QLY.H.T.S.D.R.P.WEILRN.ALCKTYNR.......ISDLRKEISSLKKDVVAAe........eA-Aa....rtQEelsaaesklslvdgepvlg.........................................enpvrlkrlksyagrakeqeI--SirDSLE.AKEALLAR.A.LE...ENEILFLSLY.........K....SFSSILTERlpa...........saqtL---.--..--.QDLKSTNPAdanamdveepsamemdnves....rpekshlngrtehaytvceneQW-CLT..TL..GY..VKAFSRQYAS---ei...........................................................................................
NCBP1_CAEBR/487-763                    ..........................................................ryll----.....DEEDAMSQRAETFTQMF.QE.RQP.......ADAFLKELKS.TDEND.ELPY.N--....----I.............NEFGVFVTVML...KMASKTYSHNF.S.ALF.R..YKDT..LKTV...........cDAA......................................................EQYQEK...L....LETLYSCWK.SNQ...Q...MLMILTDK.LLKMQIIDCSSVVGWLFD................................EKM..WQE.H.N.R.Q.W.L.FEVLNQ.ALEKLTRQ.......INVVEKDIKDLTEKVESKek......vtE-Agd...vkMEeetv.......................................................................vdeklKGEM..EELE.NHKEKLDR.M.VS...FQRNLFNDFL.........I....AFVEEIKSAa...............tnTSEM.DG..SG.DVGGS--ES.............................................SKFLWL..RG..RF..CHVLLAHAETL--lk...........................................................................................
NCBP1_DROWI/488-770                    ..............................................................YKYAn..eeAANLPGTTVAHQLVVAI.RQ.KCT.......PEEVVNILKE.IPSSG.YSGE.EMS...dGSFNA.............LKIDVFVQTLL...NLGSKSFSHSF.A.AIS.K..FHAV..FRAL............AET......................................................EEAQIC...I....LHNIFELWS.SHQ...Q...MMVVLIDK.LLKLQIVDCSAVATWIFS................................KEM..TGE.F.T.K.M.Y.L.WEILHL.TIKKMNKH.......VIKLNTELSDAKDKLSKAds......ssS--.......-Dsdedtphk...............................................................rkkpithadKPSE..EVVE.RMEEKLEA.A.NV...NQKRLFLIVF.........Q....RFIMILSEH..................LLRS.DT..DG.RDPDT----.............................................DWYRWT..IG..RL..QQVFLMHHEQVQK.............................................................................................
A0A0E0KDN6_ORYPU/422-768               ......................................................fryhsdeg----.....KESTDGHRLSKELVGMV.RG.RKT.......QGDIISWVDG.QIIPV.--NG.---....---AK.............FALDVVSQTLL...DIGSKSFTHLI.T.VLE.R..YGQI..ISKL............CPN......................................................EEMQLL...L....MDEVSAYWK.NST...Q...MIAIAIDR.MMGYRQISNLAIVKWVFS................................PAN..VDQ.F.H.V.SdR.P.WEILRN.AVSKTYNR.......IFDLRKEIQTLRKGLQAAkv.....aseK-A......aREleeaksiieivdgqpvpse..........................................npvrlrrlqvradktkaeeVTTE..ESLE.AKEALLAR.G.LE...ESKELLRLLF.........K....SFVEVLTERlppisa......dgdvpnL---.--..--.-----RAGDpnvnsaardpeattmeidneng.adndsqlngqnkkighnvgeleQWCL-C..TL..GY..LKSFSRQYATE--i............................................................................................
S8ADJ2_DACHA/535-781                   ..............................................................FKFE.....VDDIAFPEEGKQLLNLI.RQ.KAP.......NEEVDTLMNA.ITEAA.NNKG.--L....PDPSK.............YARDMYMTCIC...HIGAKSLSHVL.S.CIE.R..CKDK..LTQL...........gQES......................................................NQAQRQ...I....VGTVMRYWH.EQP...G...IGANVIDK.LLNYSILTPLSVIEWVIL................................DAG..RDA.L.P.R.G.H.A.WEMVNT.TTRKVVSR.......----TRNLAAARSVP---..........---.......--................................................................................DLPE..DQMT.MVEQGHDV.A.KA...EQAELFRVVM.........E....SLGKYADGT..................VPPP.EG..TT.EDDA-----.............................................VWLKWW..AA..SW..LRALKRQSDIEE-a............................................................................................
Q4UGZ6_THEAN/708-947                   .......................................................vlnsqvt----.....---------------SM.ET.TNL.......QEDMNTNLTN.TKSASlMSDE.NAE....VWKRD.............DLIMLFWDTLL...IFGSKSMTHLY.R.LLD.F..HSDV..LKMFetv......elpFE-......................................................ESLPYK...V....MWQTVMTFE.RDH...K...RLELSFDF.FIRNNVFTCPVILQFLFT................................LPD..N-V.L.L.S.N.F.F.FYAVNS.VFSEVNSR.......LVNFRENYKVALRELAGTv.......amEAK......kQEldaveldy................................................................fnffdhfvH---..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------lvsdrlsssepklakvmeeilvrklvkysfqeklnlklyn.....................................................
G3UGQ0_LOXAF/485-760                   ..............................................................YKYGd..esSNSLPGHSVALCLSVAF.KS.KAT.......NDEIFSILKD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.T.R.L.F.V.WEILHS.TIRKMSKH.......VLKIQKELEEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGALE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TNVLT----.............................................PWYKNC..IE..RL..QQIFLQHHL----iiqq.........................................................................................
I1N7Z9_SOYBN/490-828                   ......................................................edgkesne----.....------HVLSGQLNNMV.KG.KAP.......VREIISWIDE.SVFPS.NG--.---....---LE.............VTLRVVVQTFL...NIGSKSFTHLM.T.VLE.R..YGQV..FAKV............CPD......................................................QDKQVM...L....IAEVSAFWK.SNT...Q...MTAIAIDR.MMGYRLVSNLAIVRWVFS................................AEN..IEQ.F.H.T.SdR.P.WEILRN.AVSKTHNR.......ISDLRKEILSLKKNFSSAee.....takE--.......-Akaeldaaeskltlvdgepvl.......................................gdnptrlnrlklhaektknevVSLQ..KSSE.AKEALLAQ.A.ME...ENEALFLLLY.........K....SFSNVLIER..................LPEG.--..--.---------.............................................------..--..--..-------------artlhelksaqvdvvmavdpeepssmeldnesqrpqnsqtngekkggaynvgekeqwciitlgyvkafsrqyaaei.................
K9GB08_PEND2/520-773                   ..............................................................FKFS.....SEMAPYSNEGQELMQLI.RK.KAS.......DEEIQPVITA.IEDQA.KSQG.VD-....-DPKI.............PSTDAFVTSLC...FVGSKSLSHVL.S.CIE.R..SKDR..LLAI...........gTDS......................................................QHARRQ...I....ITSVMDYWV.DQP...G...IAINIIDK.LLNYTILSPLSVLEWALTe..............................sVAA..GTI.L.S.K.P.H.V.FEMISA.TVGKVTNR.......---MRQIV----AARAQP..........---.......--................................................................................GLYE..PQLS.VIDDTLVR.E.RA...DMQALFKYIE.........D....SIVSVAAGSnd..............eqMERG.DG..SG.TLPED----.............................................AIIRQW..GR..RW..LRVFRRKAAVEE-s............................................................................................
E7NLK7_YEASO/578-825                   .............................................................l-YFR.....QEGVPMENTVRKILDYT.HK.ANN.......SREVTELESI.LGELK.NEYG.SII....SDFNR.............FVIILLVQAVT...DSGSRSLSHAN.K.YIN.D..LKED..LKTI............FAKie.................................................ldiETKEYI...I....IEAVLTFWN.ANP...Q...TGFLVADA.FKYAGLITSRTIFTFIFNe..............................tGLK..NNG.L.I.E.A.T.A.IEAVFR.NLSQQISE.......------------------..........---.......--................................................................................----..----.--------.-.EN...ESGNNFEFVF.........E....RLCTIANST..................IDLL.DV..NA.DEDIE-IPKvngemdid............................dieddkldlKWKYFT..VI..GF..IKSILRRYSHEYR.............................................................................................
B8PDA0_POSPM/533-842                   ..............................................................YEYD.....DPAKPYYEAAQSVLNLM.RG.RTK.......AEDVVSHLDS.LKNTL.SETA.DGD....VNVNA.............VLRSIAVQSLL...NIGSRSFSHFL.N.AIE.R..YLPL..LRNL............ASGsiasn............................................tggsnVEARMD...I....LDAVSSFWK.RSK...N...MVVIVFDK.LMQYQIVDPTDVVAWTFThgg..........................vhpAAG..EKT.T.F.N.A.F.Q.WDVLKG.ALDKANGR.......VMIARRKVTALRKEEDDNaa......rvKAS.......-Dsatasmevd..............................................................aeakpavmpAAES..PALS.TALKAFTT.L.TR...EQKAALSRTL.........D....GFVSYLAAEd................rLSSL.AG..DV.ITEKA---Wqnra....................................nwdqpEWNTWE..TW..CW..YRHFSRTYSPYL-r............................................................................................
A0A090LDE9_STRRB/494-768               .......................................................kdcdedt----.....------YKISHDLAESL.SK.RIT.......NDEILKYLTK.SDDDE.NMDG.GQL....-NVATvy.........dsEKIKMLMATLL...DLAQNAYTHSV.T.FFL.R..YRPA..FLEL...........vRHD......................................................AGIRRI...I....LESIFTAWK.FNP...Q...LIELLTDK.LLKMQILDTYSIVKYILE...............................sQDL..ADY.V.N.K.K.Y.F.HHVLYQ.SIHRLSTH.......VRNLTNDYEKLKSQINSVer.....kllKK-.......-Edsnmdddgtvev........................................................cdeididslenpE--EwiNNQR.NVLEEKEK.C.LS...ENSNVLKNIL.........E....EIVTYYSSN..................LTSI.NK..E-.---------.............................................------..--..--..-------------sdeifynfvsdsfk...............................................................................
K5WYN1_AGABU/531-842                   ..............................................................FEYE.....DPSHPHHEAAQTVLNLF.RG.RAN.......AEDVITHLDT.LKSML.EASD.EGH....MDVDS.............LVRSIAVQSLL...NIGSRSFSHLL.N.GIE.R..YLAL..LRSL............ASGgvsss............................................ggqgnAKAKSD...I....LTAVASFWR.RNR...Q...MVGIVFDK.LMQYQIVDPTDVVGWTFVngsi.......................vggvrEPG..MPL.N.L.S.V.F.E.WDLLKG.ALDKANGR.......VIIARRKIATLRKEDDDAra......raKAKq.....gMEvdgei.....................................................................kpdetdNVEN..PALE.TALKASES.L.VK...EQKAALSRTL.........E....GFISCLAPP..................--EG.GS..NP.NPNSRSVIDaaawnn................................ratwdrdDWNAWE..TW..GW..YRQFVREYAPYL-r............................................................................................
NCBP1_RAT/485-760                      ..............................................................YKYGd..esSNSLPGHSVALCLSVAF.KS.KAT.......NDEIFSILKD.VPNPN.QVDD.DDE....-GFRFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DKGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.T.R.L.F.V.WEILHS.TIRKMNKH.......VLKIQKELEEAKEKLARQ.........hKRRs.....dDDdrgs........................................................................drkdGALE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TSILT----.............................................PWYKNC..IE..RL..QQIFLQHHQII--qq...........................................................................................
X0CZL2_FUSOX/531-776                   ..............................................................FKFQ.....NSETPFSKEGQEIASLL.RR.KAP.......DEEFQPLFES.IQTQA.SEQS.---....LDPIV.............ASTDVFMTAVC...WVGSKSLSHVL.A.CID.R..TKGR..LLEA...........gNSS......................................................EAARAQ...I....ISAVMSYWH.AHP...G...VALSIIEK.LLNYSILTPFTVVDWALVast.........................pangTDG..GDS.L.T.E.P.H.I.FELVFN.TIFKVTRR.......---SRDVV-A--------..........---.......--................................................................................----..-APE.TDEETRIK.E.IK...STRDLFRAMN.........D....ALVSWAGGS..................KDEL.ME..GG.DGS--SDRE.............................................AMIRRW..GQ..RW..LRVFKRMGAIEE-a............................................................................................
L2GAU7_COLGN/554-798                   ...........................................................lte----.....DKGTPFSAEGREIASLL.RR.KAP.......DEEFQPIIEK.IHSLA.IEHD.---....LDPLV.............TSTDVFVTAVC...WVGSKSLSHVL.A.CIE.R..TKDR..LLDV...........gAAS......................................................EAAKAQ...I....ITAVMSYWA.AQP...G...VAISIVEK.LLNYSILLPLSVIDWALVssn.........................hingQSS..GDS.L.A.Q.T.H.V.FELVFG.TVAKVTGR.......VRQLQTEA---DA-----..........---.......--................................................................................----..----.-DDEAKER.E.VK...AMRDLFKAME.........D....ALVSWASGS..................KDEM.ME..EM.DGA--GQRD.............................................SLLRRW..GE..RW..LRVFRRRAAIEE-a............................................................................................
A0A091CMF8_FUKDA/333-417               ..............................................................YKYGd..esSNSLPGHSVALCLAVAF.KS.KAT.......NDEIFSILKD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..----..----............---......................................................------...-....---------.---...-...--------.------------------................................---..---.-.-.-.-.-.-.------.--------.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------l............................................................................................
H2M5S5_ORYLA/497-777                   ..............................................................FKYEd..etASSLPGYPTSVTVSNAI.KN.RAS.......NEEILAILKE.VPNPN.QEDD.DDE...gEAFNP.............LKIDVFLQTLL...HLAAKSFSHSF.S.ALG.K..FHEI..LKTL............TES......................................................DEGKLH...I....LKVVYDVWR.NHP...Q...MIAVLVDK.MVRTQIVDCAAVANWLFS................................QDM..AHE.F.T.R.L.F.I.WEILHS.TIRKMNKH.......VQKIQKELEEAKEKLEKQq........nK-Rrd...sgDDedmek.....................................................................nsedeeGQLE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMLLTEH..................LVRC.ET..GS.VDIST----.............................................PWYKNC..IE..RL..QQVFLMHHVTI--qq...........................................................................................
Q5AYX3_EMENI/530-783                   ..............................................................FKYA.....SDTTPYANEGREIMQLI.RR.KAA.......DDEIQPHITA.IEERA.AGLG.VEI....--PLL.............PSTDAFVTSIC...FVGAKSLSHVL.S.CIE.R..NKER..LLAI...........gPRS......................................................PGARRQ...I....ITSVMEYWV.DQP...G...IGINIIDK.LLNYTILTPLSVIEWALVd..............................hLDA..GTI.L.A.K.T.H.I.FEMISA.TVGKVTNR.......---LRQIV----AARIQP..........---.......--................................................................................GLYE..PQLS.VLDETLNR.E.KK...DMHALFQVIE.........D....SVVSVAGGSnd..............qlMERG.DG..SG.DLPED----.............................................EIIREW..GK..RW..LRAFRRKAGVEE-a............................................................................................
C5GXV3_AJEDR/530-789                   ..............................................................FKYA.....LETTPFATEAQEIMQLI.RK.KAP.......ETEIEPHILA.IQHAA.ASQP.D-I....ADPLI.............PSTDAFVTSIC...YVGSKSLSHVL.S.CIE.R..SKER..LLAI...........gPKS......................................................PAARRQ...I....ITSVLSYWA.DQP...G...IGVNIIDK.LLNYTILTPLSVVEWALVd..............................hIEG..GAA.L.A.K.A.H.V.YEMVAA.TMGKVTNR.......---IRQIVAARVQA----..........---.......--................................................................................GIVE..PQLS.VIDETLRR.E.RG...DVQVMFEVIE.........G....ALEGVINGS..................NESG.SG..SG.SGME-DVGEgvv.......................................eekGLIREW..AR..RW..LRVFKRLRAVEE-a............................................................................................
A0A0A2KK18_PENIT/534-787               ..............................................................FKYS.....SEMAPYSKDGQELMQLI.RK.KAS.......DEEIQPVITA.IEDQA.KSQG.VD-....-DPKI.............PSTDAFVTSLC...FVGSKSLSHVL.S.CIE.R..SKDR..LLAI...........gAES......................................................QHARCQ...I....ITSVMDYWV.DQP...G...IAINIIDK.LLNYTILTPLSVLEWALSe..............................sVAA..GTI.L.S.K.P.H.V.FEMISA.TVGKVTNR.......---MRQIV----AARAQP..........---.......--................................................................................GLYE..PQLS.VIDETLAR.E.RT...DMAALFKYIE.........D....SIVSIAAGSnd..............eqMERG.DG..SG.TLPED----.............................................AIIRQW..GR..RW..LRVFRRKAAVEE-s............................................................................................
A0A093XLE1_9PEZI/534-785               ..............................................................FKYN.....DEDTPFAAEGREIHTLL.KR.KAP.......EPEIQTVIDQ.IHTQA.TTIA.--I....HEPLL.............SSTDAYVTSIC...YIGSKSLSHVL.S.CIE.R..CKER..LLSI...........gNTS......................................................ETARRQ...I....ITSVMAYWV.DQP...G...IGVNIVDK.LLNYTILTPLSVVEWALLd..............................dTKA..GDK.L.A.E.P.F.V.FEMVAG.TVQKVTNR.......---LRQIV----ASRNAP..........---.......--................................................................................GLEH..EQRL.LLDETLLR.E.RV...AMKDMFKVME.........D....ALFSWAAGS..................KDQT.ME..GG.NGDT--SDE.............................................AFIRRW..GE..KW..LRVFRRKMAVEE-a............................................................................................
G8ZLM5_TORDC/745-825                   .............................................................s----.....-----------------.--.---.......----------.-----.----.---....-----.............-----------...-----------.-.---.-..----..----............---......................................................------...-....---------.---...-...--------.------------------................................---..---.-.-.-.-.-.-.------.--------.......------------------..........---.......--................................................................................----..----.--------.Q.EA...DDNDCLKFLF.........E....RLLNITNEA..................IAQL.QV..QP.QEVIT-IPEiseemdidv...........................enelprldlLWKYET..AV..SF..FKSILRKYADDF-k............................................................................................
A0A0N4TG51_BRUPA/1-160                 ..............................................................----.....-----------------.--.---.......----------.-----.----.---....-----.............-----------...-----------.-.---.-..----..----............---......................................................------...-....---------.---...-...MIIVLVTK.LLKMSLVDASAVVAWLFS................................DEM..KPE.F.E.R.L.W.I.WEILNI.ALEHVSGH.......VRRNRQAIENAKLKKEEKe.......lnD-Ekd..dfdMEtneh........................................................................ddmaDPNA..VESF.VKESEFAD.L.HE...CLKNLLLDVL.........H....KFTVTLTEH..................IVNS.ES..SG.NDFQN----.............................................NWYLYV..TG..RF..KNVFLK-------vk...........................................................................................
C0P170_AJECG/349-601                   ..............................................................FKYA.....LESTPYAAEAQEIMQLI.RK.KAP.......DAEIEPHILA.IQHAA.ANQ-.TDT....ADPLI.............PSTDAFVTSIC...YVGSKSLSHVL.S.CIE.R..SKER..LLSI...........gPQS......................................................PAARRQ...I....ITSVLSYWA.DQP...G...IGVNIIDK.LLNYTILTPLSVIEWALVd..............................hIEG..GAA.L.A.K.A.H.V.YEMVAA.TMGKVTNR.......---IRQIVVARVQR----..........---.......--................................................................................GIVE..PQLS.VIDETLRR.E.RG...EVQVMFEVIE.........G....ALEGVISGS.................gMEDV.DG..GW.VGEGE---K.............................................VIIREW..AR..RW..LRVFKRLRAVEE-m............................................................................................
A0A094IIM4_9PEZI/549-800               ..........................................................iklt----.....NLDTPFAAEGREIHTLL.KR.KAP.......EPEIQTVIDQ.IHTQA.TTIA.--I....HEPLL.............SSTDAYVTSIC...YIGSKSLSHVL.S.CIE.R..CKER..LLSI...........gNTS......................................................ETARRQ...I....ITSVMAYWV.DQP...G...IGVNIVDK.LLNYTILTPLSVVEWALLd..............................dTKA..GDK.L.A.E.P.F.V.FEMVAG.TVQKVTNR.......---LRQIV----ASRNAP..........---.......--................................................................................GLEH..EQRL.LLDETLLR.E.RV...AMKDMFKVME.........D....ALFSWASGS..................KDQA.ME..AG.IGETT--DE.............................................AFIRRW..GE..KW..LRVFRRKMAVEE-a............................................................................................
G1LDU0_AILME/487-762                   ..............................................................YKYGd..esSNSLPGHSVALCLSVAF.KS.KAT.......NDEIFSILKD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.T.R.L.F.V.WEILHS.TIRKMNKH.......VLKIQKELEEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGALE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TSVLT----.............................................PWYKNC..IE..RL..QQIFLQHHQII--qq...........................................................................................
M4D9I5_BRARP/484-811                   ......................................................yrysleeg----.....KEKTEEHQLSAELNRKV.KE.KQS.......ARDMMSWIEE.TIYPV.HGF-.---....----E.............VTLTVVVQTLL...EIGSKSFTHMV.T.VLE.R..YGQV..FGKL............CPD......................................................NDKQVM...L....LSQVSAYWK.NNA...Q...MTAVAMDR.MMGYRLVSNQAIVRWVFS................................PEN..VDQ.F.H.V.S.D.QpWEILGN.ALNKTYNR.......ISDLRKDISNITKNVLVA.........eKASan...arAEleaaesklslvegepvlge..........................................npgkmkrlkstvektgeaeVSLR..ESLE.AKEALLNR.A.LS...ETEALLLLLF.........Q....SFSAVLKERlpep.........akarsMEDL.--..KS.EDGNSSAMEvdsengnpk...........................kkteigereQWCLST..L-..GY..LTAFTRQYANE--i............................................................................................
A0A0E9NFN8_9ASCO/514-758               ........................................................efkyad----.....------NEDVKVLLEMI.RT.KKP.......ADEIETQLKK.VEDKA.EGTE.---....QEKAR.............KAQHVLVQCVL...QLGEKSFSHAL.N.TFE.R..SLPV..LLAR...........cASS......................................................TEARRF...T....VGCVMEYWA.PQP...S...IGATLLDK.LLNYTVLNPLAVVEWFFT................................EGD..VEL.A.C.R.S.H.A.WEALET.TLDKVNNR.......VIQVRERAEQARAA----..........---.......--................................................................................GLSE..EDES.KMQATLDN.V.HA...EQADVWRTIF.........R....SYTSFVERA..................-GRA.ED..GA.SEERV----.............................................QWRVKW..AK..GW..YKAVVRRYFEA--ek...........................................................................................
W9WCJ0_9EURO/542-794                   ..............................................................FKYN.....EESTPFAVEAKEIAQLI.RR.KAQ.......HDEFTPVLEK.IEQDA.TSQG.--L....PEPTI.............AAVDAFVTSIC...WVGSKSLSHAL.A.CTE.R..CKGR..LLEF...........sASS......................................................STCRKQ...I....VTSVMDYWR.DQR...G...VGVILIDK.LLNYQILTPASVIEWALId..............................hVDR..GRL.L.A.T.T.W.C.YELVNN.TTHKVAGR.......---VRSLVAAIRTP----..........---.......--................................................................................GLTE..EQRK.ELQSTLTS.E.LE...GMKSLFATIE.........D....AVGSIRDGN..................QDEM.IE..S-.SDALRAEDE.............................................ALLRNW..GG..RW..ARVFQRKGAVEE-s............................................................................................
F9FRW4_FUSOF/531-776                   ..............................................................FKFQ.....NSETPFSKEGQEIASLL.RR.KAP.......DEEFQPLFES.IQTQA.SEQS.---....LDPIV.............ASTDVFMTAVC...WVGSKSLSHVL.A.CID.R..TKGR..LLEA...........gNSS......................................................EAARAQ...I....ISAVMSYWH.AHP...G...VALSIIEK.LLNYSILTPFTVVDWALVast.........................pangTDG..GDS.L.T.E.P.H.I.FELVFN.TIFKVTRR.......---SRDVV-A--------..........---.......--................................................................................----..-APE.TDEETRIK.E.IK...STRDLFRAMN.........D....ALVSWAGGS..................KDEL.ME..GG.DGS--SDRE.............................................AMIRRW..GQ..RW..LRVFKRMGAIEE-a............................................................................................
H2AM81_KAZAF/590-839                   .............................................................l-FFK.....QDSLPIESIVRDILDFM.HK.PNN.......TRDINELKTL.LESLT.NEYG.SIM....ADRSR.............FIIVLLIQCLC...HSGSRSLSHAN.K.YIS.D..LGSD..LKEV............FDTle.................................................ieeDIKEYT...I....IEAVLSYWV.KNS...Q...TGYLIVDT.MKFADLVKPKSIITFCFTe.............................fnGSE..NYG.L.V.D.V.T.A.IDSVFR.TLSQELVS.......------------------..........---.......--................................................................................----..----.--------.-.SP...DSVELFEFVF.........E....KLCKVMTSS..................IEQV.GL..SN.NEEVT-LPVinsaddmdv...........................eddlmkqdlLWKYDT..AM..CF..AKSLLRKFSTQYK.............................................................................................
G3ATF2_SPAPN/671-853                   ..............................................................YNFA.....NPDLPYNESATKVYEFVvAH.WKT.......NDEFSTLCQD.ILTSL.ESHP.---....-NPMQ.............FLVNLVFQTYA...YIGSRSIYSVV.S.ILS.R..DINK..LKHL............SGAtityandeph.................................fdtpeltpeevTLRQQW...I....IDAIFRVWI.HQP...Q...VVFLILEY.LIEFGIVDAKHIVTKALE................................S--..NLI.I.D.N.V.S.C.MESVNR.ILGSANKE.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------liiv.........................................................................................
NCBP1_YEAST/581-828                    .............................................................l-YFR.....QEGVPMENTVRKILDYT.HK.ANN.......SREVTELESI.LGELK.NEYG.SII....SDFNR.............FVIILLVQAVT...DSGSRSLSHAN.K.YIN.D..LKED..LKTI............FAKie.................................................ldiETKEYI...I....IEAVLTFWN.ANP...Q...TGFLVADA.FKYAGLLTSRTIFTFIFNe..............................tGLK..NNG.L.I.E.A.T.A.IEAVFR.NLSQQISE.......------------------..........---.......--................................................................................----..----.--------.-.EN...ESGNNFEFVF.........E....RLCTIANST..................IDLL.DV..NA.DEDIE-IPKvngemdid............................dieddkldlKWKYFT..VI..GF..IKSILRRYSHEYR.............................................................................................
F1ST49_PIG/424-699                     ..............................................................YKYGd..esSNTLPGHSVALCLAVAF.KS.KAT.......NDEIFSILKD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.T.R.L.F.V.WEILHS.TIRKMNKH.......VLKIQKELEEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGALE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TSVLT----.............................................PWYKNC..IE..RL..QQIFLQHHQII--qq...........................................................................................
T5A852_OPHSC/537-782                   ..............................................................YKFS.....NPDTPFAKEGQEIGALL.RR.KAP.......DEELQAVIDS.IQAQA.AERA.---....VDPVV.............TSTDVFMTAVC...WVGSKSLSHVL.A.CID.R..TKGK..LVEA...........gSAS......................................................AAARSQ...I....VAAVMSYWH.AHP...G...VALSIIEK.LLNYSILTPFSVVDWTLVast.........................spngTNG..GES.L.G.Q.S.H.I.FELVCN.TVAKVSGR.......---LRQVL----TSP---..........---.......--................................................................................----..---D.ADDETREK.E.IL...AMRELLGAAN.........D....ALVSWAGGN..................KDEM.ME..TG.DGS--SEKD.............................................ALIRRW..GQ..RW..LRVFQRLAAIEE-a............................................................................................
K3VL31_FUSPC/532-777                   ..............................................................FKFK.....NPDTPFSKEGMEIAGLL.RR.KAA.......DEEFQPFINS.IQSQA.SELS.---....LDPLV.............ASTDVFMTAIC...WVGSKSLSHVL.A.CID.R..AKGR..LLEA...........gNTS......................................................EAARAQ...I....ISALMSYWH.AHP...G...IALSITEK.LLNYSILTPLTVVDWAIVast.........................pangANG..GGS.L.A.E.P.H.I.FELVSN.TLTKVATR.......---SRQVI----SSP---..........---.......--................................................................................----..---D.TDDETRAK.E.VK...SIHDLFRATN.........D....ALISWAGGS..................KDEL.ME..EG.DGS--SDRE.............................................AMIRRW..GQ..RW..LRVFNRMGAVEE-a............................................................................................
A0A080WN96_TRIRC/1-237                 .............................................................m----.....--------------KLI.RQ.KSS.......DEEIEAVITS.IEEQA.KTHG.--L....TDPLI.............ASTDVYVTSIC...YVGSKSLSHFL.S.CIE.R..CKDR..LLAI...........gPKS......................................................DAARRQ...I....INSVMDYWV.DQP...G...IGINIIDK.LLNYTILTPLSVLEWALVd..............................nLAA..GST.L.A.K.P.H.I.FEMISA.TMRKVTNR.......---MRQIVAARTQP----..........---.......--................................................................................TLYE..PQLS.ILDETLKK.E.KA...DMLSMFQLIE.........D....TLVPVAGGYsd..............gmMER-.--..--.TEDDSLQPE............................................nAMIQQW..GS..RW..LNVFRRKVAVE--ra...........................................................................................
C5DQ64_ZYGRC/585-760                   .............................................................l-YFR.....HESFPAHQQVRQLLDYV.HK.QND.......SREVSELETI.INSIR.QEYG.DII....ANFEK.............FIIVVLIQTVV...HSGSRSLSHAN.K.YIG.D..LKDD..LTHIlg.......qmeMDD......................................................STKQFT...I....VEAVLRFWN.SNS...Q...NGFLIADT.FKFAGFLSPLSIFQFSFNeek..........................sggSTK..NYG.L.V.D.G.T.S.IESTFR.NLTQHIGD.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------qe...........................................................................................
U4L4H6_PYROM/539-791                   ..............................................................FKFD.....LDENPFKIAGKELLVAV.SE.RKE.......DAEVEPLIAA.IATAA.AEAGlADE....ADPRK.............YARDAYITCIC...HIGAKSLSHVL.S.CIE.R..CKDK..LLSI...........gHEH......................................................PDARRQ...I....VGSVLSYWK.DQP...G...IGANVVDK.LLNYSVVTPLSVIEWVLL................................DAG..PEA.L.A.K.T.Y.A.WEMVAT.TIHKVNNR.......---VRQIVAAKSSVLGAE..........---.......--................................................................................GVPE..DQIA.IFQATLKS.A.QD...EQAEILAYVE.........K....RLSELATFE..................D-AG.DE..VD.-----VESV.............................................AWIQWW..AK..GW..LRAFRRMFEVT--eg...........................................................................................
A0A0J7NBX7_LASNI/408-640               ..............................................................YKYSs..egASSLPGTAAAHELVVSI.RR.KCT.......PEEVLTVLNT.LPGPR.ENEE.TNN....YNP--.............LKIDVFVQTLL...NLGSKSFSHSF.A.AIV.K..FHYV..FKVL............AET......................................................EEAQIC...I....LRNMYALWK.NHY...Q...MMVVLTDK.FLKTGIIECSAIANWIFS................................KEM..ASE.F.T.K.L.Y.I.WEILHL.TIRKMNKH.......VTKLSTELAEAREKLRRAesr....sgsS--.......-Sedednn....................................................................keknreRPSE..DVVE.RMEEKLEA.A.QA...DQKNLFLIIF.........Q....---------..................----.--..--.---------.............................................------..--..--..-------------l............................................................................................
C1GXS9_PARBA/567-819                   ..............................................................FKYS.....FETTPYATEAQEIMQLI.RK.KAT.......DADLQPHIQA.IEQQA.AASG.A--....TDPLI.............PSTDAFVTSIC...YVGSKSLSHVL.S.CIE.R..SKER..LLSI...........gPQS......................................................PAARRQ...I....ITSVLEYWA.DQP...G...IGVNIIDK.LLNYAILTPLSVIEWALVd..............................hIDG..GAA.L.A.K.A.H.V.YEMVAA.TMGKVTNR.......---IRQIVAARVQL----..........---.......--................................................................................GLVE..PQLS.VIDETLRR.E.RG...DVGVMFDVIE.........G....ALVGVVGGAg...............agD---.GM..QG.NGA----MEg..........................................egGIISEW..GR..RW..LRVFRRMKAVEE-a............................................................................................
A0A088A145_APIME/488-764               ..............................................................YKYTs..egASSLPGTAAAHELVVSI.RR.KCT.......PEEVLNVLNT.LPGPR.ENEE.TN-....-NFNP.............LKIDVFVQTLL...NLGSKSFSHSF.A.AIG.K..FHYV..FQVL............AET......................................................EEAQIC...I....LRNMYALWK.NHY...Q...MMVVLTDK.FLKTGIIECSAIANWIFS................................KEM..VSE.F.T.K.L.Y.I.WEILHL.TIRKKNKH.......VTKLSTELAEAREKLRRAesr....sgsS--.......-Sedednn....................................................................kdrnreKPSE..DVVE.RMEEKLET.A.QA...DQKNLFLIIF.........Q....RFIMILSEH..................LGRC.DT..DG.IDYNT----.............................................HWYKWT..IG..RL..QQVFLTHHEQVQK.............................................................................................
M2XU86_GALSU/503-777                   ................ailneteeetavakelakhmigkerknaseieeflslrfpfessls----.....-----------------.--.---.......----------.-----.----.---....-----.............SAFCTLCRALL...IAGSKTFSHFD.V.VTE.R..YLGL..LRKLf..........aMDR......................................................ANMKRL...I....MSEMKNYWN.SSP...Q...HLEYVLEK.LWLYRIIDCSTVFDAAIPylsv........................eadnEKV..LSE.L.S.V.A.W.R.WKFVRK.LFDRVKEH.......VQLAKDELSMAAQAASQA..........-T-.......-Eg.............................................................................eiDAAN..LRLK.NAQTANDN.A.IK...EQKELFLHAL.........R....RSYAIIEAL..................EKNS.DN..SL.DETEGVS-Sshrf.....................................rnliSICKWR..VL..GS..MKETIRKH-----ldlle........................................................................................
V9FGR1_PHYPR/604-857                   ...................pdsaspasdfyqsvttklkghppasalrswlneelprleisra----.....-----------------.--.---.......----------.-----.----.---....-----.............EAVEVVWTCIL...EAGVATFTHMR.L.LLE.K..YGKR..NELFgge.....dqsaEET......................................................EADELV...V....VKTVASVWL.KSP...Q...HIGLILNS.MLRQGLLRPLTIVTWVFT................................ADA..VQQ.Y.S.W.P.Y.V.WEILND.TLKFVQDA.......IGAKTKQLEQASTPRSSD..........--D.......RD................................................................................NEEM..PDVA.ALEDSRKR.L.QD...ELRQLLVLLF.........R....GFDRVITEH..................KAEC.DS..EG.SDPRD----.............................................NWFRSA..LA..QM..QAVGHR-------yrvpl........................................................................................
T0KME7_COLGC/556-801                   ..............................................................FKFN.....DESTPFSAEGREIASLL.RR.KAP.......DEEFQPIIEK.IHSLA.IEHD.---....LDPLV.............TSTDVFVTAVC...WVGSKSLSHVL.A.CIE.R..TKDR..LLDV...........gAAS......................................................EAAKAQ...I....ITAVMSYWA.AQP...G...VAISIVEK.LLNYSILLPLSVIDWALVssn.........................hingQSS..GDS.L.A.Q.T.H.V.FELVFG.TVAKVTGR.......VRQLQTEA---DA-----..........---.......--................................................................................----..----.-DDEAKER.E.VK...AMRDLFKAME.........D....ALVSWASGS..................KDEM.ME..EM.DGA--GQRD.............................................SLLRRW..GE..RW..LRVFRRRAAIEE-a............................................................................................
A0A0K9PAN6_ZOSMR/452-784               ...........................................................fkf---Gtn.dcNEKSEGRVLSAELSSMV.KG.RKT.......AREVTFWVEK.---SI.ITIH.G--....---LN.............FALVVVIQTLL...NIGSKSFTHLT.T.LLE.R..YGQV..ISKL............CPD......................................................HEKQGL...L....IQEVSSYWK.NSN...Q...MTAITIDR.LMGYRLVSSLVIVDWVFS................................SAN..VDQ.F.HlK.D.L.A.WEVLRN.AVNKTTNL.......MSDMRKEILSLEKSIVAA..........KDS.......EEnckvdlenaesktldvngesp.....................................kgenpgrlkrlksylekakyhlTSLN..ESLE.AKVALLAR.A.VD...ENKALFLSLY.........R....NFSVVLSQRlsdeaei....mtvdseeP---.--..--.--------Vsmetdqdndkptege...............gnepktvkynisereQWS-RS..TL..GY..AKAFSRQYASE--il...........................................................................................
D3BF03_POLPA/465-692                   ............................................................he----.....-ESKDLVSQSHKLLLSF.KQ.KEP.......IENIIQQVAA.IPENI.----.---....-----.............NVVELVTKCIL...HIGSTSFSHLT.Y.AIE.R..YVTL..FKTT............IKS......................................................NEDRFE...C....LKSTLQFWQ.SSH...Q...HVVIVVDK.LITYKILAPIDPIAMLLSg..............................dPKN..GVV.V.T.D.A.Y.V.WEIIYN.SIEKTNII.......IDTLAKDYEVSMNSAE--..........---.......--................................................................................----..----.-KELKLKS.A.QT...EQQTLFTTMF.........K....SLDALLKNP..................----.--..--.---------.............................................------..--..--..-------------hidpvstkilsghlkstarrylnqlkplfetn.............................................................
H2PSU5_PONAB/485-760                   ..............................................................YKYGd..esSNSLPGHSVALCLAVAF.KS.KAT.......NDEIFSILKD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.T.R.L.F.V.WEILHS.TIRKMNKH.......VLKIQKELEEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGVLE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TSVLT----.............................................PWYKNC..IE..RL..QQIFLQHHQII--qq...........................................................................................
U6GML4_EIMAC/804-1033                  .............paeaaaaaaardesieednegegrqgavaalhaleqcstdtegapwspd----.....-----------------.--.---.......----------.-----.----.---....-----.............DIIKLFVFCLL...SLGSKTQTHLH.R.ALS.N..YAQA..FTFY............AAQseqtpeeqq...................................qqqqqqlvqqVDIHPA...V....LQAIQKYWT.TSQ...Q...RTALTLHA.FLKVGILKRGRVLQLLCSa..............................dPEE..RDS.W.S.Y.L.E.Y.IETVFRgAVDECETA.......REAAAESGAAM------Pr.......gtEAE.......-E...............................................................................vGEKE..EKDS.RVENLLTV.I.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------eqvqrhyfwrsf.................................................................................
A0A044V1Z9_ONCVO/492-766               ..........................................................flvn----.....QEEQSVKKLVAEVERAF.HN.KTE.......PKKLTELLRG.FNQKD.SGL-.---....-----.............TTLSIFFAVML...NAAQKSFSHNF.A.ALA.R..YHET..LKEL...........sDIN......................................................DESSMA...L....LRTLYNVWK.HNR...Q...MMVVLITK.MLRMTLVSANAAVFWLLSnvd..........................qelHRL..FLA.S.L.N.F.W.L.WEALFI.VIKYACGH.......ANRCKKKFQQMQEKRVRMdr......ndG--.......-Eayqnfcc.................................................................neeenslgVVLD..DDIE.EKRKELEE.L.QE...MLKNLFLNVL.........H....KLVVFLSEH..................LVKY.ET..AG.RNYDT----.............................................YWYRYM..MG..RF..KEILLRYWHE---lfe..........................................................................................
B9QCY2_TOXGO/839-1115                  ....krerrsfsesaedavdasskrglndesreeetkdsrdafeadsgpyeddeeghlwtlt----.....-----------------.--.---.......----------.-----.----.---....-----.............DLSQVLVFALL...ARGLKTLTHSE.R.LVE.N..YFPV..FQFLk.........kgA-Shkaflemrpatleaagddedard.......gddsdtemeeeadeegltkaerrsQEVEEA...F....LKAIFDFWK.HSR...Q...KTVLTVRH.FQRFDVVSKEGVVRFVFD................................SLT..PTD.R.D.D.S.R.V.MELFDL.LLQLSIQE.......FES---K----KET---Al.......qlS-Qd....csDDa.............................................................................erNARG..KAVS.AAVEALEA.V.Q-...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------tllhfivvgfmrellredqaa........................................................................
G5C1C6_HETGA/252-527                   ..............................................................YKYGd..esSNSLPGHSVALCLAVAF.KS.KAT.......NDEIFSILKD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.T.R.L.F.V.WEILHS.TIRKMNKH.......VLKIQKELEEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGALE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TSVLT----.............................................PWYKNC..IE..RL..QQIFLQHHQII--qq...........................................................................................
A0A063BR68_9HYPO/534-785               ......................................................ykygrsvp----.....-ADAPFSKEGQEIAALL.KR.KAT.......DEELQPAMDS.IAAQA.AAQG.---....LDPVV.............ASTDVFMTAVC...WVGSKSLSHVL.A.CID.R..TKGR..LVDV...........gTTN......................................................PTARSQ...I....ISSVMDYWS.AHP...G...IALSIVEK.LLNYSILTPLSIVDWTLTast.........................phngCRG..GEV.L.G.Q.S.H.M.YELVCN.TVAKVSGR.......---VRHLL----TSP---..........---.......--................................................................................----..---D.ADQETRDS.E.TA...SMRDLFRAVH.........E....ALAGWAAAGrq.............depMEDG.GG..DG.SPERE----.............................................ALLRRW..AQ..RW..LRVFQRLAAIEE-t............................................................................................
A0A0A1NA79_9FUNG/153-420               ..............................................................FKYE.....SAEDPLHAKSKEVIDSI.RT.KKS.......VEELRDLLSR.YKEEL.ASSG.VSS...eVEQQS.............VIRELFTQCLL...LVGSKSFSHVL.N.VVE.R..YLEV..LRFL............NAT......................................................PEGRLH...T....VQIVSSFWK.DNT...Q...FLGILVDK.LLNYRVIDPASVITWIFE................................SDQ..FKQ.V.G.R.A.Y.V.WEVLKN.TLSKVNSR.......VAQVKSKLDNLQSTHEVN..........KAKr....seSEttem.......................................................................teaeeQQEL..DSIR.IVENSLAT.V.TR...ERKEVFLLVC.........Q....KFTQMLKAI..................E---.--..QD.SNS-N----.............................................QWTIWW..AF..GW..YKEILRVNYKEC-k............................................................................................
A0A093YR42_9PEZI/534-785               ..............................................................FKYN.....DEDTPFAAEGREIHTLL.KR.KAP.......EPEIQTIIDQ.IHTQA.TTIA.--I....HEPLL.............SSTDAYVTSIC...YIGSKSLSHVL.S.CIE.R..CKER..LLSI...........gNTS......................................................ETARRQ...I....ITSVMAYWV.DQP...G...IGVNIVDK.LLNYTILTPLSVVEWALLd..............................dTKA..GDK.L.A.E.P.F.V.FEMVAG.TVQKVTNR.......---LRQIV----ASRNAP..........---.......--................................................................................GLEH..EQRL.LLDETLLR.E.RV...AMKDMFKVME.........D....ALFSWAAGS..................KDQA.ME..EG.TGET--PDE.............................................AFIRRW..GD..KW..LRVFRRKMAVEE-a............................................................................................
W4GQH0_9STRA/654-868                   ........................................................lrsqye----.....-----------QVFGKI.KA.REE.......AAAVQAWIDD.TSAAH.DGAP.---....----H.............VVLEMVVAAIL...DAGSATFTHFR.T.LLD.K..YVGV..LVAA...........iDAD......................................................VERQVV...V....IAAVSSVWE.QSP...Q...HVILILSI.LLRHHVLTPVAVVTWLFG................................ADA..VQQ.Y.S.W.P.Y.V.WEILDN.TVRYALET.......--------QAAKSTPNAV..........---.......--................................................................................----..----.-----DDA.W.AG...SVEDLFVAVF.........E....GLSRVIAAH..................KAQC.DK..DG.TTFKD----.............................................NWYAST..LA..RM..QSV----------grdfr........................................................................................
A5DTG5_LODEL/728-916                   ......................................................tretdete----.....-----------------.--.---.......---ATKETDE.TDKTK.QQQQ.QQQ....QQQQSqhleal.ipepvkFAINLIMQSYC...YIGSRSIYSEV.S.ILS.R..DADK..LKYL............SGQpiepkttapvslve.........................getefenldlteedvQNRQNW...I....IDSIFRIWV.HQP...Q...VVFLILEN.LIEFGVIKPEFLLAKAFK................................S--..NLI.I.D.N.V.S.C.MESVNR.ILENSKPA.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------vlkqgiav.....................................................................................
G7E5Q5_MIXOS/591-844                   ..............................................................FEYE.....QPDHPNHVFADIVVGDM.RN.RAP.......PHEILEKLSR.LQEVL.IAEQ.GQE....ELEAE............lRKCDLAVECLL...EIGSRSFSHTL.N.IVE.R..YLEL..LRQL............SHS......................................................PQTRMA...M....LRTIAKFWR.RHP...H...YIFIVMDK.FLQYRIVTPADIVAWVFEr..............................dGAP..DPT.W.H.H.I.V.V.WDILRA.TIEKVRAR.......VIAAEKRVKELKSISNSM..........---.......-Evd............................................................................gpHAAV..EELQ.QAEKNLKL.F.EE...NEAQVMRDCA.........T....RFAKATDNV..................T---.--..--.---LD----.............................................EWQSWW..LD..GW..YRQFARQFSKEI-t............................................................................................
A0A077ZBZ7_TRITR/409-664               ..........................................................kfsf----.....-EGTVPSELALELQEAI.KA.RKE.......PEKLLPILFP.EGESS.-ENG.GGP....VESTE.............YKAEVMISQLL...VLGQRTMSQTL.S.LLT.R..FAPV..LDQL...........vKNN......................................................ENAQLS...L....LNALRETWP.TFE...Q...RIGVVVDK.LFRLEIVPAPIIIKWVFS................................REM..KNE.F.L.K.Q.Y.V.WEIIFS.TFDKLCIN.......YRVLSDKLEAVTGENRSP..........---.......ER................................................................................SEDP..AEVL.ALQEGLDA.C.LG...SQKAFIFTLF.........Q....HFIITLSEH..................LLTV.DE..SG.DRVS-----.............................................DWYRIV..FG..RM..CQFFTT-------qcieiqr......................................................................................
T0QV77_9STRA/621-838                   .................................................feanmnatlqdvy----.....----------EDILSKI.KA.RDD.......AAVIEAWCTE.KKASL.DK--.---....----A.............IVLEMVVSALL...EAGSATFTHFR.S.LLE.K..YQEL..LATL............TAS......................................................TDDALA...A....INAVGAVWE.QSP...Q...HVILILSL.MMRHKVLTSTAISTWMFS................................ADA..VQQ.Y.S.W.H.Y.V.WEILDN.SIVYGIER.......-------V---EANPED-..........---.......--................................................................................----..----.------AA.A.LD...DLQAMLRAVL.........E....GFMKVIADH..................KFSC.DK..EG.TSFKD----.............................................NWYNST..LA..RM..KAVGRR-------frva.........................................................................................
H0VLR0_CAVPO/444-719                   ..............................................................YKYGd..esSNSLPGHSVALCLAVAF.KS.KAT.......NDEIFSILKD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.T.R.L.F.V.WEILHS.TIRKMNKH.......VLKIQKELEEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGALE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TSVLT----.............................................PWYKNC..IE..RL..QQIFLQHHQII--qq...........................................................................................
S8D3A0_9LAMI/496-821                   ..............................................erglsselsrmvkekl----.....-----------------.--.--A.......IR---EIISW.IEDQV.LPSH.G--....---LD.............VTLRVVVQTLL...NFGSKSFTHLI.T.VLE.R..YGQV..MAKI............CSD......................................................EDKQIM...L....ISEVRFFWK.NNA...Q...MTAICIDR.MMGYRLISNVSIVRWVFS................................ASN..VDE.F.H.V.SdR.P.WEILGN.AVSKTYNR.......IADLRKELPSLKKSIATAte.....aaaNA-.......-Eaeleeerskntltlvdgepvl......................................sentikmkrlksraektkeqeISTR..KSLE.AKEALLEK.A.AY...EIQELFILLF.........K....SFSDALAGPlqetsgl...srlsggedE---.--..--.--------Maidreevdldddddgqa...........qkshskrkdgyrvgekeQW-CLT..TL..GY..VKAFARQYASE--i............................................................................................
NCBP1_DROPE/488-770                    ..............................................................FKYAs..eeAASLPGTAVAHQLVVAI.RQ.KCS.......PEEVVNILKE.IPNSG.YSGE.EMS...dGTFNA.............LKIDVFVQTLL...NLGSKSFSHSF.A.AIS.K..FHSV..FRAL............AET......................................................EEAQIC...V....LHNIYELWS.SHQ...Q...MMVVLVDK.LLKLQIVDCSAVATWIFS................................KEM..TSE.F.T.K.M.Y.L.WEILHL.TIKKMNKH.......VIKLNTELSVAKDKLSKAds......ssS--.......-Esdedaptk...............................................................rkkpithadKPSE..EAVE.RMEEKLEA.A.NV...NQKRLFLIVF.........Q....RFIMILSEH..................MLRS.DT..DG.RDPDT----.............................................DWYRWT..IG..RL..QQVFLMHHEQVQK.............................................................................................
R1EHV8_EMIHU/521-759                   ............................................eiwgeqapadvldwlqre----.....-----------------.--.---.......----------.-----.----.---....-----.............-----VVHSLL...DAGAKSVSHLE.R.LLD.K..FNWL..VAAA............AQD......................................................GPARAR...V....VGAVAAYWR.APR...-...--------.----ELVDPQALVGWLCS................................APE..RRR.L.A.W.P.S.T.WEGLHL.LFERSLSH.......FKSVEGELKAEEDKYAEYvem....iggE--.......-Eegstsaagrthpsv...................................................aratcataalldacaRASR..QRLE.TKRAISER.A.RR...EKKELFANFF.........A....GVCGAFDEH..................AKAA.AA..AG.APVET----.............................................AWWSAA..IG..HA..VGLCRRHIAE---ys...........................................................................................
G2Q7P7_MYCTT/533-786                   ..............................................................FKFA.....SDDTPFAAEGREIAGLL.KR.KAD.......DEEIEAVIQR.IQSQA.IDRE.---....IDALV.............ASTDVFVTCVL...HVGSKSLSHVL.A.AIE.R..TKDR..LADA...........gAAS......................................................DAARSQ...I....ITATMAYWS.AHP...G...VALRIIEK.LLNYSILTPETVINWALVgr............................agSTR..GEA.L.S.V.A.Y.M.YEMVFN.TVVKVTGR.......---VRQLV----TKPSS-..........---.......--................................................................................PASA..EDAE.EEAATRDR.E.IK...AMRALFATIE.........D....ALSSWATGS..................KDEM.ME..AS.EGEGNGEGE.............................................RLVRRW..AE..RW..LRVFRRRAAIEE-a............................................................................................
B1N4Y9_ENTHI/2-83                      ..............................................spinytikniqqgvii----.....-----------------.--.---.......----------.-----.----.---....-----.............-----------...-----------.-.---.-..----..----............ESN......................................................EIPSSI...I....LNNLYNYWK.FNK...T...QCIFIIDY.LMKERILSC---FNYIFN................................DSK..SYS.F.H.Y.I.D.I.RDSLKT.--------.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------in...........................................................................................
V7CU42_PHAVU/487-827                   ...................................................fgaedgkesne----.....------HELSGKLNNMV.KG.KSP.......VREIISWIDE.SVFPN.NG--.---....---LE.............VTLRVIVQTLL...NIGSKSFTHLI.T.VLE.R..YGQV..FAKV............CPD......................................................EDRQVM...L....IAEVSSFWK.SNT...Q...MTAIAIDR.MMGYRLVSNLAIVRWVFS................................AEN..IEQ.F.H.T.SdR.P.WEILRN.AVSKTHNR.......ISDLRKEILTIRKNISSAee.....aakE--.......-Akaeldaaeskltlvdgepvl.......................................gdnpvrlnrlkshaektkeevVTLQ..ESLE.SKEALLVR.A.IE...ENEALFLLLY.........K....SFSNVLTERlpe...........gtrtL---.--..--.HELKSAQVDvmavdteeppsmelddenq.......rsqnsqsngekkggaytvgEKEQWC..ITtlGY..VKAFSRQYAA---ei...........................................................................................
B9RIH1_RICCO/444-789                   ..............................................................FKYSte.dgKERTEQHAVSAELINKV.KG.RQT.......AREIISWVEE.SVLPH.--HG.-W-....----E.............VTLTVVVQTFL...EIGSKSFTHLI.T.VLE.R..YGQV..IARI............CHD......................................................HDKQFM...L....IAEVSSYWK.NNG...Q...MTAIAIDR.MMGYRLLSNLAIVKWVFC................................PTN..IDQ.FhT.S.D.R.P.WEVLRN.AISKTYNR.......ICDLRKEISSLKNSVVSAee.....aaaK--.......-Akaeldaaeskltlvdgepvl.......................................genparmkrltsnaektkeeeVSAR..DSLE.AKEALLAR.A.LD...ENEALFTSLY.........K....NFSNVLIER..................L---.--..--.---------.............................................------..--..--..-------------pdaskiqtlrglksihgdemvvdldessemdvdnengrpkksqsngekssyvynigekeqwclstlgyvkafsrqyasei.............
R7YXK7_CONA1/626-880                   ..............................................................FKYS.....SDQTPYAPEGRELLTLI.RK.KAP.......EEQIQEVIDR.IHDQA.AEHG.--I....SDVLI.............PSTDAYVTAIC...FIGSKSLSHVL.S.CIE.R..CKER..LLDI...........gKAS......................................................DAARRQ...V....IASVVDYWK.DQP...G...IAVNIVDK.LLNYSIVSPMNVVQWALGd..............................hLGA..GEA.L.T.Q.S.W.V.YEMVAG.TVGKVTNR.......---MRQIADARLER----..........---.......--................................................................................GLSA..EQIE.LIDQHLLK.E.RE...SMRELFRFID.........D....AVTGIASGAad..............gfIERD.GE..KG.FGE---E-E............................................gKLIKAW..GG..RW..ARVFRRKAAVEE-s............................................................................................
I3M0Y3_ICTTR/485-760                   ..............................................................YKYGd..esSNSLPGHSVALCLAVAF.KS.KAT.......NDEIFSILKD.VPNPN.QDDD.DDE....G-FSFn...........pLKIEVFVQTLL...HLAAKSFSHSF.S.ALA.K..FHEV..FKTL............AES......................................................DEGKLH...V....LRVMFEVWR.NHP...Q...MIAVLVDK.MIRTQIVDCAAVANWIFS................................SEL..SRD.F.T.R.L.F.V.WEILHS.TIRKMNKH.......VVKIQKELEEAKEKLARQ.........hKRRs.....dDDdrss........................................................................drkdGALE..EQIE.RLQEKVES.A.QS...EQKNLFLVIF.........Q....RFIMILTEH..................LVRC.ET..DG.TSVLT----.............................................PWYKNC..IE..RL..QQIFLQHHQII--qq...........................................................................................
A8J5P0_CHLRE/707-851                   .......................................kaldwvhdhtreladthgplapa----.....-----------------.--.---.......----------.-----.----.---....-----.............---QVVSTLLL...AMGAKSPSHLH.V.AVE.R..YAEA..VRAV...........lAEAdgdaaalgalpp..............................gswrgaaaalgaSPGQVA...M....LEVLWRYHA.CEP...Q...RLLLVTDR.LLALHVLDGPALVAALFA................................DL-..---.-.-.-.-.-.-.------.--------.......------------------..........---.......--................................................................................----..----.--------.-.--...----------.........-....---------..................----.--..--.---------.............................................------..--..--..-------------eapagrrqaaaggr...............................................................................
G2QS19_THITE/535-793                   ..............................................................FKFA.....SDDTPFAAEGREILALL.KR.KAP.......DEEIEAVIQR.IQSLA.IDRE.---....IDALV.............ASTDVFVTCVL...HFGNKSLSHVL.A.AIE.R..TKDR..LADA...........gAAS......................................................DAARTQ...I....ISATMAYWS.AHP...G...VALSIIEK.LLNYSILTPATVINWALIgr............................agSTR..GEA.L.A.T.A.H.L.YEMVFN.TVMKVTGR.......---VRQLATKPPSPPHQQ..........---.......--................................................................................-AQS..SADA.EEAETRER.E.IR...AMRALFAAIE.........D....ALAAWAAGS.................kDEMM.EA..SE.GAAGDSETE.............................................RLVRRW..GE..RW..LRVFRRRAAIEE-a............................................................................................
NCBP1_DROMO/488-770                    ..............................................................YKYTn..eeAANLPGITVALQLVGAI.RQ.KCT.......PEEVVNILKE.IPNTG.YSGE.EMS...dGSFNA.............LKIDVFVQTLL...NLGSKSFSHSF.A.AIS.K..FHAV..FRAL............AET......................................................EEAQIC...I....LHNIFELWS.SHQ...Q...MMVVLIDK.LLKLQIVDCSAVATWIFS................................KEM..TGE.F.T.K.M.Y.L.WEILHL.TIKKMNKH.......VIKLNTELSEAKEKLSKAds......ssS--.......-Dtdedtphk...............................................................rkkpithadKPSE..EVVE.RMEEKLEA.A.NV...NQKRLFLIVF.........Q....RFIMILSEH..................LLRS.DT..DG.RDPDT----.............................................DWYRWT..IG..RL..QQVFLMHHEQVQK.............................................................................................
C4JPG9_UNCRE/529-782                   ..............................................................FKYA.....QETTPYSKEGQEILQLL.RK.KAP.......DEDIAPVIAS.IEEQA.KAHG.--L....ADPTI.............PSTDAFMTSIC...CVGSKSLSHFL.S.SIE.R..CKER..LLGI...........gPRS......................................................AAARRQ...I....ITSVMEYWV.DQP...G...NAVNIIDK.LLNYTILTPLSVIEWALVd..............................nLSA..GSI.L.A.K.P.H.I.YEMIAA.TMGKVTNR.......---IRQIVAART----QP..........---.......--................................................................................GLVE..PQLS.VIQDTLAR.E.RA...DVQAMFQLID.........D....SIVAVASGS..................NDVM.ME..RA.DDSALALEN.............................................ELIREW..GK..RW..LRVFRRKGAVEE-a............................................................................................
F4W7L2_ACREC/18-291                    ..............................................................YKYTp...kGNSLPGSDAAVKLIDSI.KN.KGT.......SEDVLAILNT.LPGEN.EETN.NYN....P----.............LKIDVFVQSLL...NLGSKSFSHSF.A.AIV.K..FHDI..FKML............AET......................................................EEAQIC...I....LRNMYALWK.NHY...Q...MMVVLTDK.FLKTGIIECSAIANWIFS................................KEM..ASE.F.T.K.L.Y.I.WEILHL.TIRKMNKH.......VTKLSTELIDAREKLRRAesr....sgsS--.......-Sdeednn....................................................................kernreRPSE..DEVE.RKEEKLEA.A.QA...DQKNLFLIIF.........Q....RFIMILSEH..................LVRC.DT..DG.IDYNT----.............................................HWYKWT..IG..RL..QQVFLSHQEQVQK.............................................................................................
I2H7H4_TETBL/583-827                   ............................................................ll--FR.....QDSFPLCENVRKILDYI.HK.AIN.......QKEVTELETL.LEELK.SDN-.-LI....VDYNK.............FIIILLIQSVV...HSGSRSLSHAN.K.YIN.D..IKDD..LQHI............FNKie.................................................ldqEYKEQI...I....VEAILRFWN.TNS...Q...TGFLVADA.FKHAGLISAKSIIKFTFTe..............................fNNK..NYS.L.S.D.D.T.A.MNAIFR.NLSQRVIG.......------------------..........---.......--................................................................................----..----.--------.-.EV...DSGSDFEYTF.........E....QLCIILNKT..................VVEL.GV..NL.DQEID-DPIiledtdle.............................ndlprfdlIWKYKT..AL..SF..IKSLLRKYSTEYK.............................................................................................
D8LFZ4_ECTSI/632-865                   .......................................................redvedl----.....-----------------.--.---.......----------.-----.----.---....-----.............-------QVLL...RGGQASPTHTF.V.YLD.R..YRSY..LRTL............RRDea..................................................lgEANQVA...M....LDGVAQLWE.HSP...Q...WFCLVCKY.LLDIGVLSPTTVVYYVFR...............................eDNN..NAI.A.L.S.P.F.L.WEVMSK.AISLYTDR.......VTLSLGELRDLEKSAKALde......aiD--.......-Erlknrspvpsteeg...................................................ddnappadpqdveekQRMS..NDIE.DQRDVVRE.A.VQ...QARALCTATV.........S....SFVQALANA..................LPQY.AA..NG.MTD------.............................................------..--..--..-------------fsadpwwvsmtsylkg.............................................................................
A0A0D9VTY5_9ORYZ/464-811               ...................................................fryhtdegkes----.....---PDGYRLSKELVGMV.RG.KKT.......VHDIISWIEE.QIIPA.---N.G--....---AK.............FALDVVSHTLL...DIGSKSFTHLI.T.VLE.R..YYQI..ISKL............CPN......................................................EEMQLL...L....MDEVSAYWK.NST...Q...MIAIAIDR.MMGYRLISNLAIVKWVFS................................PAS..VDQ.F.HvS.D.R.P.WEILRN.AVSKTYNR.......ICDLRKEIQTLRKGLPAAke.....aseK--.......-Askeleeaksiieivdgqsvp.......................................senpgrlrrlqvradktkeeeVNIE..ESLE.AKEALLAR.G.LE...ESKELLRLLF.........K....SFVDVLTERlppvsa......dgevpnL-RA.G-..--.--------Dpnadsvtrdpeattmeiddeng.adndshpngqnkkaghnvgeleQWCL-C..TL..GY..LKSFSRQYATE--wa...........................................................................................
A0A0L1J250_ASPNO/554-805               ...........................................................sss----.....-TATPYANEGTEIMQLI.RK.KAA.......DDDILPIISS.IEEQA.RAMG.V--....EDPML.............PSTDAFVTAIC...FVGSKSLSHVL.S.CIE.R..NKER..LLAI...........gPKS......................................................TRARRQ...I....ITSVMEYWK.DQP...G...IGINIIDK.LLNYTILTPLSVIEWALVd..............................kLEA..GTI.L.A.R.T.H.V.FEMISS.TVGKVTNR.......---LRQIV----AARTQP..........---.......--................................................................................GLYE..PQLS.VLDDTLNR.E.KA...DMQALFKVIE.........D....SIVSVAGGNnd..............glMERG.DG..SG.ELPED----.............................................EIIRQW..GC..RW..LRAFRRKAGVEE-s............................................................................................
R9P1P9_PSEHS/526-840                   ..............................................................FTYQ.....DESHPYFAQATRLINSI.KA.KAS.......AEVILADFES.FKSSI.LETS.SAL....PTDDVagmvrd.plqaevVVRDLTIQSIL...SVGSRSFSHFL.N.IVE.R..YHSL..LRQL............SKT......................................................SRMRVA...I....LSGSVKFWR.ANQ...Q...WIGIVVDK.LLQYRIVEPADVVEFIFSppkdep...................qtiassaAGE..EEG.W.V.G.F.N.R.WNLLKL.TLEKVNGR.......VDQLSKRLDESRRKEAEEle......rkE--.......-Aslaaglpeetpeqtddlpk..........................................pllfptsailptrpptdqtSSKD..ISST.EALASLEA.I.QS...EQRKVLITTL.........L....GFKSHILAP..................T---.--..--.--KG-----.............................................DWPKWW..IE..SW..YKQFVRCFNRQ--ll...........................................................................................
B3RS52_TRIAD/483-748                   ......................................................ckfersda----.....ESTDPAVNLAQQLFTAF.KA.KKS.......PEEVIEVLES.AKTSL.FADN.E--....DEYAK.............TAAEVLVQCVL...SIGQKSISHAT.S.GIT.K..FKTV..FKAI............IKG......................................................GDEQII...C....LNSMFSVWE.RNI...Q...ILELLLDK.MLRLEIIEPSSVINWLLS................................RDM..LGS.F.Q.R.F.F.V.WNIVHH.CLRKCSKR.......LRIAKRELQDVKEKFSACs.......nsE--.......-Dttd..........................................................................eerSKLS..NAVD.NLSDEVYN.A.YQ...KQKEVFLILF.........Q....RFIIILNDH..................LYRR.EQ..--.-DQSS----.............................................PWLSFA..LE..KL..KEVMHMYYEEVF-s............................................................................................
J3LNQ4_ORYBR/483-828                   ......................................................fryhsdeg----.....KESTDGHRLSKELVGMV.RG.KKT.......VRDIILWVEE.QIIPA.--NG.---....---AK.............FALDVVSQTLL...DIGSKSFTHLI.T.VLE.R..YNQI..ISKL............CPN......................................................EEMQLL...L....MDEVSAYWK.NST...Q...MIAITIDR.MMVYRLISNLAIVKWVFS................................PAN..VDQ.F.H.V.SdR.P.WEILRN.AVSKTYNR.......IYDLRKEIQTLRKGLQAAke......asE--.......-Kanreleeaksiieivdgqpvp......................................vekpgrlkrlqtradtmkeeeVTTE..ESLE.AKDALLVR.G.LE...ESKELLRLLF.........K....SFVDVLTERlppisa......dgevpnL---.--..--.-----RAGDpnvnsaasapeatmdidneng..adndsqlngqntkvghnvgeleQWCL-C..TL..GY..LKSFSRQYATE--i............................................................................................
#=GC SS_cons                           ..............................................................-TTSS..TS-TTSTTHHHHHHHHHHH.HT.T--.......HHHHHHHHTT.S----.----.---....------...........HHHHHHHHHHHH...HHTTTSHHHHH.H.HHH.H..THHH..HHHH............TSS......................................................HHHHHH...H....HHHHHHHHT.T-H...H...HHHHHHHH.HHHTTSS-HHHHHHHHTS................................GGG..TTT.T.T.S.H.H.H.HHHHHH.HHHHHHHH.......HHHHHHHHHHHHHC----.........-----.....-------........................................................................--HHHHHH..HHHH.HHHHHHHH.H.HH...HHHHHHHHHH.........H....HHHHHHHHH..................HHHH.HH..HT.--SS-----.............................................HHHHHH..HH..HH..HHHHHHTHHHH--GG...........................................................................................
#=GC seq_cons                          ................................................................at.....ttphPhtt.utplhthl.+p.+ss.......sc-l.shlpp.l.p.s.tpts..........................hph-lhlpsll...hlGSKShSHsh.s.slc.+..hpph..ltpl............sts......................................................ppsphp...l....lpslhphWp.sps...p...hhhlllDK.hlphpIlsshuVlpWhhs................................tpt..spt.h.s.p...a.h.aEllps.olpKssp+..........lpp.ltthppt.............................................................................................................p...php.thpptlpp.t.pp...p.csLFhhlh.........p....thh.hhstp..................h.ph..t..ts.tt....................................................thht.h..ht..ph...phFhppht....t............................................................................................
//
DBGET integrated database retrieval system