GenomeNet

Database: Pfam
Entry: MLANA
LinkDB: MLANA
Original site: MLANA 
#=GF ID   MLANA
#=GF AC   PF14991.1
#=GF DE   Protein melan-A
#=GF AU   Bateman A
#=GF SE   Jackhmmer:Q16655
#=GF GA   27.00 27.00;
#=GF TC   81.80 81.70;
#=GF NC   23.80 23.00;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   MLANA
#=GF RN   [1]
#=GF RM   8170938
#=GF RT   Cloning of the gene coding for a shared human melanoma antigen
#=GF RT   recognized by autologous T cells infiltrating into tumor.
#=GF RA   Kawakami Y, Eliyahu S, Delgado CH, Robbins PF, Rivoltini L,
#=GF RA   Topalian SL, Miki T, Rosenberg SA;
#=GF RL   Proc Natl Acad Sci U S A. 1994;91:3515-3519.
#=GF RN   [2]
#=GF RM   8006593
#=GF RT   A new gene coding for a differentiation antigen recognized by
#=GF RT   autologous cytolytic T lymphocytes on HLA-A2 melanomas.
#=GF RA   Coulie PG, Brichard V, Van Pel A, Wolfel T, Schneider J,
#=GF RA   Traversari C, Mattei S, De Plaen E, Lurquin C, Szikora JP,
#=GF RA   Renauld JC, Boon T;
#=GF RL   J Exp Med. 1994;180:35-42.
#=GF RN   [3]
#=GF RM   19717472
#=GF RT   The ocular albinism type 1 (OA1) G-protein-coupled receptor
#=GF RT   functions with MART-1 at early stages of melanogenesis to
#=GF RT   control melanosome identity and composition.
#=GF RA   Giordano F, Bonetti C, Surace EM, Marigo V, Raposo G;
#=GF RL   Hum Mol Genet. 2009;18:4530-4545.
#=GF SQ   35
#=GS F7G2A4_MACMU/2-118   AC F7G2A4.1
#=GS G1QEN9_MYOLU/1-95    AC G1QEN9.1
#=GS G5B6S2_HETGA/2-118   AC G5B6S2.1
#=GS F1SMM1_PIG/2-57      AC F1SMM1.1
#=GS MAR1_HUMAN/2-118     AC Q16655.1
#=GS MAR1_HUMAN/2-118     DR PDB; 2GTZ F; 3-9;
#=GS MAR1_HUMAN/2-118     DR PDB; 2GT9 F; 1-9;
#=GS MAR1_HUMAN/2-118     DR PDB; 3MRO P; 3-10;
#=GS MAR1_HUMAN/2-118     DR PDB; 2GUO C; 1-9;
#=GS MAR1_HUMAN/2-118     DR PDB; 2GT9 C; 1-9;
#=GS MAR1_HUMAN/2-118     DR PDB; 2GUO F; 1-9;
#=GS MAR1_HUMAN/2-118     DR PDB; 3MRQ P; 3-10;
#=GS MAR1_HUMAN/2-118     DR PDB; 2GTW C; 2-9;
#=GS MAR1_HUMAN/2-118     DR PDB; 3L6F C; 1-15;
#=GS MAR1_HUMAN/2-118     DR PDB; 2GTZ C; 3-9;
#=GS MAR1_HUMAN/2-118     DR PDB; 2GTW F; 2-9;
#=GS MAR1_HUMAN/2-118     DR PDB; 3MRP P; 3-10;
#=GS G3VV60_SARHA/2-98    AC G3VV60.1
#=GS E1BQ49_CHICK/2-120   AC E1BQ49.1
#=GS F6QDI3_MONDO/2-119   AC F6QDI3.1
#=GS G3RJG3_GORGO/2-118   AC G3RJG3.1
#=GS F6Y2L7_HORSE/2-118   AC F6Y2L7.1
#=GS G1RCY2_NOMLE/2-118   AC G1RCY2.1
#=GS G7PSE2_MACFA/2-118   AC G7PSE2.1
#=GS Q4SJH4_TETNG/10-120  AC Q4SJH4.1
#=GS F6QH78_CALJA/2-118   AC F6QH78.1
#=GS H0X3V0_OTOGA/2-118   AC H0X3V0.1
#=GS H3CUG6_TETNG/2-112   AC H3CUG6.1
#=GS H2QX01_PANTR/2-118   AC H2QX01.1
#=GS D2I649_AILME/1-71    AC D2I649.1
#=GS G1L271_AILME/1-95    AC G1L271.1
#=GS G3PX89_GASAC/2-113   AC G3PX89.1
#=GS F1MXK9_BOVIN/2-118   AC F1MXK9.2
#=GS H2LTQ3_ORYLA/10-120  AC H2LTQ3.1
#=GS G1KCI6_ANOCA/2-117   AC G1KCI6.1
#=GS G1TBP4_RABIT/2-118   AC G1TBP4.1
#=GS G1N196_MELGA/2-120   AC G1N196.1
#=GS Q2TA50_MOUSE/2-113   AC Q2TA50.1
#=GS G3UD84_LOXAF/2-57    AC G3UD84.1
#=GS H0VNR1_CAVPO/2-118   AC H0VNR1.1
#=GS Q9D1Y3_MOUSE/2-113   AC Q9D1Y3.1
#=GS H2PS70_PONAB/2-118   AC H2PS70.1
#=GS E1C403_CHICK/2-113   AC E1C403.1
#=GS H1A4V7_TAEGU/2-118   AC H1A4V7.1
#=GS Q6ICU4_HUMAN/2-118   AC Q6ICU4.1
#=GS Q864R3_CANFA/1-95    AC Q864R3.1
#=GS D3ZWI9_RAT/2-116     AC D3ZWI9.1
F7G2A4_MACMU/2-118              .PREDAHFIYGYPKKGHGHSYITAEEAAGIGILTVILGILLLIGCWYCRRRNGYRALMDKSLHVGTQC.AL.TRRCPQEGFDHQDSKLSLQEKNC-.EPVVPNAPPAYEKLSAEQSPPPYSP.
G1QEN9_MYOLU/1-95               .---------GYPRRGHGHSYITAKEIAGIGVLTVILGLVLFLGCWYCRRRNGYGILKGRSRYVGTQG.TF.TGRCLREGLGHQDSKLPFLENNY-.EPVVPNAPPAYE-------------.
G5B6S2_HETGA/2-118              .PQEEGHFSHGYPRKGHGHAYITTEEAAGIGILTVILGILLLIGCWYCRRQSGYRTLMDKNLHAGVQG.TL.CRRCSHEELGHQDTKLFFQEKNC-.EPLVPNAPPAYEKLSREQSPPPYSP.
F1SMM1_PIG/2-57                 .PREEAHFFYGSSKKGHGHSHITAEEAAGIGFLMVILGILLLISCWYCKRRSGYRSL-----------.--.------------------------.-------------------------.
MAR1_HUMAN/2-118                .PREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRRRNGYRALMDKSLHVGTQC.AL.TRRCPQEGFDHRDSKVSLQEKNC-.EPVVPNAPPAYEKLSAEQSPPPYSP.
#=GR MAR1_HUMAN/2-118     SS    .XXXXXXXXXXXXXXXXXXXXXXXXXX-SSS----XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.XX.XXXXXXXXXXXXXXXXXXXXXXX-.XXXXXXXXXBXXXXXXXXXXXXXXX.
G3VV60_SARHA/2-98               .PKENDHFIHAYLKK-KKIPHLMAEEAAGIGILAVILGVLLLLTCWYCKRRSGYKILKDKKLGAGTGN.AL.MGNYYQDKGILPVSKGPFQENNNY.NSMV---------------------c
E1BQ49_CHICK/2-120              .PRRS-HYEDGNFFRGKGRTYFTAEEALGIGIFILVLVLLLIFGCWFYKRRSGYKRLRNKTIFLLLEG.FTsKNRCNWSKSRKQTSQLSFQSFTPIfLPQVPNAPPAYDKIAAEQSPPPYSP.
F6QDI3_MONDO/2-119              t-KENAHFIDVYFKKKKSSSHITAEEAVGIGILAVILGILLLISCWYCRRRSGYKTLKDKNLCVGTQN.AL.MGNYYSDESVLPVNKMPFQENSNC.NSVVPDAPPAYEKLPAEQFPPPYTP.
G3RJG3_GORGO/2-118              .PREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRRRNGYRALMDKSLHVGTQC.AL.TRRCPQEGFDHRDSKVSLQEKNC-.EPVVPNAPPAYEKLSAEQSPPPYSP.
F6Y2L7_HORSE/2-118              .PREEAYFTYGYPKMGHGRSHITAEEAAGIGILIVILGILLLIGCWYCRRRSGYKSLKDKSIYVSTQS.TL.TGRCPREGLGHQDSKLPFQENSC-.DPVVPNAPPAYEKLSATQSPPPYSP.
G1RCY2_NOMLE/2-118              .PREDAHFIYDYPKKRHGHSYITAEEAAGIGILTVILGVLLLIGCWYCRRRNGYRALMDKSLHVGTQC.DL.TRRCPQEGFDHRDSKLSLQEKNC-.EPVVPNAPPAYEKLSAEQSPPPYSP.
G7PSE2_MACFA/2-118              .PREDAHFIYGYPKKGHGHSYITAEEAAGIGILTVILGILLLIGCWYCRRRNGYRALMDKSLHVGTQC.AL.TRRCPQEGFDHQDSKLSLQEKNC-.EPVVPNAPPAYEKLSAEQSPPPYSP.
Q4SJH4_TETNG/10-120             .PRGDFNI----YFASNRHGYVRAEEAVGIVLLLVILAAVFVLSCWYFKKRSGYKLI--SSIRSGSPG.Y-.TGGQYSEAGPAAESKMAMTDFGSF.RPAVPNAPPAYEKIASGPLPPPYSP.
F6QH78_CALJA/2-118              .PREDTPFVSDYPRKRHGHSYITAEEAAGIGILTVILGIILLIGCWYCRRRNGYRALMDKSLHAGTQN.TL.TRRCPQEGYGHQDSKLSFQEKNC-.EHVVPNAPPAYEKLSAEQSPPPYSP.
H0X3V0_OTOGA/2-118              .PREDAHFVYGNPKKGHHHSYITAEEAAGIGILTVILGILLLIGCWYCRRRSGYRTLTDKNHHVGSQS.TL.TRRCSREGLGHQDSKLPFQERNC-.DLVVPNAPSSYEKLSTEQSPPPYSP.
H3CUG6_TETNG/2-112              .PRGDFNI----YFASNRHGYVRAEEAVGIVLLLVILAAVFVLSCWYFKKRSGYKLI--SSIRSGSPG.Y-.TGGQYSEAGPAAESKMAMTDFGSF.RPAVPNAPPAYEKIASGPLPPPYSP.
H2QX01_PANTR/2-118              .PREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRRRNGYRALMDKSLHVGTQC.AL.TRRCPQEGFDHRDSKVSLQEKNC-.EPVVPNAPPAYEKLSAEQSPPPYSP.
D2I649_AILME/1-71               .-------------------------AAGIGILTVILGSLLLIGCWYCRRRSEYRSLRDKSIHAGTQS.TL.TGRCPCEGFGHQDSKLPFQENNC-.EPVV---------------------.
G1L271_AILME/1-95               .---------GHPKKGHNHSYITAEEAAGIGILTVILGSLLLIGCWYCRRRSEYRSLRDKSIHAGTQS.TL.TGRCPCEGFGHQDSKLPFQENNC-.EPVVPSAPPAYE-------------.
G3PX89_GASAC/2-113              .PRGDFNI----YFASSRRGYIRAEEAVGIVLLVVILASLLILGCWYFKKRSGYKIIRQ-SPRSGTPS.H-.TEGQYSEAGPSADNKMAATDFGSF.RPTVANAPPAYDKISSGPLPPPYSP.
F1MXK9_BOVIN/2-118              .PREEAHFFYGSPRKGHSHSYVTAEEAAGIGILIVILGILLLLSCWYCRRRSGYRSLKDKNIHAGTQS.TL.TGRCSHEGLGQQDSKLPFQENNC-.EPVIPNAPPAYEKLSAEQSPPPYSP.
H2LTQ3_ORYLA/10-120             .PRGDFNI----YFTSGRRGNVRAEEAVGIALLVVLLAGLLILGCWYFKKRSGYKII--RTPRSGSPG.Y-.TGGHYSEGGPSADNKMALTDFGSF.RPVVPNAPPAYEKISSAPLPPPYSP.
G1KCI6_ANOCA/2-117              .PKGD-HYLDGSFGRGKRFTSLSTEEAAGIGLLVVVLAALLLIGCWYYKKRRGYRNLLENMLTLKTSS.DY.TRKCSEEKLCHEVVKSELPFLAC-.SPYVPDAPPAYDKISTSPLPPPYAP.
G1TBP4_RABIT/2-118              .PRKEAHFIYGYPKKGHGHSYITVEEAAGIGILTVILGVLLLIGCWYCRRRSGYRTLTDKSLQAGIQS.TL.MGRGPQEQLGQQDSNLFFQEKNC-.ELLVPNAPPAYEKVSAEQSPPPYSP.
G1N196_MELGA/2-120              .PRGS-DHQGGNFFRGKGRIYFTAEQALGIGIFILVLAILIIFGCWFYKRRSGYKRLRSKTTFSLLKKfTS.KNRCDWSKPRKQKAQLSFQSFTLIfLPQVPDAPPAYDKIAAEQSPPPYSP.
Q2TA50_MOUSE/2-113              .PQEDIHF--GYPRKGHRRSYVTAEEAAGIGILIVVLGIALLIGCWYCRRRSGYRTLMDKRRHIGIQK.TS.RERCSCESPDHQDSRLSSQEKSH-.QPVVPNAPPAYEKLS---SPPPYSP.
G3UD84_LOXAF/2-57               .PREDVHLIHGYPRKGYHHASITAEEAVGVGILTVILGILLLLGCWYCRRRSGYQTL-----------.--.------------------------.-------------------------.
H0VNR1_CAVPO/2-118              .PREESHLDYGFPRKGRDHTYITIEAAAGIGILTVILGILLLLGCWYCRRRSGYRTLTDKSLHARAQS.IL.QGRCSHGQLGHQDTKLSSEEKNC-.EPLVPNAPPAYEKLSGEHSPPPYSP.
Q9D1Y3_MOUSE/2-113              .PQEDIHF--GYPRKGHRRSYVTAEEAAGNGILIVVLGIALLIGCWYCRRRSGYRTLMDKRRHIGIQK.TS.RERCSCESPDHQDSRLSSQEKSH-.QPVVPNAPPAYEKLS---SPPPYSP.
H2PS70_PONAB/2-118              .PTEDAHFIYGYPKKGHGHSYITAEEAAGIGILTVILGVLLLIGCWYCRRRNGYRALMDKSLHVGTQC.AL.TRRCPQEGFDHRDSKLSLQEKNC-.EPVVPNAPPAYEKLSAEQSPPPYSP.
E1C403_CHICK/2-113              .PRRS-HYEDGNFFRGKGRTYFTAEEALGIGIFILVLVLLLIFGCWFYKRRSGYKRLRSKGIGMDTIR.TV.V-----GEGARAACKTALQEYRNF.NSVVPNAPPAYDKIAAEQSPPPYSP.
H1A4V7_TAEGU/2-118              .PRGHNHL-DSNYVRGKGYVYFAAEEALGIGLFILVLAILLAFGCWYYKRRNGYKSLRVSVATHFLSC.VS.TIRNLVGEGEILDCKMPLQNYRDF.NSVVPDAPPAYTKIAADQSPPPYSP.
Q6ICU4_HUMAN/2-118              .PREDAHFIYGYPKKGHGHSYTTAEEAAGIGILTVILGVLLLIGCWYCRRRNGYRALMDKSLHVGTQC.AL.TRRCPQEGFDHRDSKVSLQEKNC-.EPVVPNAPPAYEKLSAEQSPPPYSP.
Q864R3_CANFA/1-95               .---------GYPKKGHNHSYITAEEAAGIGILTVILGILLLIACWYCRRRSGYRSLRDKSIHAGTQS.TL.RGRCPHEGFGHQHSKLPFQESNC-.ELVVPNAPPAYE-------------.
D3ZWI9_RAT/2-116                .PREEVHF--GYPRKGHSHSYITAEEAAGIGILVVALGIALLIGCWYCRRRSGYRALTDKRRHAGTQN.TS.RERCLCESLDHQDSRLSSQEKNH-.QPVVPNAPPAYEKLSSDHSPPPYSP.
#=GC SS_cons                    .XXXXXXXXXXXXXXXXXXXXXXXXXX-SSS----XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.XX.XXXXXXXXXXXXXXXXXXXXXXX-.XXXXXXXXXBXXXXXXXXXXXXXXX.
#=GC seq_cons                   .PRE-sHa..GaP+KGHuHSYlTAEEAAGIGILsVILGlLLLIGCWYCRRRSGYRsLhDKol+sGTQs.sl.TtRCspEuhsHpDSKlshQEpss..cPVVPNAPPAYEKlSuppSPPPYSP.
//
DBGET integrated database retrieval system