
Database: Pfam
Entry: MOZ_SAS
Original site: MOZ_SAS 
#=GF AC   PF01853.13
#=GF DE   MOZ/SAS family
#=GF AU   Bateman A
#=GF SE   Pfam-B_3994 (Release 4.3)
#=GF GA   23.30 23.30;
#=GF TC   23.30 23.30;
#=GF NC   23.20 23.20;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   8607265
#=GF RT   Identification of a cellular protein that specifically interacts
#=GF RT   with the essential cysteine region of the HIV-1 Tat
#=GF RT   transactivator. 
#=GF RA   Kamine J, Elangovan B, Subramanian T, Coleman D, Chinnadurai G; 
#=GF RL   Virology 1996;216:357-366.
#=GF RN   [2]
#=GF RM   8782818
#=GF RT   Yeast SAS silencing genes and human genes associated with AML
#=GF RT   and HIV-1 Tat interactions are homologous with
#=GF RT   acetyltransferases [see comments] [published erratum appears in
#=GF RT   Nat Genet 1997 May;16(1):109] 
#=GF RA   Reifsnyder C, Lowell J, Clarke A, Pillus L; 
#=GF RL   Nat Genet 1996;14:42-49.
#=GF DR   INTERPRO; IPR002717;
#=GF DR   SCOP; 1fy7; fa;
#=GF CC   This region of these proteins has been suggested to be
#=GF CC   homologous to acetyltransferases [1].
#=GF SQ   1290
#=GS A3BME4_ORYSJ/163-349    AC A3BME4.1
#=GS H2UGW1_TAKRU/559-745    AC H2UGW1.1
#=GS F1NGX4_CHICK/385-572    AC F1NGX4.1
#=GS Q0CQQ1_ASPTN/535-721    AC Q0CQQ1.1
#=GS Q4QFX1_LEIMA/276-465    AC Q4QFX1.1
#=GS E9AP51_LEIMU/253-317    AC E9AP51.1
#=GS I1G988_AMPQE/183-369    AC I1G988.1
#=GS G0RAB4_HYPJQ/274-463    AC G0RAB4.1
#=GS Q4DUW6_TRYCC/228-417    AC Q4DUW6.1
#=GS B7Z4D9_HUMAN/204-391    AC B7Z4D9.1
#=GS H3AQQ7_LATCH/390-577    AC H3AQQ7.1
#=GS A7F0Z3_SCLS1/339-519    AC A7F0Z3.1
#=GS Q6MFL9_NEUCS/649-842    AC Q6MFL9.1
#=GS D0IQI5_DROME/765-953    AC D0IQI5.1
#=GS Q4YB51_PLABA/265-448    AC Q4YB51.1
#=GS Q3UPM9_MOUSE/561-748    AC Q3UPM9.1
#=GS E3LAC6_PUCGT/376-540    AC E3LAC6.2
#=GS Q5U8N1_ENTHI/175-369    AC Q5U8N1.1
#=GS F0ZF82_DICPU/336-511    AC F0ZF82.1
#=GS I1CM66_RHIO9/246-432    AC I1CM66.1
#=GS B4PQS6_DROYA/120-308    AC B4PQS6.1
#=GS A7ASC0_BABBO/216-401    AC A7ASC0.1
#=GS B4DGY4_HUMAN/353-540    AC B4DGY4.1
#=GS G3AKJ0_SPAPN/109-299    AC G3AKJ0.1
#=GS E5SQH2_TRISP/129-332    AC E5SQH2.1
#=GS A9URG9_MONBE/60-246     AC A9URG9.1
#=GS Q8SR51_ENCCU/169-354    AC Q8SR51.1
#=GS G3S8U6_GORGO/562-749    AC G3S8U6.1
#=GS C5G6S7_AJEDR/287-473    AC C5G6S7.1
#=GS D8QKG5_SCHCM/221-371    AC D8QKG5.1
#=GS G7E6K3_MIXOS/321-493    AC G7E6K3.1
#=GS Q0IJ11_XENTR/278-470    AC Q0IJ11.1
#=GS E3WX16_ANODA/144-198    AC E3WX16.1
#=GS G1N326_MELGA/481-668    AC G1N326.2
#=GS D2HID3_AILME/773-960    AC D2HID3.1
#=GS E7R1V6_PICAD/239-429    AC E7R1V6.1
#=GS C5DQT6_ZYGRC/294-496    AC C5DQT6.1
#=GS ESA1_CRYNB/339-525      AC P0CP03.1
#=GS F1LRU3_RAT/393-580      AC F1LRU3.1
#=GS C9STR2_VERA1/278-467    AC C9STR2.1
#=GS H2MKG3_ORYLA/566-752    AC H2MKG3.1
#=GS A0PJC5_MOUSE/101-288    AC A0PJC5.1
#=GS A8IKV3_DROSI/565-753    AC A8IKV3.1
#=GS H3G293_PRIPA/842-1028   AC H3G293.1
#=GS A7TMV8_VANPO/369-569    AC A7TMV8.1
#=GS F8MUN5_NEUT8/447-648    AC F8MUN5.1
#=GS Q16G59_AEDAE/8-107      AC Q16G59.1
#=GS Q8SQM1_ENCCU/95-271     AC Q8SQM1.1
#=GS ESA1_CRYNJ/339-525      AC P0CP02.1
#=GS G6CZK5_DANPL/306-499    AC G6CZK5.1
#=GS C4XWF8_CLAL4/306-508    AC C4XWF8.1
#=GS C6LNH5_GIAIB/247-378    AC C6LNH5.1
#=GS E2RRZ5_CANFA/390-577    AC E2RRZ5.1
#=GS F9X7W5_MYCGM/526-616    AC F9X7W5.1
#=GS E9AP51_LEIMU/354-472    AC E9AP51.1
#=GS E3MB58_CAERE/122-311    AC E3MB58.1
#=GS H2V027_TAKRU/290-482    AC H2V027.1
#=GS G8YQB0_PICSO/124-327    AC G8YQB0.1
#=GS H2YRS6_CIOSA/280-473    AC H2YRS6.1
#=GS ESA1_NEUCR/278-467      AC Q7S9B6.1
#=GS D4A4Q5_RAT/301-488      AC D4A4Q5.1
#=GS Q5ZK16_CHICK/390-577    AC Q5ZK16.1
#=GS E1FVH2_LOALO/256-441    AC E1FVH2.1
#=GS B0DB55_LACBS/82-224     AC B0DB55.1
#=GS H0XAK1_OTOGA/285-477    AC H0XAK1.1
#=GS C0SVV9_ARATH/227-413    AC C0SVV9.1
#=GS Q28ZY6_DROPS/767-955    AC Q28ZY6.2
#=GS G0P680_CAEBE/393-586    AC G0P680.1
#=GS B4Q083_DROYA/313-506    AC B4Q083.1
#=GS B4GQF8_DROPE/169-361    AC B4GQF8.1
#=GS B1A1S4_DROME/1-83       AC B1A1S4.1
#=GS B2R8A7_HUMAN/285-477    AC B2R8A7.1
#=GS A7E4U0_SCLS1/591-780    AC A7E4U0.1
#=GS Q0CXQ0_ASPTN/74-225     AC Q0CXQ0.1
#=GS H3CD29_TETNG/574-761    AC H3CD29.1
#=GS A1CK57_ASPCL/76-293     AC A1CK57.1
#=GS F8MWF8_NEUT8/584-777    AC F8MWF8.1
#=GS B3MDW4_DROAN/762-950    AC B3MDW4.1
#=GS F1MP98_BOVIN/232-418    AC F1MP98.1
#=GS F1RRK3_PIG/233-258      AC F1RRK3.1
#=GS D2A012_TRICA/234-427    AC D2A012.1
#=GS E3K100_PUCGT/340-529    AC E3K100.2
#=GS E9APK8_LEIMU/276-465    AC E9APK8.1
#=GS A5PLL3_HUMAN/562-749    AC A5PLL3.1
#=GS I1QCE3_ORYGL/232-418    AC I1QCE3.1
#=GS F2PK11_TRIEC/270-452    AC F2PK11.1
#=GS B1H0Y6_XENTR/277-469    AC B1H0Y6.1
#=GS H3A8L0_LATCH/282-465    AC H3A8L0.1
#=GS E9NMQ9_DROIM/87-213     AC E9NMQ9.1
#=GS F2R0A6_PICP7/239-425    AC F2R0A6.1
#=GS A4HGT1_LEIBR/150-258    AC A4HGT1.1
#=GS F1NT94_CHICK/68-255     AC F1NT94.1
#=GS B4L1W3_DROMO/666-854    AC B4L1W3.1
#=GS H9JLW6_BOMMO/563-636    AC H9JLW6.1
#=GS B1A1N4_DROME/1-83       AC B1A1N4.1
#=GS C1GCV7_PARBD/77-228     AC C1GCV7.1
#=GS A1CWJ7_NEOFI/534-719    AC A1CWJ7.1
#=GS G7X848_ASPKW/536-722    AC G7X848.1
#=GS B8LW12_TALSN/525-711    AC B8LW12.1
#=GS B9Q3K5_TOXGO/849-1039   AC B9Q3K5.1
#=GS D4DHH2_TRIVH/312-499    AC D4DHH2.1
#=GS H2UIL3_TAKRU/331-518    AC H2UIL3.1
#=GS B0WEL5_CULQU/260-445    AC B0WEL5.1
#=GS C3YGL3_BRAFL/220-408    AC C3YGL3.1
#=GS H9JG69_BOMMO/247-440    AC H9JG69.1
#=GS A5DHG3_PICGU/121-318    AC A5DHG3.2
#=GS E1Z613_CHLVA/65-255     AC E1Z613.1
#=GS H3HBV1_PHYRM/202-389    AC H3HBV1.1
#=GS B3RUC0_TRIAD/447-635    AC B3RUC0.1
#=GS B4LPD8_DROVI/562-750    AC B4LPD8.1
#=GS E1FSW2_LOALO/394-582    AC E1FSW2.1
#=GS I1GBI6_AMPQE/209-402    AC I1GBI6.1
#=GS G1MT57_MELGA/392-579    AC G1MT57.1
#=GS E7R2K3_PICAD/234-421    AC E7R2K3.1
#=GS Q7S627_NEUCR/584-777    AC Q7S627.2
#=GS F2U7H2_SALS5/229-415    AC F2U7H2.1
#=GS Q7YYD7_CRYPV/301-496    AC Q7YYD7.1
#=GS A1DFX1_NEOFI/280-467    AC A1DFX1.1
#=GS G8YRS2_PICSO/124-327    AC G8YRS2.1
#=GS A5DEH1_PICGU/217-418    AC A5DEH1.2
#=GS G3W6G7_SARHA/467-654    AC G3W6G7.1
#=GS B9WD26_CANDC/254-414    AC B9WD26.1
#=GS B7Q8U7_IXOSC/389-556    AC B7Q8U7.1
#=GS F2PSP4_TRIEC/503-629    AC F2PSP4.1
#=GS C5K278_AJEDS/287-473    AC C5K278.1
#=GS F1RIR8_PIG/232-418      AC F1RIR8.1
#=GS ESA1_YEAST/220-406      AC Q08649.1
#=GS ESA1_YEAST/220-406      DR PDB; 3TO6 A; 220-406;
#=GS ESA1_YEAST/220-406      DR PDB; 1MJA A; 220-406;
#=GS ESA1_YEAST/220-406      DR PDB; 1MJ9 A; 220-406;
#=GS ESA1_YEAST/220-406      DR PDB; 3TO7 A; 220-406;
#=GS ESA1_YEAST/220-406      DR PDB; 3TO9 A; 220-406;
#=GS ESA1_YEAST/220-406      DR PDB; 1MJB A; 220-406;
#=GS ESA1_YEAST/220-406      DR PDB; 1FY7 A; 220-406;
#=GS F6M9E3_9MUSC/84-212     AC F6M9E3.1
#=GS D4D811_TRIVH/74-240     AC D4D811.1
#=GS E9PXP9_MOUSE/285-405    AC E9PXP9.1
#=GS G3QWY7_GORGO/390-577    AC G3QWY7.1
#=GS F6UKV1_XENTR/332-519    AC F6UKV1.1
#=GS B9QI24_TOXGO/246-429    AC B9QI24.1
#=GS G3QAR2_GASAC/300-492    AC G3QAR2.1
#=GS G0RWG0_HYPJQ/590-783    AC G0RWG0.1
#=GS C4JWA5_UNCRE/75-235     AC C4JWA5.1
#=GS B2RWN8_HUMAN/773-960    AC B2RWN8.1
#=GS Q4E3G3_TRYCC/62-254     AC Q4E3G3.1
#=GS E0S903_ENCIT/95-272     AC E0S903.1
#=GS I0Z823_9CHLO/166-355    AC I0Z823.1
#=GS C0NJW4_AJECG/548-734    AC C0NJW4.1
#=GS A6ZMI7_YEAS7/126-314    AC A6ZMI7.1
#=GS E0VU52_PEDHC/717-907    AC E0VU52.1
#=GS E7Q9D0_YEASB/202-388    AC E7Q9D0.1
#=GS E9NMR0_9MUSC/87-214     AC E9NMR0.1
#=GS F6SP03_MONDO/183-369    AC F6SP03.1
#=GS MOF_DROME/596-784       AC O02193.1
#=GS G3RNG8_GORGO/232-418    AC G3RNG8.1
#=GS E6RA41_CRYGW/402-562    AC E6RA41.1
#=GS F7HVC0_CALJA/773-959    AC F7HVC0.1
#=GS Q4QGD7_LEIMA/354-472    AC Q4QGD7.1
#=GS F2UQ57_SALS5/306-394    AC F2UQ57.1
#=GS B4JPK1_DROGR/146-339    AC B4JPK1.1
#=GS E7KUJ5_YEASL/220-406    AC E7KUJ5.1
#=GS H3JNF8_STRPU/1-114      AC H3JNF8.1
#=GS Q4P9B1_USTMA/692-878    AC Q4P9B1.1
#=GS E9AUD7_LEIMU/59-253     AC E9AUD7.1
#=GS Q5ACY2_CANAL/131-323    AC Q5ACY2.1
#=GS Q4UHT8_THEAN/219-414    AC Q4UHT8.1
#=GS ESA1_KLULA/214-400      AC Q6CKE9.1
#=GS H2MQA9_ORYLA/397-584    AC H2MQA9.1
#=GS A8NSI3_BRUMA/463-654    AC A8NSI3.1
#=GS B0Y6S5_ASPFC/546-731    AC B0Y6S5.1
#=GS H2LTD2_ORYLA/314-506    AC H2LTD2.1
#=GS H9LIX7_CRAAR/1-182      AC H9LIX7.1
#=GS G2QEZ5_THIHA/573-766    AC G2QEZ5.1
#=GS G2HE23_PANTR/74-266     AC G2HE23.1
#=GS A7TH51_VANPO/221-407    AC A7TH51.1
#=GS H2XN29_CIOIN/214-274    AC H2XN29.1
#=GS G1T6D0_RABIT/318-510    AC G1T6D0.1
#=GS E9NMR1_9MUSC/87-215     AC E9NMR1.1
#=GS Q5XTS8_GIAIN/257-384    AC Q5XTS8.1
#=GS G9MNK9_HYPVG/278-476    AC G9MNK9.1
#=GS F7FU99_MACMU/233-389    AC F7FU99.1
#=GS G5C7I6_HETGA/774-889    AC G5C7I6.1
#=GS E2A1C2_CAMFO/1003-1188  AC E2A1C2.1
#=GS B8N378_ASPFN/125-311    AC B8N378.1
#=GS H8X5R3_9ASCO/247-409    AC H8X5R3.1
#=GS A2EPN6_TRIVA/166-352    AC A2EPN6.1
#=GS Q4WXI3_ASPFU/75-287     AC Q4WXI3.1
#=GS B9H794_POPTR/230-416    AC B9H794.1
#=GS Q5B1E0_EMENI/539-724    AC Q5B1E0.1
#=GS C9SGJ0_VERA1/408-618    AC C9SGJ0.1
#=GS B4KLV6_DROMO/730-918    AC B4KLV6.1
#=GS H1V8F2_COLHI/378-581    AC H1V8F2.1
#=GS A4H724_LEIBR/353-475    AC A4H724.1
#=GS C0SAR5_PARBP/256-443    AC C0SAR5.1
#=GS H2LGN0_ORYLA/354-541    AC H2LGN0.1
#=GS H2YRS8_CIOSA/202-395    AC H2YRS8.1
#=GS C5DCQ5_LACTC/271-473    AC C5DCQ5.1
#=GS A1CEC6_ASPCL/278-465    AC A1CEC6.1
#=GS A2E091_TRIVA/141-328    AC A2E091.1
#=GS E7Q7U2_YEASB/126-314    AC E7Q7U2.1
#=GS F4RA27_MELLP/232-421    AC F4RA27.1
#=GS G8YKY2_PICSO/264-467    AC G8YKY2.1
#=GS C0PK30_MAIZE/221-407    AC C0PK30.1
#=GS C8ZEY2_YEAS8/126-314    AC C8ZEY2.1
#=GS Q1RPX1_CIOIN/287-475    AC Q1RPX1.1
#=GS D6X346_TRICA/664-787    AC D6X346.1
#=GS G0S3X6_CHATD/275-464    AC G0S3X6.1
#=GS KAT7_RAT/391-578        AC Q810T5.1
#=GS H2NVL2_PONAB/390-577    AC H2NVL2.1
#=GS B4R499_DROSI/313-506    AC B4R499.1
#=GS I1JI23_SOYBN/180-301    AC I1JI23.1
#=GS H8WW58_9ASCO/217-414    AC H8WW58.1
#=GS A2G4N9_TRIVA/144-328    AC A2G4N9.1
#=GS E2QT63_CANFA/232-418    AC E2QT63.1
#=GS A7F8C8_SCLS1/276-465    AC A7F8C8.1
#=GS Q3UJQ1_MOUSE/285-477    AC Q3UJQ1.1
#=GS D6RM30_COPC7/1119-1302  AC D6RM30.1
#=GS F9FD34_FUSOF/270-459    AC F9FD34.1
#=GS E7LP90_TRYCR/216-433    AC E7LP90.1
#=GS E9JCW7_SOLIN/657-735    AC E9JCW7.1
#=GS Q4XXB4_PLACH/266-449    AC Q4XXB4.1
#=GS C5FUI4_ARTOC/533-719    AC C5FUI4.1
#=GS A5DV21_LODEL/165-374    AC A5DV21.1
#=GS E7QJB6_YEASZ/126-314    AC E7QJB6.1
#=GS B0WGS2_CULQU/602-682    AC B0WGS2.1
#=GS E3WWJ0_ANODA/489-678    AC E3WWJ0.1
#=GS Q4S3F3_TETNG/59-246     AC Q4S3F3.1
#=GS G3NR96_GASAC/401-588    AC G3NR96.1
#=GS H9K8H4_APIME/682-776    AC H9K8H4.1
#=GS G4ZD94_PHYSP/308-405    AC G4ZD94.1
#=GS H0GL43_9SACH/126-314    AC H0GL43.1
#=GS F6S9I7_MONDO/1-170      AC F6S9I7.1
#=GS I1BNV5_RHIO9/229-415    AC I1BNV5.1
#=GS E2ACJ8_CAMFO/1-83       AC E2ACJ8.1
#=GS F7HQQ5_CALJA/773-960    AC F7HQQ5.1
#=GS F6UXD9_HORSE/285-477    AC F6UXD9.1
#=GS G4TC41_PIRID/450-634    AC G4TC41.1
#=GS H0ELF3_GLAL7/561-750    AC H0ELF3.1
#=GS ESA1_DEBHA/250-419      AC Q6BU95.2
#=GS F6W581_MONDO/590-777    AC F6W581.1
#=GS G8YNB4_PICSO/264-468    AC G8YNB4.1
#=GS G2QKQ9_THIHA/271-460    AC G2QKQ9.1
#=GS H0WHS0_OTOGA/388-575    AC H0WHS0.1
#=GS G8JNR5_ERECY/210-396    AC G8JNR5.1
#=GS B1A1N2_DROME/1-83       AC B1A1N2.1
#=GS A9RJM4_PHYPA/185-371    AC A9RJM4.1
#=GS G5BYC4_HETGA/168-354    AC G5BYC4.1
#=GS Q4SBB6_TETNG/364-549    AC Q4SBB6.1
#=GS G0SAK1_CHATD/592-785    AC G0SAK1.1
#=GS H9GJ04_ANOCA/562-749    AC H9GJ04.1
#=GS F9XIV7_MYCGM/285-478    AC F9XIV7.1
#=GS A8NQL2_BRUMA/261-446    AC A8NQL2.1
#=GS C4XWL1_CLAL4/92-291     AC C4XWL1.1
#=GS D2HQM4_AILME/200-386    AC D2HQM4.1
#=GS Q383C5_TRYB2/257-365    AC Q383C5.1
#=GS F2SE58_TRIRC/74-240     AC F2SE58.1
#=GS F2QR92_PICP7/243-441    AC F2QR92.1
#=GS G9NAG4_HYPVG/274-463    AC G9NAG4.1
#=GS Q9U3C3_CAEEL/241-443    AC Q9U3C3.1
#=GS G6CN11_DANPL/553-740    AC G6CN11.1
#=GS B4KHA7_DROMO/222-416    AC B4KHA7.1
#=GS B9WKY3_CANDC/282-488    AC B9WKY3.1
#=GS Q6GPW8_XENLA/396-583    AC Q6GPW8.1
#=GS E1F974_GIAIA/251-379    AC E1F974.1
#=GS KAT7_MOUSE/392-579      AC Q5SVQ0.1
#=GS C4R6T5_PICPG/239-425    AC C4R6T5.1
#=GS G6DER4_DANPL/215-401    AC G6DER4.1
#=GS E2A1K0_CAMFO/226-412    AC E2A1K0.1
#=GS E2R922_CANFA/561-748    AC E2R922.1
#=GS D7RTH9_LEIDO/276-465    AC D7RTH9.1
#=GS D4B5X6_ARTBC/294-481    AC D4B5X6.1
#=GS H2UZF9_TAKRU/348-535    AC H2UZF9.1
#=GS H2UGV9_TAKRU/573-759    AC H2UGV9.1
#=GS E2B5G0_HARSA/1-83       AC E2B5G0.1
#=GS E9EPL9_METAR/581-774    AC E9EPL9.1
#=GS G4VKY3_SCHMA/838-967    AC G4VKY3.1
#=GS E9NMR3_9MUSC/87-215     AC E9NMR3.1
#=GS Q9DF19_CHICK/235-282    AC Q9DF19.1
#=GS B4LS29_DROVI/599-790    AC B4LS29.1
#=GS E3MHB0_CAERE/738-833    AC E3MHB0.1
#=GS Q29NY2_DROPS/605-796    AC Q29NY2.2
#=GS KAT7_HUMAN/390-577      AC O95251.1
#=GS C4JS19_UNCRE/543-623    AC C4JS19.1
#=GS A4HQM2_LEIBR/73-267     AC A4HQM2.1
#=GS I1GS50_BRADI/217-403    AC I1GS50.1
#=GS B1A1U4_DROME/4-35       AC B1A1U4.1
#=GS E9NMR5_9MUSC/87-215     AC E9NMR5.1
#=GS A4ICE0_LEIIN/59-253     AC A4ICE0.1
#=GS G0PAD0_CAEBE/659-853    AC G0PAD0.1
#=GS B1A1Q0_DROME/1-83       AC B1A1Q0.1
#=GS Q2QEH8_TOXGO/285-475    AC Q2QEH8.2
#=GS E2RE53_CANFA/233-425    AC E2RE53.1
#=GS E9E0M7_METAQ/579-772    AC E9E0M7.1
#=GS MST2_SCHPO/156-342      AC Q10325.1
#=GS I1CVJ9_RHIO9/231-320    AC I1CVJ9.1
#=GS I1C292_RHIO9/222-405    AC I1C292.1
#=GS G1PHE9_MYOLU/390-577    AC G1PHE9.1
#=GS E5RYE8_TRISP/104-266    AC E5RYE8.1
#=GS ESA1_YARLI/243-430      AC Q6C710.1
#=GS H2UGW3_TAKRU/600-786    AC H2UGW3.1
#=GS H3DH88_TETNG/564-750    AC H3DH88.1
#=GS G4MSW6_MAGO7/600-793    AC G4MSW6.1
#=GS B7FPT7_PHATC/73-269     AC B7FPT7.1
#=GS G7PPH5_MACFA/318-510    AC G7PPH5.1
#=GS E9C2U4_CAPO3/290-476    AC E9C2U4.1
#=GS F8PYZ2_SERL3/366-549    AC F8PYZ2.1
#=GS G2WSR7_VERDV/407-618    AC G2WSR7.1
#=GS B9GUG6_POPTR/227-413    AC B9GUG6.1
#=GS H2UIL0_TAKRU/392-579    AC H2UIL0.1
#=GS F0XSR0_GROCL/276-465    AC F0XSR0.1
#=GS E4ZQ49_LEPMJ/273-460    AC E4ZQ49.1
#=GS G1SDY4_RABIT/561-743    AC G1SDY4.1
#=GS Q7YTZ9_DROME/290-481    AC Q7YTZ9.1
#=GS C1MNM5_MICPC/217-408    AC C1MNM5.1
#=GS G0RIY0_HYPJQ/158-364    AC G0RIY0.1
#=GS G6CY59_DANPL/701-887    AC G6CY59.1
#=GS KAT6A_HUMAN/562-749     AC Q92794.2
#=GS KAT6A_HUMAN/562-749     DR PDB; 2OZU A; 562-749;
#=GS KAT6A_HUMAN/562-749     DR PDB; 2RC4 A; 562-749;
#=GS Q6FY84_CANGA/252-458    AC Q6FY84.1
#=GS G2RE94_THITE/271-460    AC G2RE94.1
#=GS Q4RDR2_TETNG/1-35       AC Q4RDR2.1
#=GS Q4CKI2_TRYCC/130-347    AC Q4CKI2.1
#=GS F7FB22_CALJA/562-749    AC F7FB22.1
#=GS H2UIK8_TAKRU/395-582    AC H2UIK8.1
#=GS E3K9A4_PUCGT/745-954    AC E3K9A4.2
#=GS H2UAR8_TAKRU/780-967    AC H2UAR8.1
#=GS E0W2D9_PEDHC/554-639    AC E0W2D9.1
#=GS Q4PFB3_USTMA/325-482    AC Q4PFB3.1
#=GS E9DD01_COCPS/240-427    AC E9DD01.1
#=GS H2L6F4_ORYLA/262-448    AC H2L6F4.1
#=GS G7PBR3_MACFA/848-1022   AC G7PBR3.1
#=GS G7IVB8_MEDTR/295-432    AC G7IVB8.1
#=GS C1GDR4_PARBD/287-474    AC C1GDR4.1
#=GS C9ZT70_TRYB9/223-412    AC C9ZT70.1
#=GS G2W8V6_YEASK/325-535    AC G2W8V6.1
#=GS F1KRC9_ASCSU/112-220    AC F1KRC9.1
#=GS A5JPL6_BOMMO/215-401    AC A5JPL6.1
#=GS E9NMR8_9MUSC/87-215     AC E9NMR8.1
#=GS F6YK25_CALJA/386-573    AC F6YK25.1
#=GS B3NSY4_DROER/593-781    AC B3NSY4.1
#=GS E9EXD0_METAR/397-603    AC E9EXD0.1
#=GS G5EGU3_CAEEL/273-465    AC G5EGU3.1
#=GS A9YI75_DROME/147-235    AC A9YI75.1
#=GS G5BMJ0_HETGA/561-748    AC G5BMJ0.1
#=GS B1A1M6_DROME/1-83       AC B1A1M6.1
#=GS G0V249_TRYCI/469-559    AC G0V249.1
#=GS G7XDS3_ASPKW/76-247     AC G7XDS3.1
#=GS F8PAZ6_SERL9/82-227     AC F8PAZ6.1
#=GS D6X346_TRICA/562-641    AC D6X346.1
#=GS C5DI27_LACTC/103-291    AC C5DI27.1
#=GS Q0Z9W0_WHEAT/217-403    AC Q0Z9W0.1
#=GS G8BW31_TETPH/146-334    AC G8BW31.1
#=GS G0NX68_CAEBE/225-416    AC G0NX68.1
#=GS A8B8C8_DROSI/596-784    AC A8B8C8.1
#=GS G2XJ11_VERDV/290-479    AC G2XJ11.1
#=GS B4MZV4_DROWI/568-759    AC B4MZV4.1
#=GS H9GEE3_ANOCA/31-218     AC H9GEE3.1
#=GS Q29I48_DROPS/329-522    AC Q29I48.2
#=GS F7DYY3_XENTR/277-469    AC F7DYY3.1
#=GS F4X1D6_ACREC/224-417    AC F4X1D6.1
#=GS A2ENW6_TRIVA/165-352    AC A2ENW6.1
#=GS D7MRV8_ARALL/227-413    AC D7MRV8.1
#=GS E6QZL1_CRYGW/340-526    AC E6QZL1.1
#=GS F6S4B9_MOUSE/1-148      AC F6S4B9.1
#=GS G5B6J4_HETGA/321-513    AC G5B6J4.1
#=GS C1MNF7_MICPC/279-475    AC C1MNF7.1
#=GS Q753V4_ASHGO/103-290    AC Q753V4.1
#=GS B4JRS4_DROGR/537-725    AC B4JRS4.1
#=GS ESA1_ASPFU/253-440      AC Q4WHG1.1
#=GS C7YLN1_NECH7/572-765    AC C7YLN1.1
#=GS A9V986_MONBE/88-274     AC A9V986.1
#=GS E7LYQ6_YEASV/106-294    AC E7LYQ6.1
#=GS Q7QK98_ANOGA/351-537    AC Q7QK98.5
#=GS H2Q441_PANTR/318-510    AC H2Q441.1
#=GS B3MKA7_DROAN/585-776    AC B3MKA7.1
#=GS A3LNI3_PICST/255-415    AC A3LNI3.2
#=GS A6ZKP6_YEAS7/325-534    AC A6ZKP6.1
#=GS F8NXK3_SERL9/481-664    AC F8NXK3.1
#=GS G1P372_MYOLU/232-418    AC G1P372.1
#=GS D8TQT1_VOLCA/207-410    AC D8TQT1.1
#=GS H6C6F8_EXODN/306-454    AC H6C6F8.1
#=GS F1SE29_PIG/325-512      AC F1SE29.1
#=GS A6QUB9_AJECN/286-473    AC A6QUB9.1
#=GS G0WAL7_NAUDC/400-610    AC G0WAL7.1
#=GS B4KKB4_DROMO/594-785    AC B4KKB4.1
#=GS B5RSS4_DEBHA/262-468    AC B5RSS4.1
#=GS B1A1V5_DROME/4-35       AC B1A1V5.1
#=GS G7MZ71_MACMU/708-882    AC G7MZ71.1
#=GS F7FSM6_MACMU/576-758    AC F7FSM6.1
#=GS G3SCG8_GORGO/396-583    AC G3SCG8.1
#=GS Q4Q837_LEIMA/181-289    AC Q4Q837.1
#=GS F9G643_FUSOF/599-792    AC F9G643.1
#=GS D7SFM3_CAEEL/266-458    AC D7SFM3.2
#=GS H2NQS1_PONAB/232-418    AC H2NQS1.1
#=GS G3QAR1_GASAC/312-504    AC G3QAR1.1
#=GS A3KN50_BOVIN/232-418    AC A3KN50.1
#=GS Q3TD41_MOUSE/360-547    AC Q3TD41.1
#=GS C5PI16_COCP7/289-476    AC C5PI16.1
#=GS F2QWP3_PICP7/103-292    AC F2QWP3.1
#=GS D8LW66_BLAHO/76-266     AC D8LW66.1
#=GS B6QRD0_PENMQ/75-249     AC B6QRD0.1
#=GS G4UYC1_NEUT9/335-536    AC G4UYC1.1
#=GS G3PQ17_GASAC/269-455    AC G3PQ17.1
#=GS F2ULI6_SALS5/199-360    AC F2ULI6.1
#=GS G3AIQ7_SPAPN/237-459    AC G3AIQ7.1
#=GS E9NMR2_9MUSC/87-215     AC E9NMR2.1
#=GS G0WB13_NAUDC/222-408    AC G0WB13.1
#=GS G2YIQ8_BOTF4/614-802    AC G2YIQ8.1
#=GS Q6PCK3_XENLA/314-501    AC Q6PCK3.1
#=GS A8IKW7_DROSI/565-753    AC A8IKW7.1
#=GS C5JDQ3_AJEDS/79-230     AC C5JDQ3.1
#=GS E2B5F9_HARSA/654-737    AC E2B5F9.1
#=GS F7FUA3_MACMU/318-474    AC F7FUA3.1
#=GS H9GBU7_ANOCA/241-427    AC H9GBU7.1
#=GS Q383C5_TRYB2/391-480    AC Q383C5.1
#=GS C4V792_NOSCE/161-346    AC C4V792.1
#=GS B4NPA9_DROWI/285-478    AC B4NPA9.1
#=GS E9B048_LEIMU/356-464    AC E9B048.1
#=GS E3LPK7_CAERE/226-417    AC E3LPK7.1
#=GS G3UBV2_LOXAF/590-777    AC G3UBV2.1
#=GS F0XBY5_GROCL/581-773    AC F0XBY5.1
#=GS C4YPI3_CANAW/254-416    AC C4YPI3.1
#=GS B5DEC5_XENTR/243-430    AC B5DEC5.1
#=GS C4JEB2_UNCRE/283-470    AC C4JEB2.1
#=GS Q6V9I3_SOLCH/224-410    AC Q6V9I3.1
#=GS E1BS85_CHICK/481-668    AC E1BS85.1
#=GS I1CVJ9_RHIO9/111-225    AC I1CVJ9.1
#=GS KAT5_PONAB/233-425      AC Q5RBG4.1
#=GS F7GZJ8_CALJA/285-477    AC F7GZJ8.1
#=GS B0W2A3_CULQU/229-422    AC B0W2A3.1
#=GS C7Z8F5_NECH7/271-460    AC C7Z8F5.1
#=GS Q3V1G6_MOUSE/561-748    AC Q3V1G6.1
#=GS I1RPR8_GIBZE/352-550    AC I1RPR8.1
#=GS C1C0U2_9MAXI/201-258    AC C1C0U2.1
#=GS G1TM69_RABIT/366-553    AC G1TM69.1
#=GS Q7SXF3_DANRE/261-447    AC Q7SXF3.1
#=GS H3APV3_LATCH/290-477    AC H3APV3.1
#=GS E9FTT7_DAPPU/6-194      AC E9FTT7.1
#=GS H2UIK7_TAKRU/396-583    AC H2UIK7.1
#=GS B6GYE6_PENCW/73-291     AC B6GYE6.1
#=GS B1A1Q6_DROME/1-83       AC B1A1Q6.1
#=GS B4DF85_HUMAN/251-438    AC B4DF85.1
#=GS H2V026_TAKRU/311-503    AC H2V026.1
#=GS H2NAI1_PONAB/773-960    AC H2NAI1.1
#=GS Q9W1A9_DROME/765-953    AC Q9W1A9.2
#=GS E7M0L6_YEASV/220-406    AC E7M0L6.1
#=GS F7CNR1_MONDO/545-723    AC F7CNR1.1
#=GS F0WX68_9STRA/202-389    AC F0WX68.1
#=GS G0V249_TRYCI/336-444    AC G0V249.1
#=GS E9EE82_METAQ/273-462    AC E9EE82.1
#=GS A6SLY5_BOTFB/274-463    AC A6SLY5.1
#=GS G3W6G6_SARHA/590-777    AC G3W6G6.1
#=GS B3NSU7_DROER/313-506    AC B3NSU7.1
#=GS B4N1W0_DROWI/769-956    AC B4N1W0.1
#=GS G3P619_GASAC/332-519    AC G3P619.1
#=GS F7AWA4_MONDO/233-425    AC F7AWA4.1
#=GS B4QBJ1_DROSI/764-952    AC B4QBJ1.1
#=GS Q2GSV7_CHAGB/571-764    AC Q2GSV7.1
#=GS G1R1I6_NOMLE/317-509    AC G1R1I6.1
#=GS C1H9F2_PARBA/77-228     AC C1H9F2.1
#=GS F6ZDV1_ORNAN/170-357    AC F6ZDV1.1
#=GS H9ENC2_MACMU/390-577    AC H9ENC2.1
#=GS B9RKC6_RICCO/208-304    AC B9RKC6.1
#=GS A8Q168_BRUMA/257-442    AC A8Q168.1
#=GS E6ZYY7_SPORE/329-515    AC E6ZYY7.1
#=GS G3TFJ3_LOXAF/317-509    AC G3TFJ3.1
#=GS E2RTZ5_GIAIC/155-258    AC E2RTZ5.1
#=GS G1X676_ARTOA/149-328    AC G1X676.1
#=GS F1R4F8_DANRE/757-944    AC F1R4F8.1
#=GS F1S2G4_PIG/275-462      AC F1S2G4.1
#=GS E7K9A9_YEASA/153-362    AC E7K9A9.1
#=GS F8MJI1_NEUT8/278-467    AC F8MJI1.1
#=GS H2UZG2_TAKRU/347-534    AC H2UZG2.1
#=GS D0MTA7_PHYIT/233-420    AC D0MTA7.1
#=GS Q4Q053_LEIMA/59-253     AC Q4Q053.1
#=GS KAT6B_HUMAN/773-960     AC Q8WYB5.3
#=GS B3N6C7_DROER/581-772    AC B3N6C7.1
#=GS A4I3V8_LEIIN/179-287    AC A4I3V8.1
#=GS A4H7H5_LEIBR/272-461    AC A4H7H5.1
#=GS B3LNI9_YEAS1/325-534    AC B3LNI9.1
#=GS A2F1D2_TRIVA/160-346    AC A2F1D2.1
#=GS C7GNB2_YEAS2/325-534    AC C7GNB2.1
#=GS Q55NW0_CRYNB/397-550    AC Q55NW0.1
#=GS G9P053_HYPAI/526-718    AC G9P053.1
#=GS C5LJ05_PERM5/270-489    AC C5LJ05.1
#=GS ESA1_ASPOR/276-463      AC Q2UMQ5.1
#=GS B4GCR9_DROPE/769-957    AC B4GCR9.1
#=GS E9CW14_COCPS/526-712    AC E9CW14.1
#=GS C5X2L1_SORBI/225-411    AC C5X2L1.1
#=GS B4HY61_DROSE/581-772    AC B4HY61.1
#=GS MYST2_ARATH/227-413     AC Q9LXD7.1
#=GS H2NCU4_PONAB/285-477    AC H2NCU4.1
#=GS B4I0I1_DROSE/588-776    AC B4I0I1.1
#=GS H9HEZ7_ATTCE/4-67       AC H9HEZ7.1
#=GS F0YQ63_AURAN/235-426    AC F0YQ63.1
#=GS Q4D8L5_TRYCC/241-443    AC Q4D8L5.1
#=GS Q7Q1Q5_ANOGA/1-83       AC Q7Q1Q5.4
#=GS G5EGP0_CAEEL/557-749    AC G5EGP0.1
#=GS Q3YFI9_MOUSE/285-405    AC Q3YFI9.1
#=GS A8PFZ7_BRUMA/216-410    AC A8PFZ7.1
#=GS A2F781_TRIVA/152-199    AC A2F781.1
#=GS Q4QGD7_LEIMA/253-317    AC Q4QGD7.1
#=GS B0XG73_CULQU/151-337    AC B0XG73.1
#=GS A4IGQ4_XENTR/337-524    AC A4IGQ4.1
#=GS A4S305_OSTLU/189-376    AC A4S305.1
#=GS A4S2G8_OSTLU/187-381    AC A4S2G8.1
#=GS E0VL98_PEDHC/228-415    AC E0VL98.1
#=GS E9BBP9_LEIDB/276-465    AC E9BBP9.1
#=GS H3BMX5_HUMAN/33-187     AC H3BMX5.1
#=GS G9L168_MUSPF/243-430    AC G9L168.1
#=GS B8C892_THAPS/127-316    AC B8C892.1
#=GS G4NDQ2_MAGO7/390-620    AC G4NDQ2.1
#=GS I1RW28_GIBZE/592-785    AC I1RW28.1
#=GS E9DWC5_METAQ/402-611    AC E9DWC5.1
#=GS B0WUA3_CULQU/14-100     AC B0WUA3.1
#=GS B6Q9D1_PENMQ/225-412    AC B6Q9D1.1
#=GS E5SFF9_TRISP/279-465    AC E5SFF9.1
#=GS H3ISK9_STRPU/393-499    AC H3ISK9.1
#=GS G1LFV0_AILME/561-748    AC G1LFV0.1
#=GS G2XRY3_BOTF4/274-463    AC G2XRY3.1
#=GS Q2UJQ0_ASPOR/582-768    AC Q2UJQ0.1
#=GS H3DVT6_PRIPA/168-278    AC H3DVT6.1
#=GS B4I121_DROSE/313-506    AC B4I121.1
#=GS G4LXT0_SCHMA/234-427    AC G4LXT0.1
#=GS E9NP03_9MUSC/77-205     AC E9NP03.1
#=GS H8Z9N8_NEMS1/191-382    AC H8Z9N8.1
#=GS G0S295_CHATD/358-534    AC G0S295.1
#=GS G2QSB2_THITE/571-764    AC G2QSB2.1
#=GS A6QW35_AJECN/547-733    AC A6QW35.1
#=GS G3AR44_SPAPN/122-285    AC G3AR44.1
#=GS H2KNG9_CLOSI/217-412    AC H2KNG9.1
#=GS A8B8C1_DROSI/596-784    AC A8B8C1.1
#=GS E4V1C5_ARTGP/555-741    AC E4V1C5.1
#=GS D8Q424_SCHCM/120-261    AC D8Q424.1
#=GS F4NT63_BATDJ/194-380    AC F4NT63.1
#=GS A9UYF0_MONBE/49-234     AC A9UYF0.1
#=GS B4JKW1_DROGR/637-825    AC B4JKW1.1
#=GS G5C4P8_HETGA/390-577    AC G5C4P8.1
#=GS B1A1Q9_DROME/1-83       AC B1A1Q9.1
#=GS Q1AJD0_MOUSE/390-577    AC Q1AJD0.1
#=GS Q869X5_DICDI/417-603    AC Q869X5.1
#=GS C4V7W7_NOSCE/124-299    AC C4V7W7.1
#=GS B8CEC8_THAPS/75-263     AC B8CEC8.1
#=GS A5C1M8_VITVI/201-314    AC A5C1M8.1
#=GS C6LNH5_GIAIB/155-227    AC C6LNH5.1
#=GS Q0UYS2_PHANO/70-273     AC Q0UYS2.2
#=GS F8PUH0_SERL3/11-197     AC F8PUH0.1
#=GS B3RTV6_TRIAD/58-245     AC B3RTV6.1
#=GS G0NQN3_CAEBE/270-465    AC G0NQN3.1
#=GS H9F0R5_MACMU/773-960    AC H9F0R5.1
#=GS Q5K7A8_CRYNJ/255-445    AC Q5K7A8.1
#=GS MYST1_ORYSJ/232-418     AC Q8LI34.1
#=GS E9D9V5_COCPS/76-289     AC E9D9V5.1
#=GS H2UGW4_TAKRU/494-680    AC H2UGW4.1
#=GS H2WH43_CAEJA/225-416    AC H2WH43.1
#=GS Q5DDR3_SCHJA/234-427    AC Q5DDR3.1
#=GS C5JLU8_AJEDS/565-751    AC C5JLU8.1
#=GS C3XZ16_BRAFL/69-261     AC C3XZ16.1
#=GS G2R7S4_THITE/382-592    AC G2R7S4.1
#=GS G1M0R5_AILME/390-577    AC G1M0R5.1
#=GS G3B7Z2_CANTC/287-478    AC G3B7Z2.1
#=GS B0DA09_LACBS/86-238     AC B0DA09.1
#=GS H3D150_TETNG/266-452    AC H3D150.1
#=GS H2KUD1_CLOSI/279-463    AC H2KUD1.1
#=GS A7BJV7_RAT/385-572      AC A7BJV7.1
#=GS A4S9V4_OSTLU/195-398    AC A4S9V4.1
#=GS B7ZU40_XENTR/224-410    AC B7ZU40.1
#=GS G0NLL5_CAEBE/610-798    AC G0NLL5.1
#=GS F4KE11_ARATH/122-335    AC F4KE11.1
#=GS A8P3F7_BRUMA/88-205     AC A8P3F7.1
#=GS B5VDT2_YEAS6/48-258     AC B5VDT2.1
#=GS C0NP86_AJECG/286-473    AC C0NP86.1
#=GS G4TAJ0_PIRID/316-506    AC G4TAJ0.1
#=GS D3B5D4_POLPA/1-131      AC D3B5D4.1
#=GS G7Q102_MACFA/173-359    AC G7Q102.1
#=GS B5VSC6_YEAS6/134-320    AC B5VSC6.1
#=GS H9HEZ9_ATTCE/688-776    AC H9HEZ9.1
#=GS G1QSN1_NOMLE/342-529    AC G1QSN1.1
#=GS A9YI74_DROME/147-235    AC A9YI74.1
#=GS B6HQ72_PENCW/535-721    AC B6HQ72.1
#=GS H2Y514_CIOSA/16-197     AC H2Y514.1
#=GS E1G6T8_LOALO/220-414    AC E1G6T8.1
#=GS B3S7S8_TRIAD/179-372    AC B3S7S8.1
#=GS F2TM69_AJEDA/79-232     AC F2TM69.1
#=GS H0Z8D3_TAEGU/773-960    AC H0Z8D3.1
#=GS G4V0D3_NEUT9/584-777    AC G4V0D3.1
#=GS B0D0S6_LACBS/315-502    AC B0D0S6.1
#=GS F7E3A7_MACMU/772-959    AC F7E3A7.1
#=GS Q4SAS3_TETNG/264-450    AC Q4SAS3.1
#=GS B2ASN1_PODAN/285-474    AC B2ASN1.1
#=GS D8R327_SELML/189-375    AC D8R327.1
#=GS I1KFP7_SOYBN/216-402    AC I1KFP7.1
#=GS A4K580_BOMMO/215-401    AC A4K580.1
#=GS C6HMG4_AJECH/49-236     AC C6HMG4.1
#=GS H0Z4T5_TAEGU/561-748    AC H0Z4T5.1
#=GS G9CU79_LEIDO/354-470    AC G9CU79.1
#=GS B4GJS3_DROPE/605-796    AC B4GJS3.1
#=GS F7B2S8_HORSE/233-419    AC F7B2S8.1
#=GS E4X6F2_OIKDI/185-381    AC E4X6F2.1
#=GS G3JGV3_CORMM/329-529    AC G3JGV3.1
#=GS G3RR84_GORGO/470-659    AC G3RR84.1
#=GS G7KGV7_MEDTR/179-295    AC G7KGV7.1
#=GS G0U7B2_TRYVI/65-260     AC G0U7B2.1
#=GS G0PNX4_CAEBE/256-323    AC G0PNX4.1
#=GS G5E8Q9_MOUSE/318-510    AC G5E8Q9.1
#=GS G3QL80_GORGO/318-510    AC G3QL80.1
#=GS F1KUK8_ASCSU/319-506    AC F1KUK8.1
#=GS F7B937_HORSE/561-748    AC F7B937.1
#=GS H2PQ67_PONAB/562-749    AC H2PQ67.1
#=GS Q5B8Q9_EMENI/71-245     AC Q5B8Q9.1
#=GS Q4X6C9_PLACH/122-305    AC Q4X6C9.1
#=GS H2UGW0_TAKRU/557-743    AC H2UGW0.1
#=GS B5DJ87_DROPS/136-328    AC B5DJ87.1
#=GS C0SHR3_PARBP/77-228     AC C0SHR3.1
#=GS A2FPH6_TRIVA/149-336    AC A2FPH6.1
#=GS A4HGT1_LEIBR/256-355    AC A4HGT1.1
#=GS A1D7A7_NEOFI/75-287     AC A1D7A7.1
#=GS C1GVI6_PARBA/287-474    AC C1GVI6.1
#=GS G3Y2Q6_ASPNA/275-462    AC G3Y2Q6.1
#=GS F1MFX5_BOVIN/470-657    AC F1MFX5.1
#=GS E1EX08_GIAIA/148-355    AC E1EX08.1
#=GS A5DJW5_PICGU/240-403    AC A5DJW5.2
#=GS A8IKT6_DROSI/565-753    AC A8IKT6.1
#=GS Q2GQX5_CHAGB/360-539    AC Q2GQX5.1
#=GS B1A1R1_DROME/1-83       AC B1A1R1.1
#=GS B1A1M5_DROME/1-83       AC B1A1M5.1
#=GS A8PXY3_MALGO/10-196     AC A8PXY3.1
#=GS B4M8C2_DROVI/768-956    AC B4M8C2.1
#=GS H3JME6_STRPU/244-437    AC H3JME6.1
#=GS H3ABQ1_LATCH/538-725    AC H3ABQ1.1
#=GS A3LMW7_PICST/126-328    AC A3LMW7.2
#=GS A7TFQ4_VANPO/98-286     AC A7TFQ4.1
#=GS Q011W0_OSTTA/208-402    AC Q011W0.1
#=GS F2Z534_PIG/233-425      AC F2Z534.1
#=GS A8IKU9_DROSI/565-753    AC A8IKU9.1
#=GS C0S6M2_PARBP/568-754    AC C0S6M2.1
#=GS KAT8_MOUSE/232-418      AC Q9D1P2.1
#=GS H9K1L8_APIME/224-417    AC H9K1L8.1
#=GS G1P9A6_MYOLU/773-960    AC G1P9A6.1
#=GS E9NMR7_9MUSC/87-215     AC E9NMR7.1
#=GS B6AC57_CRYMR/266-451    AC B6AC57.1
#=GS E2ACJ7_CAMFO/691-773    AC E2ACJ7.1
#=GS H9HML3_ATTCE/768-955    AC H9HML3.1
#=GS G3AZ46_CANTC/98-301     AC G3AZ46.1
#=GS G3I7D3_CRIGR/232-418    AC G3I7D3.1
#=GS C0NGQ8_AJECG/79-250     AC C0NGQ8.1
#=GS H2UGW2_TAKRU/695-881    AC H2UGW2.1
#=GS H2B2C1_KAZAF/211-399    AC H2B2C1.1
#=GS Q5KEK1_CRYNJ/397-550    AC Q5KEK1.1
#=GS G5EBH5_CAEEL/602-794    AC G5EBH5.1
#=GS ESA1_ASHGO/295-481      AC Q75BY2.1
#=GS E9FX74_DAPPU/49-236     AC E9FX74.1
#=GS A2VDH4_MOUSE/232-424    AC A2VDH4.1
#=GS H3D2F6_TETNG/300-493    AC H3D2F6.1
#=GS E3X7R8_ANODA/9-95       AC E3X7R8.1
#=GS Q5CPZ1_CRYPI/271-465    AC Q5CPZ1.1
#=GS D4A999_RAT/285-395      AC D4A999.1
#=GS A8IKU1_DROSI/321-509    AC A8IKU1.1
#=GS Q9NHW0_DROME/581-772    AC Q9NHW0.1
#=GS E9NMR4_9MUSC/87-215     AC E9NMR4.1
#=GS G9K6N1_MUSPF/138-294    AC G9K6N1.1
#=GS F2TNJ6_AJEDA/327-514    AC F2TNJ6.1
#=GS B4DGH8_HUMAN/1-132      AC B4DGH8.1
#=GS G3W8Q2_SARHA/390-577    AC G3W8Q2.1
#=GS C5FLM0_ARTOC/74-291     AC C5FLM0.1
#=GS D6XIY7_TRYB2/223-412    AC D6XIY7.1
#=GS Q16HC8_AEDAE/197-342    AC Q16HC8.1
#=GS B1A1N5_DROME/1-83       AC B1A1N5.1
#=GS F6SN79_HORSE/390-577    AC F6SN79.1
#=GS H0ETY3_GLAL7/533-718    AC H0ETY3.1
#=GS H2UAR9_TAKRU/575-762    AC H2UAR9.1
#=GS G8ZRC3_TORDC/336-536    AC G8ZRC3.1
#=GS E9GC17_DAPPU/222-408    AC E9GC17.1
#=GS F0UC99_AJEC8/548-734    AC F0UC99.1
#=GS TIP60_CAEEL/226-417     AC Q9TYU5.1
#=GS B0G130_DICDI/434-620    AC B0G130.1
#=GS E6RFU9_CRYGW/258-448    AC E6RFU9.1
#=GS B6ADE4_CRYMR/312-513    AC B6ADE4.1
#=GS A2YNW7_ORYSI/232-418    AC A2YNW7.1
#=GS G3Y9F4_ASPNA/535-721    AC G3Y9F4.1
#=GS E0W2D9_PEDHC/734-867    AC E0W2D9.1
#=GS G0NKI2_CAEBE/117-167    AC G0NKI2.1
#=GS F2SQW8_TRIRC/263-450    AC F2SQW8.1
#=GS C1EHC2_MICSR/215-406    AC C1EHC2.1
#=GS G9KCA4_MUSPF/204-390    AC G9KCA4.1
#=GS F1KPU9_ASCSU/641-832    AC F1KPU9.1
#=GS G0NV22_CAEBE/267-458    AC G0NV22.1
#=GS B3MR53_DROAN/595-783    AC B3MR53.1
#=GS B2AKW4_PODAN/418-638    AC B2AKW4.1
#=GS H2QDD8_PANTR/390-577    AC H2QDD8.1
#=GS SAS2_YEAST/126-314      AC P40963.1
#=GS E9NNX3_9MUSC/77-205     AC E9NNX3.1
#=GS A6ZP83_YEAS7/220-406    AC A6ZP83.1
#=GS B4MIX9_DROWI/799-987    AC B4MIX9.1
#=GS A9JTB7_DANRE/261-447    AC A9JTB7.1
#=GS D2VA75_NAEGR/150-335    AC D2VA75.1
#=GS E5AF50_LEPMJ/93-303     AC E5AF50.1
#=GS E5SWT9_TRISP/187-363    AC E5SWT9.1
#=GS E4XB50_OIKDI/212-412    AC E4XB50.1
#=GS D8FT35_DROME/600-717    AC D8FT35.1
#=GS Q4S914_TETNG/287-492    AC Q4S914.1
#=GS ESA1_USTMA/342-528      AC Q4P3S3.1
#=GS E2RTY3_GIAIC/148-348    AC E2RTY3.1
#=GS F6Z1B6_CALJA/390-577    AC F6Z1B6.1
#=GS Q0D4H1_ORYSJ/232-418    AC Q0D4H1.1
#=GS F4RSI0_MELLP/1-119      AC F4RSI0.1
#=GS F9X7W5_MYCGM/638-769    AC F9X7W5.1
#=GS F1KW63_ASCSU/556-744    AC F1KW63.1
#=GS C6H774_AJECH/79-250     AC C6H774.1
#=GS H2YRS7_CIOSA/215-408    AC H2YRS7.1
#=GS D3ZCG0_RAT/363-550      AC D3ZCG0.1
#=GS E2L631_MONPE/5-148      AC E2L631.1
#=GS B9QQG8_TOXGO/849-1039   AC B9QQG8.1
#=GS A8Q3V3_BRUMA/326-518    AC A8Q3V3.1
#=GS C8ZGZ6_YEAS8/220-406    AC C8ZGZ6.1
#=GS F7H9S6_CALJA/318-510    AC F7H9S6.1
#=GS A6RK57_BOTFB/614-802    AC A6RK57.1
#=GS E7QKX7_YEASZ/220-406    AC E7QKX7.1
#=GS H2XZY0_CIOIN/215-401    AC H2XZY0.1
#=GS E9C2C2_CAPO3/237-410    AC E9C2C2.1
#=GS Q6AZV6_XENLA/332-519    AC Q6AZV6.1
#=GS G1DGB6_CAPHI/285-477    AC G1DGB6.1
#=GS B1A1X9_DROME/4-35       AC B1A1X9.1
#=GS G0T222_RHOG2/401-552    AC G0T222.1
#=GS E4WZA8_OIKDI/269-464    AC E4WZA8.1
#=GS A5DS58_LODEL/223-416    AC A5DS58.1
#=GS E3RP55_PYRTT/273-460    AC E3RP55.1
#=GS F6SA03_CALJA/233-425    AC F6SA03.1
#=GS B4MTN5_DROWI/90-283     AC B4MTN5.1
#=GS A0DTL9_PARTE/201-390    AC A0DTL9.1
#=GS F7DHT3_MONDO/356-543    AC F7DHT3.1
#=GS B1A1N0_DROME/1-62       AC B1A1N0.1
#=GS E6ZHG3_DICLA/780-967    AC E6ZHG3.1
#=GS F6ZDW2_ORNAN/562-749    AC F6ZDW2.1
#=GS F2S2X2_TRIT1/554-740    AC F2S2X2.1
#=GS F0UN98_AJEC8/286-473    AC F0UN98.1
#=GS H9HEZ6_ATTCE/6-91       AC H9HEZ6.1
#=GS Q8L818_MAIZE/226-412    AC Q8L818.1
#=GS E7ER15_HUMAN/251-438    AC E7ER15.1
#=GS KAT5_HUMAN/285-477      AC Q92993.2
#=GS KAT5_HUMAN/285-477      DR PDB; 2OU2 A; 233-422;
#=GS B6KVX0_TOXGO/848-1038   AC B6KVX0.1
#=GS Q5CK79_CRYHO/305-510    AC Q5CK79.1
#=GS Q5XTS8_GIAIN/155-258    AC Q5XTS8.1
#=GS A8N0R7_COPC7/254-408    AC A8N0R7.2
#=GS Q6CJM5_KLULA/109-296    AC Q6CJM5.1
#=GS F2S382_TRIT1/294-481    AC F2S382.1
#=GS G3USU0_MELGA/390-577    AC G3USU0.1
#=GS G8BSE3_TETPH/228-414    AC G8BSE3.1
#=GS E2C6Q8_HARSA/228-414    AC E2C6Q8.1
#=GS H0UV75_CAVPO/232-418    AC H0UV75.1
#=GS B7XJY8_ENTBH/145-332    AC B7XJY8.1
#=GS G3NBY5_GASAC/762-949    AC G3NBY5.1
#=GS Q6CMI7_KLULA/278-472    AC Q6CMI7.1
#=GS Q6MFC5_NEUCS/458-660    AC Q6MFC5.1
#=GS H2LX98_ORYLA/576-763    AC H2LX98.1
#=GS G7NHF4_MACMU/386-573    AC G7NHF4.1
#=GS G3X940_MOUSE/561-748    AC G3X940.1
#=GS G8JSK2_ERECY/268-466    AC G8JSK2.1
#=GS H1W5K7_COLHI/602-795    AC H1W5K7.1
#=GS A8N749_COPC7/315-502    AC A8N749.2
#=GS F6TMD0_MACMU/7-193      AC F6TMD0.1
#=GS B3MSL3_DROAN/324-517    AC B3MSL3.1
#=GS G0VFS8_NAUCC/305-499    AC G0VFS8.1
#=GS B1A1M9_DROME/1-83       AC B1A1M9.1
#=GS C5MJF2_CANTT/67-229     AC C5MJF2.1
#=GS C5PGA2_COCP7/547-733    AC C5PGA2.1
#=GS B9RJB9_RICCO/227-413    AC B9RJB9.1
#=GS F2CTG2_HORVD/220-406    AC F2CTG2.1
#=GS B4NZK8_DROYA/581-772    AC B4NZK8.1
#=GS H2UAS1_TAKRU/575-762    AC H2UAS1.1
#=GS Q55HS2_CRYNB/255-445    AC Q55HS2.1
#=GS G4NIS4_MAGO7/306-495    AC G4NIS4.1
#=GS F4PE36_BATDJ/54-242     AC F4PE36.1
#=GS G7IVB8_MEDTR/222-309    AC G7IVB8.1
#=GS G8BTG8_TETPH/368-568    AC G8BTG8.1
#=GS H2AN70_KAZAF/219-405    AC H2AN70.1
#=GS A2R7D1_ASPNC/189-388    AC A2R7D1.1
#=GS H2UIL4_TAKRU/398-585    AC H2UIL4.1
#=GS B6K1Q4_SCHJY/159-345    AC B6K1Q4.1
#=GS B7Q2V1_IXOSC/226-419    AC B7Q2V1.1
#=GS D3BF10_POLPA/136-244    AC D3BF10.1
#=GS Q5BW07_SCHJA/1-145      AC Q5BW07.2
#=GS Q95ZX6_CAEEL/388-575    AC Q95ZX6.1
#=GS F1PWC5_CANFA/566-753    AC F1PWC5.1
#=GS E3WLQ2_ANODA/1-152      AC E3WLQ2.1
#=GS C5M5I4_CANTT/130-323    AC C5M5I4.1
#=GS E1G189_LOALO/435-626    AC E1G189.1
#=GS Q010Z9_OSTTA/191-378    AC Q010Z9.1
#=GS B2VYH7_PYRTR/546-732    AC B2VYH7.1
#=GS G5C7I6_HETGA/923-1011   AC G5C7I6.1
#=GS G5BTP0_HETGA/1-122      AC G5BTP0.1
#=GS E3Q914_COLGM/387-591    AC E3Q914.1
#=GS B0XY41_ASPFC/75-287     AC B0XY41.1
#=GS C1EHI9_MICSR/270-465    AC C1EHI9.1
#=GS B2G213_ANOGA/36-212     AC B2G213.1
#=GS G9NZJ2_HYPAI/280-479    AC G9NZJ2.1
#=GS Q8I9K7_9TRYP/257-365    AC Q8I9K7.1
#=GS A2QJ44_ASPNC/535-721    AC A2QJ44.1
#=GS B7QIA7_IXOSC/205-392    AC B7QIA7.1
#=GS B4H3N8_DROPE/913-1101   AC B4H3N8.1
#=GS F6JAD9_DROME/148-251    AC F6JAD9.1
#=GS E9IIK5_SOLIN/978-1166   AC E9IIK5.1
#=GS H0GZD6_9SACH/172-360    AC H0GZD6.1
#=GS A2CEF2_DANRE/588-775    AC A2CEF2.2
#=GS Q4Q837_LEIMA/304-382    AC Q4Q837.1
#=GS B1A1P4_DROME/1-83       AC B1A1P4.1
#=GS A7S982_NEMVE/8-145      AC A7S982.1
#=GS H2UAS0_TAKRU/572-759    AC H2UAS0.1
#=GS C6LVL9_GIAIB/148-343    AC C6LVL9.1
#=GS C4R2I0_PICPG/243-441    AC C4R2I0.1
#=GS E9NNY3_9MUSC/77-205     AC E9NNY3.1
#=GS F7HL51_CALJA/232-418    AC F7HL51.1
#=GS F8QG85_SERL3/82-227     AC F8QG85.1
#=GS H2UGW6_TAKRU/559-745    AC H2UGW6.1
#=GS H2V025_TAKRU/310-502    AC H2V025.1
#=GS F6QND8_ORNAN/590-777    AC F6QND8.1
#=GS H6BX60_EXODN/143-380    AC H6BX60.1
#=GS G1KDL2_ANOCA/385-572    AC G1KDL2.1
#=GS B0EA83_ENTDS/174-368    AC B0EA83.1
#=GS G3WY39_SARHA/562-749    AC G3WY39.1
#=GS B6K311_SCHJY/237-424    AC B6K311.1
#=GS G4TS20_PIRID/341-522    AC G4TS20.1
#=GS D6WHU4_TRICA/225-411    AC D6WHU4.1
#=GS A9RAZ9_PHYPA/77-274     AC A9RAZ9.1
#=GS G8JUZ6_ERECY/101-288    AC G8JUZ6.1
#=GS H2SA34_TAKRU/260-446    AC H2SA34.1
#=GS G1TDI8_RABIT/772-959    AC G1TDI8.1
#=GS G0WF91_NAUDC/202-392    AC G0WF91.1
#=GS H2UIL1_TAKRU/367-554    AC H2UIL1.1
#=GS A5PKX7_HUMAN/562-749    AC A5PKX7.1
#=GS B8JKI8_DANRE/310-502    AC B8JKI8.1
#=GS Q3V268_MOUSE/232-418    AC Q3V268.1
#=GS G1LL01_AILME/207-393    AC G1LL01.1
#=GS H2UIL2_TAKRU/397-584    AC H2UIL2.1
#=GS F4WNJ3_ACREC/229-417    AC F4WNJ3.1
#=GS KAT5_RAT/285-477        AC Q99MK2.2
#=GS A7S8T4_NEMVE/165-351    AC A7S8T4.1
#=GS KAT6A_RAT/560-747       AC Q5TKR9.2
#=GS C5M4E6_CANTT/277-481    AC C5M4E6.1
#=GS Q2H344_CHAGB/268-457    AC Q2H344.1
#=GS B5VPQ3_YEAS6/84-272     AC B5VPQ3.1
#=GS D0A925_TRYB9/391-480    AC D0A925.1
#=GS G7N244_MACMU/773-960    AC G7N244.1
#=GS E7LDV9_TRYCR/1-102      AC E7LDV9.1
#=GS F6HGS1_VITVI/181-294    AC F6HGS1.1
#=GS Q4S4L9_TETNG/229-416    AC Q4S4L9.1
#=GS Q7Q030_ANOGA/218-403    AC Q7Q030.4
#=GS E7KIA6_YEASA/134-320    AC E7KIA6.1
#=GS B2G205_ANOAR/36-212     AC B2G205.1
#=GS G3HJQ2_CRIGR/363-550    AC G3HJQ2.1
#=GS G3IDM8_CRIGR/285-477    AC G3IDM8.1
#=GS KAT6A_MOUSE/561-748     AC Q8BZ21.2
#=GS TIP60_DROME/313-506     AC Q960X4.1
#=GS H9F9H0_MACMU/223-409    AC H9F9H0.1
#=GS E9NMR6_9MUSC/87-215     AC E9NMR6.1
#=GS A2FUS9_TRIVA/162-349    AC A2FUS9.1
#=GS H2WKU8_CAEJA/229-393    AC H2WKU8.1
#=GS E6ZGR5_DICLA/326-513    AC E6ZGR5.1
#=GS C0H9L2_SALSA/382-569    AC C0H9L2.1
#=GS B6Q9D0_PENMQ/269-456    AC B6Q9D0.1
#=GS Q56UC8_TOXGO/186-369    AC Q56UC8.1
#=GS H2YRS3_CIOSA/215-408    AC H2YRS3.1
#=GS H2XLH8_CIOIN/1-110      AC H2XLH8.1
#=GS H2UGW5_TAKRU/494-680    AC H2UGW5.1
#=GS H2YRS5_CIOSA/269-478    AC H2YRS5.1
#=GS F6XLL0_MONDO/472-659    AC F6XLL0.1
#=GS B2WNR9_PYRTR/531-748    AC B2WNR9.1
#=GS F1QX50_DANRE/276-462    AC F1QX50.1
#=GS E9BB92_LEIDB/253-317    AC E9BB92.1
#=GS G1S288_NOMLE/232-418    AC G1S288.1
#=GS G3RCP2_GORGO/232-418    AC G3RCP2.1
#=GS C4R4A0_PICPG/103-292    AC C4R4A0.1
#=GS H2AM79_KAZAF/126-314    AC H2AM79.1
#=GS F0U6I4_AJEC8/79-153     AC F0U6I4.1
#=GS B8M776_TALSN/75-290     AC B8M776.1
#=GS G1TEY7_RABIT/285-477    AC G1TEY7.1
#=GS C1E302_MICSR/327-526    AC C1E302.1
#=GS KAT8_RAT/232-418        AC Q5XI06.1
#=GS B3DK07_DANRE/588-775    AC B3DK07.1
#=GS G0UQA4_TRYCI/42-231     AC G0UQA4.1
#=GS G0MJD0_CAEBE/244-429    AC G0MJD0.1
#=GS F1L9V9_ASCSU/180-365    AC F1L9V9.1
#=GS H9GEI7_ANOCA/237-429    AC H9GEI7.1
#=GS B0XVK3_ASPFC/253-440    AC B0XVK3.1
#=GS F0YEA3_AURAN/188-381    AC F0YEA3.1
#=GS C5L2J6_PERM5/249-394    AC C5L2J6.1
#=GS G7E6K4_MIXOS/320-492    AC G7E6K4.1
#=GS D4DD56_TRIVH/538-724    AC D4DD56.1
#=GS F7W7R8_SORMK/288-477    AC F7W7R8.1
#=GS G3PI74_GASAC/556-742    AC G3PI74.1
#=GS E3RYP8_PYRTT/241-323    AC E3RYP8.1
#=GS E0VIN7_PEDHC/238-431    AC E0VIN7.1
#=GS H3DTK7_PRIPA/218-364    AC H3DTK7.1
#=GS ESA1_EMENI/278-465      AC C8VBH4.1
#=GS B3LJR3_YEAS1/220-406    AC B3LJR3.1
#=GS B4DJ40_HUMAN/55-242     AC B4DJ40.1
#=GS G3Y5R9_ASPNA/74-294     AC G3Y5R9.1
#=GS A8XUQ8_CAEBR/225-416    AC A8XUQ8.2
#=GS G2HH64_PANTR/233-425    AC G2HH64.1
#=GS B7ZD46_DANRE/81-268     AC B7ZD46.1
#=GS Q6BIP3_DEBHA/128-329    AC Q6BIP3.2
#=GS Q0UPG4_PHANO/515-700    AC Q0UPG4.2
#=GS A4HVV6_LEIIN/276-465    AC A4HVV6.1
#=GS F6Q7M7_HORSE/481-668    AC F6Q7M7.1
#=GS D5GFQ3_TUBMM/211-398    AC D5GFQ3.1
#=GS C5DQ61_ZYGRC/103-291    AC C5DQ61.1
#=GS F6RD05_HORSE/773-960    AC F6RD05.1
#=GS D0A925_TRYB9/257-365    AC D0A925.1
#=GS H2RH56_PANTR/232-413    AC H2RH56.1
#=GS G1X754_ARTOA/503-688    AC G1X754.1
#=GS H8WZ18_9ASCO/122-313    AC H8WZ18.1
#=GS H0XD84_OTOGA/774-961    AC H0XD84.1
#=GS E2ATM8_CAMFO/226-419    AC E2ATM8.1
#=GS Q6DHD0_DANRE/313-505    AC Q6DHD0.1
#=GS C0PI88_MAIZE/91-247     AC C0PI88.1
#=GS F7VVW7_SORMK/465-637    AC F7VVW7.1
#=GS H2UIK9_TAKRU/393-580    AC H2UIK9.1
#=GS C5DXR9_ZYGRC/208-394    AC C5DXR9.1
#=GS Q29JC6_DROPS/942-1130   AC Q29JC6.2
#=GS F2SXC2_TRIRC/553-739    AC F2SXC2.1
#=GS E7NLK9_YEASO/126-314    AC E7NLK9.1
#=GS H2UZG0_TAKRU/320-507    AC H2UZG0.1
#=GS H2V029_TAKRU/243-435    AC H2V029.1
#=GS C7GU91_YEAS2/126-314    AC C7GU91.1
#=GS F2S5N9_TRIT1/74-239     AC F2S5N9.1
#=GS B4M7M5_DROVI/307-500    AC B4M7M5.1
#=GS G1U6V2_RABIT/232-418    AC G1U6V2.1
#=GS G4ZD94_PHYSP/244-310    AC G4ZD94.1
#=GS H2W8V1_CAEJA/197-350    AC H2W8V1.1
#=GS A8B8D8_DROSI/596-784    AC A8B8D8.1
#=GS A8B8D6_DROSI/596-784    AC A8B8D6.1
#=GS Q4YA56_PLABA/266-448    AC Q4YA56.1
#=GS A8B8E4_DROSI/596-784    AC A8B8E4.1
#=GS A2G690_TRIVA/154-341    AC A2G690.1
#=GS E5R0H3_ARTGP/74-293     AC E5R0H3.1
#=GS E3X609_ANODA/208-319    AC E3X609.1
#=GS G1PWW0_MYOLU/561-748    AC G1PWW0.1
#=GS F7B7R4_HORSE/561-748    AC F7B7R4.1
#=GS H3FK61_PRIPA/1-55       AC H3FK61.1
#=GS ESA1_CANAL/254-418      AC Q5A7Q2.1
#=GS A6R716_AJECN/16-73      AC A6R716.1
#=GS A8HUP5_CHLRE/52-241     AC A8HUP5.1
#=GS E9ERY1_METAR/273-462    AC E9ERY1.1
#=GS H6CBF8_EXODN/514-701    AC H6CBF8.1
#=GS G1RQI0_NOMLE/562-749    AC G1RQI0.1
#=GS D8UIN5_VOLCA/332-518    AC D8UIN5.1
#=GS B3L4Y9_PLAKH/377-559    AC B3L4Y9.1
#=GS Q5CZR3_DANRE/310-502    AC Q5CZR3.1
#=GS E3LYA0_CAERE/391-577    AC E3LYA0.1
#=GS C5DF01_LACTC/220-406    AC C5DF01.1
#=GS G2XPD0_BOTF4/11-189     AC G2XPD0.1
#=GS Q08DP5_BOVIN/390-577    AC Q08DP5.1
#=GS Q4DJ31_TRYCC/224-413    AC Q4DJ31.1
#=GS A2CG09_DANRE/587-774    AC A2CG09.1
#=GS A8XU69_CAEBR/295-477    AC A8XU69.2
#=GS Q7PM09_ANOGA/579-692    AC Q7PM09.4
#=GS D5G549_TUBMM/115-298    AC D5G549.1
#=GS G1X0F4_ARTOA/276-465    AC G1X0F4.1
#=GS Q28CF9_XENTR/314-501    AC Q28CF9.1
#=GS E9NNZ3_9MUSC/77-205     AC E9NNZ3.1
#=GS D7FJG2_ECTSI/242-435    AC D7FJG2.1
#=GS I1FXD3_AMPQE/489-676    AC I1FXD3.1
#=GS E5SZ40_TRISP/251-302    AC E5SZ40.1
#=GS C5PFB4_COCP7/76-289     AC C5PFB4.1
#=GS A2F6N9_TRIVA/149-335    AC A2F6N9.1
#=GS C1N9E9_MICPC/139-323    AC C1N9E9.1
#=GS A9T381_PHYPA/119-197    AC A9T381.1
#=GS E3QX73_COLGM/599-792    AC E3QX73.1
#=GS D7M268_ARALL/223-409    AC D7M268.1
#=GS B6HTJ4_PENCW/260-447    AC B6HTJ4.1
#=GS H1V5T7_COLHI/273-462    AC H1V5T7.1
#=GS Q3UH94_MOUSE/482-669    AC Q3UH94.1
#=GS G0UD62_TRYVI/260-369    AC G0UD62.1
#=GS D8M976_BLAHO/78-264     AC D8M976.1
#=GS A8Q3V2_BRUMA/448-640    AC A8Q3V2.1
#=GS E9B048_LEIMU/477-556    AC E9B048.1
#=GS G2WKH8_YEASK/126-314    AC G2WKH8.1
#=GS G3J3Z3_CORMM/272-461    AC G3J3Z3.1
#=GS G7PEZ6_MACFA/773-960    AC G7PEZ6.1
#=GS G3SR61_LOXAF/392-579    AC G3SR61.1
#=GS H9KFR3_APIME/229-415    AC H9KFR3.1
#=GS G1SH87_RABIT/232-418    AC G1SH87.1
#=GS G3TCI2_LOXAF/232-331    AC G3TCI2.1
#=GS G4VP74_SCHMA/168-365    AC G4VP74.1
#=GS G0QL13_ICHMG/204-396    AC G0QL13.1
#=GS D4AYB0_ARTBC/74-240     AC D4AYB0.1
#=GS E9NNZ1_9MUSC/77-205     AC E9NNZ1.1
#=GS G7PU94_MACFA/386-573    AC G7PU94.1
#=GS B4JQP5_DROGR/621-812    AC B4JQP5.1
#=GS G4UJF3_NEUT9/278-467    AC G4UJF3.1
#=GS E1G2T9_LOALO/264-453    AC E1G2T9.1
#=GS F8NUM9_SERL9/109-295    AC F8NUM9.1
#=GS E9IPR7_SOLIN/228-414    AC E9IPR7.1
#=GS A8XVI4_CAEBR/589-792    AC A8XVI4.2
#=GS B3NQ81_DROER/762-950    AC B3NQ81.1
#=GS F9XDS5_MYCGM/81-271     AC F9XDS5.1
#=GS D2H4P7_AILME/318-510    AC D2H4P7.1
#=GS A2DTA3_TRIVA/163-350    AC A2DTA3.1
#=GS ESA1_CANGA/221-407      AC Q6FPH9.1
#=GS F2PJ10_TRIEC/113-278    AC F2PJ10.1
#=GS E4YZ11_OIKDI/1-146      AC E4YZ11.1
#=GS B3KVJ2_HUMAN/234-421    AC B3KVJ2.1
#=GS B1A1T0_DROME/1-83       AC B1A1T0.1
#=GS H3D6L1_TETNG/576-763    AC H3D6L1.1
#=GS I0Z815_9CHLO/44-233     AC I0Z815.1
#=GS G0YL11_SCHGR/212-295    AC G0YL11.1
#=GS B3LM18_YEAS1/126-314    AC B3LM18.1
#=GS A3M0I3_PICST/162-372    AC A3M0I3.2
#=GS E2BH53_HARSA/224-417    AC E2BH53.1
#=GS H2UAS3_TAKRU/568-755    AC H2UAS3.1
#=GS C7YPV2_NECH7/308-516    AC C7YPV2.1
#=GS B4JNG5_DROGR/378-571    AC B4JNG5.1
#=GS G1MG58_AILME/285-477    AC G1MG58.1
#=GS H0VPB3_CAVPO/285-477    AC H0VPB3.1
#=GS F4RZU4_MELLP/102-284    AC F4RZU4.1
#=GS G3S5C2_GORGO/285-477    AC G3S5C2.1
#=GS Q4RPG5_TETNG/785-971    AC Q4RPG5.1
#=GS C0P4I0_MAIZE/226-378    AC C0P4I0.1
#=GS Q7S5B5_NEUCR/458-660    AC Q7S5B5.1
#=GS F7F247_MACMU/770-957    AC F7F247.1
#=GS F4SEM0_MELLP/1-85       AC F4SEM0.1
#=GS H3I2S6_STRPU/74-260     AC H3I2S6.1
#=GS Q9VM15_DROME/581-772    AC Q9VM15.2
#=GS Q171E0_AEDAE/260-445    AC Q171E0.1
#=GS E4Y8V0_OIKDI/212-412    AC E4Y8V0.1
#=GS H2UGW7_TAKRU/557-743    AC H2UGW7.1
#=GS F7HVC5_CALJA/762-949    AC F7HVC5.1
#=GS G4VED7_SCHMA/247-432    AC G4VED7.1
#=GS A5K4J9_PLAVS/407-589    AC A5K4J9.1
#=GS E9BJW4_LEIDB/179-287    AC E9BJW4.1
#=GS I1CJI7_RHIO9/125-312    AC I1CJI7.1
#=GS B9WAA0_CANDC/131-322    AC B9WAA0.1
#=GS F6PNA9_CIOIN/68-193     AC F6PNA9.1
#=GS F7BCB6_HORSE/561-748    AC F7BCB6.1
#=GS Q4WPY5_ASPFU/546-731    AC Q4WPY5.1
#=GS E3MHJ8_CAERE/302-500    AC E3MHJ8.1
#=GS B6KPT3_TOXGO/246-429    AC B6KPT3.1
#=GS E4ZSL7_LEPMJ/690-878    AC E4ZSL7.1
#=GS Q3UGF2_MOUSE/364-551    AC Q3UGF2.1
#=GS Q8III2_PLAF7/386-566    AC Q8III2.1
#=GS E4YR25_OIKDI/72-259     AC E4YR25.1
#=GS E2RE71_CANFA/318-510    AC E2RE71.1
#=GS E7A2K1_SPORE/603-788    AC E7A2K1.1
#=GS G3GWQ5_CRIGR/1-165      AC G3GWQ5.1
#=GS Q501M5_MOUSE/482-669    AC Q501M5.1
#=GS C5GX52_AJEDR/79-232     AC C5GX52.1
#=GS D8SMF4_SELML/189-375    AC D8SMF4.1
#=GS G3V961_RAT/390-577      AC G3V961.1
#=GS E3RYP8_PYRTT/88-244     AC E3RYP8.1
#=GS E7FAT9_DANRE/386-573    AC E7FAT9.1
#=GS O80378_DAUCA/215-401    AC O80378.1
#=GS Q28CP4_XENTR/239-425    AC Q28CP4.1
#=GS A4I3V8_LEIIN/301-379    AC A4I3V8.1
#=GS G3WE75_SARHA/227-413    AC G3WE75.1
#=GS G9NS61_HYPAI/274-463    AC G9NS61.1
#=GS G0PMS2_CAEBE/225-416    AC G0PMS2.1
#=GS A4HVF3_LEIIN/253-317    AC A4HVF3.1
#=GS Q4N7S1_THEPA/139-324    AC Q4N7S1.1
#=GS D2HMY4_AILME/386-573    AC D2HMY4.1
#=GS A0ND10_ANOGA/509-707    AC A0ND10.3
#=GS D0A3S6_TRYB9/63-258     AC D0A3S6.1
#=GS G1MW59_MELGA/563-750    AC G1MW59.2
#=GS H2YRS4_CIOSA/280-473    AC H2YRS4.1
#=GS C6HIU9_AJECH/564-750    AC C6HIU9.1
#=GS B1A1T3_DROME/1-83       AC B1A1T3.1
#=GS A4H724_LEIBR/252-316    AC A4H724.1
#=GS F1L0N0_ASCSU/273-458    AC F1L0N0.1
#=GS G8BGW8_CANPC/247-406    AC G8BGW8.1
#=GS G7Y8D1_CLOSI/749-948    AC G7Y8D1.1
#=GS B4J6E8_DROGR/670-858    AC B4J6E8.1
#=GS C9K0F9_HUMAN/142-329    AC C9K0F9.1
#=GS E9BB92_LEIDB/354-470    AC E9BB92.1
#=GS E2RTZ5_GIAIC/257-384    AC E2RTZ5.1
#=GS Q59EJ8_HUMAN/220-412    AC Q59EJ8.1
#=GS C1GVX3_PARBA/568-619    AC C1GVX3.1
#=GS G3QPT7_GORGO/564-751    AC G3QPT7.1
#=GS A2DWG7_TRIVA/132-317    AC A2DWG7.1
#=GS B1A1T8_DROME/1-83       AC B1A1T8.1
#=GS Q6C7N8_YARLI/155-346    AC Q6C7N8.1
#=GS B1A1V4_DROME/4-35       AC B1A1V4.1
#=GS E7NMM3_YEASO/202-388    AC E7NMM3.1
#=GS F6Z2E0_CALJA/107-294    AC F6Z2E0.1
#=GS A1CI27_ASPCL/538-724    AC A1CI27.1
#=GS G1SDT4_RABIT/393-580    AC G1SDT4.1
#=GS A9YI73_DROSI/147-235    AC A9YI73.1
#=GS C4Y336_CLAL4/238-402    AC C4Y336.1
#=GS D3K5K8_PIG/390-577      AC D3K5K8.1
#=GS KAT8_HUMAN/232-418      AC Q9H7Z6.2
#=GS KAT8_HUMAN/232-418      DR PDB; 2Y0M A; 232-418;
#=GS KAT8_HUMAN/232-418      DR PDB; 2PQ8 A; 232-418;
#=GS KAT8_HUMAN/232-418      DR PDB; 2GIV A; 59-245;
#=GS KAT8_HUMAN/232-418      DR PDB; 3QAH A; 232-418;
#=GS B6QQE8_PENMQ/533-719    AC B6QQE8.1
#=GS G2QK85_THIHA/141-352    AC G2QK85.1
#=GS A8WW58_CAEBR/391-578    AC A8WW58.1
#=GS E4UR37_ARTGP/296-483    AC E4UR37.1
#=GS D0VY24_9SAUR/228-415    AC D0VY24.1
#=GS G5E9K7_HUMAN/360-547    AC G5E9K7.1
#=GS B8M2R0_TALSN/269-456    AC B8M2R0.1
#=GS E3RG37_PYRTT/562-748    AC E3RG37.1
#=GS G1PC54_MYOLU/285-477    AC G1PC54.1
#=GS D3TPP9_GLOMM/256-449    AC D3TPP9.1
#=GS E5SLH4_TRISP/189-376    AC E5SLH4.1
#=GS G2WNB2_YEASK/220-406    AC G2WNB2.1
#=GS Q3UGU8_MOUSE/234-421    AC Q3UGU8.1
#=GS G3V125_HUMAN/234-421    AC G3V125.1
#=GS F7E3B4_MACMU/590-777    AC F7E3B4.1
#=GS B1A1N8_DROME/1-83       AC B1A1N8.1
#=GS H0YUG5_TAEGU/390-580    AC H0YUG5.1
#=GS E9C2L3_CAPO3/351-538    AC E9C2L3.1
#=GS E9BJW4_LEIDB/301-379    AC E9BJW4.1
#=GS H0XB88_OTOGA/231-417    AC H0XB88.1
#=GS E6ZTQ1_SPORE/312-480    AC E6ZTQ1.1
#=GS B4I2D5_DROSE/764-952    AC B4I2D5.1
#=GS E2RRZ2_CANFA/393-580    AC E2RRZ2.1
#=GS D5GPU9_TUBMM/506-691    AC D5GPU9.1
#=GS G7NC89_MACMU/318-510    AC G7NC89.1
#=GS B8NNR7_ASPFN/276-463    AC B8NNR7.1
#=GS B3P5T0_DROER/111-299    AC B3P5T0.1
#=GS Q6FN05_CANGA/140-328    AC Q6FN05.1
#=GS F9FN80_FUSOF/347-534    AC F9FN80.1
#=GS H2WG13_CAEJA/365-580    AC H2WG13.1
#=GS C8Z3P6_YEAS8/325-534    AC C8Z3P6.1
#=GS E4XZA8_OIKDI/184-370    AC E4XZA8.1
#=GS G3AXU8_CANTC/249-462    AC G3AXU8.1
#=GS B4HA97_DROPE/1-138      AC B4HA97.1
#=GS E9NMR9_9MUSC/87-215     AC E9NMR9.1
#=GS B7ZXU9_MAIZE/11-113     AC B7ZXU9.1
#=GS G0N7G6_CAEBE/95-287     AC G0N7G6.1
#=GS G9KCA9_MUSPF/1-76       AC G9KCA9.1
#=GS A9NUX9_PICSI/241-427    AC A9NUX9.1
#=GS ESA1_GIBZE/274-463      AC Q4IEV4.1
#=GS A7SMW6_NEMVE/250-442    AC A7SMW6.1
#=GS B4Q1D9_DROYA/595-783    AC B4Q1D9.1
#=GS H0GNV4_9SACH/220-406    AC H0GNV4.1
#=GS C4YKZ1_CANAW/301-511    AC C4YKZ1.1
#=GS F1RRK4_PIG/318-510      AC F1RRK4.1
#=GS E4YKQ8_OIKDI/188-374    AC E4YKQ8.1
#=GS H3F4Q2_PRIPA/394-588    AC H3F4Q2.1
#=GS E1F974_GIAIA/155-249    AC E1F974.1
#=GS G0VGQ7_NAUCC/139-332    AC G0VGQ7.1
#=GS A6RY81_BOTFB/306-486    AC A6RY81.1
#=GS G3VG62_SARHA/253-445    AC G3VG62.1
#=GS C0SVP1_ARATH/227-413    AC C0SVP1.1
#=GS G7DW09_MIXOS/429-612    AC G7DW09.1
#=GS F6QNC0_ORNAN/348-535    AC F6QNC0.1
#=GS E9PJI1_HUMAN/74-266     AC E9PJI1.1
#=GS H3AME8_LATCH/123-310    AC H3AME8.1
#=GS A7E2B6_HUMAN/481-668    AC A7E2B6.1
#=GS G8YI80_PICSO/244-410    AC G8YI80.1
#=GS G1S4L0_NOMLE/767-954    AC G1S4L0.1
#=GS A8B8B8_DROSI/596-784    AC A8B8B8.1
#=GS C4YJ12_CANAW/131-323    AC C4YJ12.1
#=GS F7AWF2_MONDO/319-511    AC F7AWF2.1
#=GS F6TV17_CALJA/772-959    AC F6TV17.1
#=GS F2T7X0_AJEDA/565-751    AC F2T7X0.1
#=GS E1BEB3_BOVIN/561-748    AC E1BEB3.2
#=GS B3RPJ9_TRIAD/137-266    AC B3RPJ9.1
#=GS D6WX35_TRICA/856-1041   AC D6WX35.1
#=GS B3RW46_TRIAD/225-411    AC B3RW46.1
#=GS F6SWT5_XENTR/239-425    AC F6SWT5.1
#=GS B7Q9K5_IXOSC/215-401    AC B7Q9K5.1
#=GS E9BV90_LEIDB/59-253     AC E9BV90.1
#=GS B8MZN6_ASPFN/75-241     AC B8MZN6.1
#=GS Q00SN5_OSTTA/3-132      AC Q00SN5.1
#=GS F0VAG3_NEOCL/246-424    AC F0VAG3.1
#=GS H0V809_CAVPO/481-668    AC H0V809.1
#=GS G3R085_GORGO/773-960    AC G3R085.1
#=GS E3MHB0_CAERE/663-746    AC E3MHB0.1
#=GS A9V4T8_MONBE/549-745    AC A9V4T8.1
#=GS Q4DSV4_TRYCC/195-412    AC Q4DSV4.1
#=GS B2WGV0_PYRTR/273-460    AC B2WGV0.1
#=GS D4A957_RAT/318-510      AC D4A957.1
#=GS Q75BN5_ASHGO/258-455    AC Q75BN5.2
#=GS G5DZQ5_9PIPI/68-200     AC G5DZQ5.1
#=GS KAT5_MOUSE/285-477      AC Q8CHK4.2
#=GS G7YA05_CLOSI/179-377    AC G7YA05.1
#=GS I1M828_SOYBN/177-302    AC I1M828.1
#=GS H2V028_TAKRU/279-471    AC H2V028.1
#=GS H3DSQ4_PRIPA/263-468    AC H3DSQ4.1
#=GS C1G425_PARBD/552-738    AC C1G425.1
#=GS G3QAR0_GASAC/292-397    AC G3QAR0.1
#=GS F7VW38_SORMK/642-835    AC F7VW38.1
#=GS H0VJS6_CAVPO/362-549    AC H0VJS6.1
#=GS F4PJ52_DICFS/898-1046   AC F4PJ52.1
#=GS G7XCH8_ASPKW/275-462    AC G7XCH8.1
#=GS Q6CHX2_YARLI/281-480    AC Q6CHX2.1
#=GS Q21789_CAEEL/266-458    AC Q21789.3
#=GS B1A1R2_DROME/1-83       AC B1A1R2.1
#=GS F4WLV3_ACREC/659-734    AC F4WLV3.1
#=GS G3TEZ7_LOXAF/260-447    AC G3TEZ7.1
#=GS F0VLC3_NEOCL/1119-1309  AC F0VLC3.1
#=GS E4XNZ8_OIKDI/598-785    AC E4XNZ8.1
#=GS G5B6D5_HETGA/139-308    AC G5B6D5.1
#=GS H3D0P5_TETNG/394-584    AC H3D0P5.1
#=GS B4Q5P5_DROSI/565-756    AC B4Q5P5.1
#=GS E3LLU7_CAERE/235-420    AC E3LLU7.1
#=GS A4HVF3_LEIIN/354-470    AC A4HVF3.1
#=GS E7EUP3_HUMAN/204-391    AC E7EUP3.1
#=GS Q9VAV6_DROME/199-386    AC Q9VAV6.1
#=GS G5BFM8_HETGA/103-185    AC G5BFM8.1
#=GS G3JF48_CORMM/521-714    AC G3JF48.1
#=GS Q8I9K7_9TRYP/391-480    AC Q8I9K7.1
#=GS F6W3I1_CALJA/1-132      AC F6W3I1.1
#=GS G0TYT4_TRYVI/223-412    AC G0TYT4.1
#=GS H3J987_STRPU/119-199    AC H3J987.1
#=GS G7E1H3_MIXOS/342-528    AC G7E1H3.1
#=GS H2QAZ7_PANTR/232-413    AC H2QAZ7.1
#=GS B4DG18_HUMAN/107-294    AC B4DG18.1
#=GS C9SWN5_VERA1/575-725    AC C9SWN5.1
#=GS F6UKT0_XENTR/391-578    AC F6UKT0.1
#=GS B0R0X6_DANRE/292-484    AC B0R0X6.1
#=GS H2WG28_CAEJA/370-557    AC H2WG28.1
#=GS H9JYU9_APIME/827-935    AC H9JYU9.1
#=GS H0WI07_OTOGA/748-935    AC H0WI07.1
#=GS G3QAR3_GASAC/243-435    AC G3QAR3.1
#=GS Q5CX42_CRYPI/305-510    AC Q5CX42.1
#=GS F4W4H7_ACREC/935-1122   AC F4W4H7.1
#=GS MYST1_ARATH/227-413     AC Q9FLF7.1
#=GS I1F7A4_AMPQE/473-559    AC I1F7A4.1
#=GS Q0TVG3_PHANO/284-472    AC Q0TVG3.2
#=GS D4B1H8_ARTBC/536-722    AC D4B1H8.1
#=GS Q38AD3_TRYB2/63-257     AC Q38AD3.1
#=GS C5FM08_ARTOC/294-462    AC C5FM08.1
#=GS C1C2N4_9MAXI/201-387    AC C1C2N4.1
#=GS Q7ZW29_DANRE/348-535    AC Q7ZW29.1
#=GS H2UAS2_TAKRU/479-666    AC H2UAS2.1
#=GS Q4DQJ5_TRYCC/62-254     AC Q4DQJ5.1
#=GS F6H0N1_VITVI/221-407    AC F6H0N1.1
#=GS H9K8H4_APIME/824-916    AC H9K8H4.1
#=GS Q5A9C5_CANAL/301-511    AC Q5A9C5.1
#=GS E0S9K2_ENCIT/169-354    AC E0S9K2.1
#=GS KAT6B_MACFA/481-668     AC Q8WML3.1
#=GS E6ZHG4_DICLA/613-800    AC E6ZHG4.1
#=GS C3XQH2_BRAFL/689-803    AC C3XQH2.1
#=GS F6M9F4_9MUSC/84-211     AC F6M9F4.1
#=GS H2YI86_CIOSA/237-425    AC H2YI86.1
#=GS E3KQE3_PUCGT/253-421    AC E3KQE3.2
#=GS D8QC13_SCHCM/321-507    AC D8QC13.1
#=GS Q6J514_DANRE/587-774    AC Q6J514.1
#=GS C7GWE4_YEAS2/220-406    AC C7GWE4.1
#=GS G3SV35_LOXAF/562-749    AC G3SV35.1
#=GS D7G7K4_ECTSI/353-540    AC D7G7K4.1
#=GS H2Q248_PANTR/773-960    AC H2Q248.1
#=GS G0UD62_TRYVI/393-477    AC G0UD62.1
#=GS E1BMS5_BOVIN/285-477    AC E1BMS5.1
#=GS Q5REC7_PONAB/562-749    AC Q5REC7.1
#=GS G0UX27_TRYCI/63-257     AC G0UX27.1
#=GS Q0CHU4_ASPTN/239-426    AC Q0CHU4.1
#=GS E9IXP2_SOLIN/190-383    AC E9IXP2.1
#=GS H8Z922_NEMS1/145-252    AC H8Z922.1
#=GS A5DY23_LODEL/252-413    AC A5DY23.1
#=GS E2RRZ4_CANFA/360-547    AC E2RRZ4.1
#=GS B4L6N2_DROMO/301-494    AC B4L6N2.1
#=GS C3XQG2_BRAFL/223-409    AC C3XQG2.1
#=GS Q8I9K8_9TRYP/223-412    AC Q8I9K8.1
#=GS G8ZLM2_TORDC/96-284     AC G8ZLM2.1
#=GS F7DHZ3_MONDO/391-578    AC F7DHZ3.1
#=GS F7HRR5_CALJA/204-390    AC F7HRR5.1
#=GS G8BC73_CANPC/178-375    AC G8BC73.1
#=GS F4PJ50_DICFS/199-386    AC F4PJ50.1
#=GS A8B8A8_DROSI/596-784    AC A8B8A8.1
#=GS E7L7H9_TRYCR/241-442    AC E7L7H9.1
#=GS Q8W513_MAIZE/226-412    AC Q8W513.1
#=GS C4JS19_UNCRE/617-694    AC C4JS19.1
#=GS B4PAU4_DROYA/763-951    AC B4PAU4.1
#=GS Q5CL15_CRYHO/271-465    AC Q5CL15.1
#=GS KAT6B_MOUSE/591-778     AC Q8BRB7.3
#=GS F1KYF2_ASCSU/236-430    AC F1KYF2.1
#=GS SAS3_YEAST/325-535      AC P34218.1
#=GS A8Q6A2_MALGO/1-80       AC A8Q6A2.1
#=GS D3GKE2_HORVU/220-406    AC D3GKE2.1
#=GS H2QW31_PANTR/562-749    AC H2QW31.1
#=GS E1G6X4_LOALO/264-449    AC E1G6X4.1
#=GS A8J386_CHLRE/189-375    AC A8J386.1
#=GS F6QZE4_MACMU/285-441    AC F6QZE4.1
#=GS C5GU93_AJEDR/565-751    AC C5GU93.1
#=GS H0UX50_CAVPO/390-577    AC H0UX50.1
#=GS B7FRP3_PHATC/133-321    AC B7FRP3.1
#=GS B1A1Z4_DROME/4-35       AC B1A1Z4.1
#=GS G8ZMV7_TORDC/218-404    AC G8ZMV7.1
#=GS G0VBC0_NAUCC/223-409    AC G0VBC0.1
#=GS H2UZG1_TAKRU/333-520    AC H2UZG1.1
#=GS Q16S27_AEDAE/575-647    AC Q16S27.1
#=GS G9MP82_HYPVG/573-766    AC G9MP82.1
#=GS Q2UQE0_ASPOR/75-241     AC Q2UQE0.1
#=GS G7NQY5_MACMU/189-375    AC G7NQY5.1
#=GS F6WDR7_CALJA/81-268     AC F6WDR7.1
#=GS F1RTB9_PIG/390-577      AC F1RTB9.1
#=GS Q5XTS9_GIAIN/148-348    AC Q5XTS9.1
#=GS A2QFA7_ASPNC/275-462    AC A2QFA7.1
#=GS G3TXS2_LOXAF/561-748    AC G3TXS2.1
#=GS ESA1_SCHPO/237-423      AC O94446.1
#=GS B4LQG9_DROVI/228-421    AC B4LQG9.1
#=GS Q7PXS0_ANOGA/228-421    AC Q7PXS0.5
#=GS F0XN89_GROCL/485-705    AC F0XN89.1
#=GS G8BEQ4_CANPC/121-313    AC G8BEQ4.1
#=GS Q7RR28_PLAYO/266-449    AC Q7RR28.1
#=GS G2XB33_VERDV/607-802    AC G2XB33.1
#=GS A7T4V3_NEMVE/1-96       AC A7T4V3.1
#=GS E7KGR4_YEASA/1-145      AC E7KGR4.1
#=GS E3QIL4_COLGM/273-462    AC E3QIL4.1
A3BME4_ORYSJ/163-349               ............................................................l-KHPPGD.EIY......R.......S.............G............T.......L..SMF...E.VDGK..KN.......................K..V..YGQNLCYLAKLFLDHKTLY..YD.......V.DL.....FLFYVLC..E...C...D..D...R...G.................................CH..MVGYFS.K..........E....KH....S....E....E.S.........Y.NLAC...ILTLPP..........Y.....Q.RK..G..........YGKF.LIAF..........S................Y.EL....S...K....K...E.....G..............K..V..........G.TPE...........RPLSDLGLL..S.YRGYWTRVLLEI.LK......K..H.K..S.--.............................NI.S.....I.K....ELSDMTAIKADDILSTLQSLD.LIQYRKGQHVICAd......................................................
#=GR A3BME4_ORYSJ/163-349    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H2UGW1_TAKRU/559-745               .............................................................WFHPPAN.EIY......R.......K.............E............D.......V..SVF...E.VDGN..VS.......................T..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..Q...N...D..S...K...G.................................CH..LVGYFS.K..........E....KH....C....Q....Q.K.........Y.NVSC...IMILPQ..........Y.....Q.RK..G..........YGRF.LIDF..........S................Y.LL....S...K....R...E.....G..............Q..P..........G.SPE...........KPLSDLGRL..S.YMAYWRSVVLEC.LH......E..V.Q..D.R-.............................QI.T.....I.R....QLSKLTGICPQDITTTLHSLN.MLEQRGD------rlvlvr.................................................
#=GR H2UGW1_TAKRU/559-745    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F1NGX4_CHICK/385-572               .............................................................WKHPPGD.EIY......R.......K.............G............S.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LIGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LH......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQALQ.MLKYWKGKHLV--lkr....................................................
#=GR F1NGX4_CHICK/385-572    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q0CQQ1_ASPTN/535-721               ............................................................a-KHPPGD.EIY......R.......D.............G............S.......I..SIF...E.VDGR..KN.......................P..V..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYVMT..E...F...D..D...L...G.................................CH..FVGYFS.K..........E....KR....P....S....S.A.........N.NVSC...ILTLPI..........H.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...R....I...E.....G..............K..T..........G.SPE...........KPLSDMGLV..S.YRNYWRLILSYQ.LR......N..Q.K..T.P-.............................-V.S.....I.A....DLSDRTGMTADDIVSGLEALR.ALVRD--------pvtktyalr..............................................
#=GR Q0CQQ1_ASPTN/535-721    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q4QFX1_LEIMA/276-465               ............................................................l-RHPPGN.EIY......R.......D.............Pv..........rR.......L..VVL...E.LDGS..LE.......................P..T..FCEHLALLSKLFLEHKALD..HD.......M.TP.....FLFYVLC..S...V...E..T...H...G.................................LQ..VLGYFS.K..........E....KQ....T....P....E.P.........Y.NLSC...ILVLPQ..........Y.....Q.SR..G..........IGRF.LIEL..........S................Y.EL....S...R....R...E.....G..............K..V..........G.TPE...........KPLSDLGEK..L.YLSYWADSVTMA.IA......R.aM.E..E.GH.............................CV.S.....V.D....YLVQATAMIQADVIRALQHQK.LLN----------ghqltised..............................................
#=GR Q4QFX1_LEIMA/276-465    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E9AP51_LEIMU/253-317               ............................................................l-RTPPGR.LIY......H.......D.............E............Da.....gY..KAF...L.VDGA..KD.......................L..H..YGRCLSLLGKQLIESKVLS..ND.......V.DL.....YEYVVVT..-...-...-..-...-...-.................................--..------.-..........-....--....-....-....-.-.........-.----...------..........-.....-.--..-..........----.----..........-................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------ipras..................................................
#=GR E9AP51_LEIMU/253-317    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
I1G988_AMPQE/183-369               .............................................................WRQPPGK.EIY......R.......K.............G............N.......I..SMF...E.LDGR..DH.......................K..I..YCQNLCLLAKLFLDHKTLF..FD.......V.EP.....FWFYVFT..E...V...D..R...E...G.................................CH..IVGYFS.K..........E....KE....S....I....E.C.........N.NVAC...ILTLPP..........Y.....Q.RK..G..........YGKF.LIAF..........S................Y.EL....S...K....L...E.....E..............C..V..........G.SPE...........KPLSDLGKL..S.YRSYWTWVLLDI.LK......N..A.S..G.Y-.............................-V.S.....I.K....DLSATTSISQDDVLSTLQALN.MVKYWKGQHVICVt......................................................
#=GR I1G988_AMPQE/183-369    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G0RAB4_HYPJQ/274-463               ............................................................l-QHPPGN.EIY......R.......D.............D............Y.......V..SFF...E.IDGR..RQ.......................R..T..WCRNLCLLSKMFLDHKTLY..YD.......V.DP.....FLFYVMT..M...R...T..D...K...G.................................CH..IVGYFS.K..........E....KE....S....A....D.A.........Y.NVAC...ILTLPQ..........Y.....Q.RK..G..........YGRL.LIQF..........S................Y.EL....S...K....I...E.....G..............K..L..........G.SPE...........KPLSDLGLL..S.YRQYWSENILDL.LL......G..Y.N..E.RD............................eKV.T.....I.E....AISSALAMTTQDVEHTLQAMK.MQVYHKSDHKIV-ip.....................................................
#=GR G0RAB4_HYPJQ/274-463    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q4DUW6_TRYCC/228-417               ............................................................p-RHPPGN.EIY......R.......D.............Pv..........rQ.......L..VVL...E.MDAV..VE.......................P..V..FCEHLALLSKLFLEHKALD..HD.......M.TP.....FLFYVLC..A...V...Q..P...H...G.................................LE..VLGYFS.K..........E....KQ....S....P....E.M.........Y.NLSC...ILVLPQ..........F.....Q.SR..G..........IGRF.LIEL..........S................Y.EL....S...R....R...E.....G..............R..I..........G.SPE...........KPLSDLGEK..L.YLGYWGDVIVSA.LA......R..AiE..E.NH.............................CA.T.....L.D....YLVQATYLSQADVLRTLQYLR.LLNG---------tqivvsee...............................................
#=GR Q4DUW6_TRYCC/228-417    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B7Z4D9_HUMAN/204-391               .............................................................WKHPPGD.EIY......R.......K.............G............S.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LIGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LH......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQALQ.MLKYWKGKHLV--lkr....................................................
#=GR B7Z4D9_HUMAN/204-391    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H3AQQ7_LATCH/390-577               .............................................................WKHPPGD.EIY......R.......K.............G............S.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LIGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LH......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQALQ.MLKYWKGKHLV--lkr....................................................
#=GR H3AQQ7_LATCH/390-577    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A7F0Z3_SCLS1/339-519               ..........................................................kgt---VPGN.CVY......Eh....eeD.............G............E.......W..SVW...E.VDGE..VE.......................G..T..FSQSLSLFAKLFLDNKSVL..YD.......V.QS.....FNYFLLV..H...T...DldT...A...E.................................RQ..IIGFFS.K..........E....KM....S....W....D.N.........N.NLAC...ILVFPP..........W.....Q.KK..G..........LGSI.LIGV..........S................Y.EI....S...R....R...E.....G..............L..L..........G.GPE...........KPISELGKK..G.YERFWGAEVARY.LL......E..L.E..E.GD.............................DI.M.....E.D....V-EEE----------------.-------------eeeeievvkvvqkpvvkk.....................................
#=GR A7F0Z3_SCLS1/339-519    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q6MFL9_NEUCS/649-842               ............................................................a-KHPPGD.EIY......R.......H.............G............S.......I..SVF...E.VDGR..KN.......................P..V..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYVLC..E...Y...D..Q...Y...G.................................YH..FVGYFS.K..........E....KR....A....S....S.Q.........N.NVSC...ILTLPI..........H.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...R....V...E.....Q..............K..T..........G.SPE...........KPLSDMGLV..S.YRNYWRLVMCKY.LL......E..H.C..S.GDpk........................ekkGL.S.....I.K....KISDDTGLTPDDVISSLEGLR.CLVRDPQTQ----lyafr..................................................
#=GR Q6MFL9_NEUCS/649-842    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
D0IQI5_DROME/765-953               .............................................................WKQPPGT.EIF......R.......Q.............G............N.......I..SVF...E.VDGN..VN.......................K..I..YCQNLCLLAKFFLDHKTLY..YD.......V.EP.....FLFYILT..K...N...D..Q...S...G.................................CH..LVGYFS.K..........E....KH....C....T....Q.K.........Y.NVSC...ILTMPQ..........Y.....Q.RQ..G..........YGRF.LIDF..........S................Y.LL....S...R....E...E.....G..............Q..L..........G.TPE...........KPLSDLGRL..S.YFSYWKSVVLEY.LY......K..H.R..N.YT.............................KI.T.....F.K....DIAIKTGLAISDIALAFELLN.FIKLRKNDGDIR-yq.....................................................
#=GR D0IQI5_DROME/765-953    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q4YB51_PLABA/265-448               ............................................................i-RHPPGN.EIY......R.......N.............E............K.......I..SIF...E.IDGN..YF.......................R..I..YCENLCFLSKLFLDHKTLK..HR.......V.NL.....FLFYVIT..E...F...D..E...Y...G.................................YH..ITGYFS.K..........E....KY....S....-....-.K.........N.NVSC...ILTLPQ..........H.....Q.KK..G..........YGKF.LINF..........S................Y.FL....S...Q....T...E.....K..............R..I..........G.TPE...........RPLSDLGAA..S.YMAYWYETLLKV.LI......N..Y.E..K.--.............................-L.S.....I.Q....ELSEITSIETYDIVACLEEKE.IIKSMANG-----etvyyi.................................................
#=GR Q4YB51_PLABA/265-448    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q3UPM9_MOUSE/561-748               .............................................................WFHPPAN.EIY......R.......K.............N............N.......I..SVF...E.VDGN..VS.......................T..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..Q...N...D..V...K...G.................................CH..LVGYFS.K..........E....KH....C....Q....Q.K.........Y.NVSC...IMILPQ..........Y.....Q.RK..G..........YGRF.LIDF..........S................Y.LL....S...K....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YMAYWKSVILEC.LY......H..Q.N..D.-K.............................QI.S.....I.K....KLSKLTGVCPQDITSTLHHLR.MLDFRSDQFVII-rr.....................................................
#=GR Q3UPM9_MOUSE/561-748    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E3LAC6_PUCGT/376-540               ............................................................l-LHPPGN.EIY......R.......A.............E............E.......I..HFF...E.IDGR..RQ.......................K..T..WCRNLSLLSKCFLDHKTLY..YD.......V.DP.....FLYYVMC..Q...R...D..S...N...G.................................LH..LIGYFS.K..........E....KE....S....A....E.N.........Y.NVAC...ILTLPQ..........Y.....Q.RL..G..........FGKL.LIEF..........S................Y.EL....S...K....K...E.....G..............K..L..........G.SPE...........KPLSDLGLL..S.YRAYWEETIVGF.IL......D.cH.Q..K.NE.............................GV.S.....I.D....EIAQKTAIV------------.-------------s......................................................
#=GR E3LAC6_PUCGT/376-540    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q5U8N1_ENTHI/175-369               ...........................................................yh--FPPGL.LIY......K.......D.............De..........rH.......L..AFF...E.VDGA..EA.......................K..M..FCQSLCLLSKMFLDHKTLY..YD.......V.EP.....FYFYVLC..E...F...N..Y...N...Eqwk...........................sddYH..IVGYFS.K..........E....KA....S....P....D.G.........Y.NLSC...LMVLPH..........H.....Q.RK..G..........YGKM.LISM..........S................Y.EL....S...K....I...E.....G..............I..P..........G.SPE...........KPLSDLGLV..S.FKSYWSGVIAEE.LL......N..S.T..E.I-.............................-P.S.....I.E....DLTLKTGITKEDCVSALDTLN.CISPYRGSQIISIn......................................................
#=GR Q5U8N1_ENTHI/175-369    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F0ZF82_DICPU/336-511               ............................................................l-RHPPGN.EIY......R.......S.............G............N.......L..SMF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......N.AI.....-------..-...-...-..-...K...E.................................VA..TWLAIS.K..........E....KD....S....P....D.G.........Y.NLAC...ILTLPP..........Y.....Q.RK..G..........FGKL.LISF..........S................Y.EL....S...K....K...E.....N..............K..V..........G.TPE...........KPLSDLGLL..S.FRSYWTQVLLEI.LR......K..H.K..G.--.............................NL.S.....I.L....DISNMTSIRTEDVISTLQSLN.LIRYWKGQHIISVt......................................................
#=GR F0ZF82_DICPU/336-511    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
I1CM66_RHIO9/246-432               ............................................................l-HHPPGN.EIY......R.......N.............D............E.......I..SFF...E.IDGR..KQ.......................K..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMT..E...R...D..E...K...G.................................YH..LIGYFS.K..........E....KE....S....S....E.N.........Y.NVAC...ILTLPQ..........Y.....Q.RL..G..........YGRL.LIAF..........S................Y.EL....S...K....A...E.....G..............R..T..........G.SPE...........KPLSDLGLL..S.YRAFWTETIVEY.LL......Q..A.Q..E.--.............................EV.T.....I.E....EISQRTSITTQDILHTLQNIG.ALKYYRGQHIICLg......................................................
#=GR I1CM66_RHIO9/246-432    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B4PQS6_DROYA/120-308               ............................................................k-RRPPGS.LVY......R.......K.............D............A.......I..HIY...E.VDGN..KE.......................K..L..YCQCLCLMAKLFLKNKETL..YS.......P.KL.....LFFYILC..L...K...D..K...D...G.................................EH..LVGYFS.R..........D....KK....S....N....S.N.........V.NLNC...ILVLPP..........Y.....M.RK..G..........YGKL.LIAL..........S................Y.EI....S...R....K...E.....G..............V..I..........G.GPQ...........KPLSDVGSL..C.YLSYWGHILLEW.LR......H..H.T..S.PD.............................RI.T.....I.E....ELSKATGFVKEDVILTLKFMK.IRTYYTDDHIL--ytt....................................................
#=GR B4PQS6_DROYA/120-308    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A7ASC0_BABBO/216-401               ............................................................l-RHPPGN.EIY......R.......D.............G............N.......L..AMF...E.VDGA..LS.......................S..I..YCENLCYLSKLFLDHKSLR..HT.......V.NL.....FIFYVMT..E...V...D..D...N...G.................................YH..ITGYFS.K..........E....KH....S....S....-.-.........N.NVSC...ILSLPQ..........H.....Q.RK..G..........YGKF.LTAF..........S................Y.LL....S...R....K...E.....G..............R..T..........G.TPE...........RPLSDLGRA..S.YMSYWSEVLLEI.LF......D..P.R..Y.E-.............................NV.T.....I.E....MLSHMTCFEPNDIIMCLEELG.LLHTLS-------ngrsviti...............................................
#=GR A7ASC0_BABBO/216-401    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B4DGY4_HUMAN/353-540               .............................................................WKHPPGD.EIY......R.......K.............G............S.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LIGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LH......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQALQ.MLKYWKGKHLV--lkr....................................................
#=GR B4DGY4_HUMAN/353-540    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G3AKJ0_SPAPN/109-299               ........................................................trptv-----GR.LVY......Y.......D.............D............K.......Y..IIR...E.VRGF..QD.......................R..L..FCQNLCLFAKLFLVDKSIY..YN.......I.DY.....FNFYIIY..G...Y...D..S...G...T.................................YK..PMGFFS.K..........E....VL....S....Y....DnD.........N.NLAC...ICIFPP..........Y.....Q.RL..R..........LGSM.MIEF..........S................Y.EL....A...K....L...Tp...gQ..............L..T..........S.GPE...........YPLSPYGKI..S.YLRYWSKKLARI.LH......G..L.T..D.ND.............................SI.T.....I.N....QLSKQTGFRKEDVLFTLEYMK.LIQYNP-------rgdtkls................................................
#=GR G3AKJ0_SPAPN/109-299    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E5SQH2_TRISP/129-332               ...........................................................rr--KTKGN.KAY......E.......S.............D............N.......M..ILY...E.FDGE..TDsvt.................iplS..V..ICSHLCLFASNFISSKVCA..YL.......L.SP.....FMFYVLY..R...K...G..V...D...G................................vIE..ACGYFS.K..........E....KS....G....D....N.G.........K.ALSC...LCVFPH..........E.....Q.RN..G..........YGMF.LIEFckyi.aqahgS................Y.EL....C...K....R...N.....R..............L..Y..........G.TPE...........RPLSDEGRS..A.FMKYWTYSIFNI.LD......E..K.D..G.R-.............................KI.S.....I.T....SLQEKSGIVAEDILDMLEQYS.FVKNCPSNHIIL-vd.....................................................
#=GR E5SQH2_TRISP/129-332    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A9URG9_MONBE/60-246                ...........................................................pp--HPPGA.EIY......R.......A.............G............N.......L..AVW...E.VDGA..VE.......................K..V..YCQNLCLLSKLFLSTKTLY..TD.......V.EP.....FWFYVLT..E...W...T..E...H...G.................................AR..IVGYFS.K..........E....KQ....S....F....L.N.........Y.NLSC...IMTLPQ..........H.....Q.RK..G..........YGKL.MIEF..........S................Y.LL....S...I....R...E.....G..............V..P..........G.SPE...........KPLSDLGLL..S.YRSYWREAIVRY.LH......E..R.K..N.SS.............................HV.S.....V.R....DMSETTGILDTDLISTLQYLG.FIKQWRSQYVI--l......................................................
#=GR A9URG9_MONBE/60-246     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q8SR51_ENCCU/169-354               ............................................................l-RHPPGR.EIY......R.......D.............G............V.......L..SFF...E.CDGH..IQ.......................K..N..YCRNLSLLSKLFLDHKSLY..YD.......I.DV.....FMFYVLC..R...L...E..D...N...G.................................YQ..IVGYFS.K..........E....KM....S....E....Q.G.........Y.NLAC...ILTLPF..........E.....Q.RK..G..........YGKI.LIDF..........S................Y.LL....S...R....R...E.....N..............V..V..........S.GPE...........KPLSDLGLL..S.YRAYWMEVIVEY.LS......K..H.D..K.--.............................-A.S.....I.S....EISRETYISEDDVIGTLCAYK.MLRMEGNEFI---ftya...................................................
#=GR Q8SR51_ENCCU/169-354    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G3S8U6_GORGO/562-749               .............................................................WFHPPAN.EIY......R.......K.............N............N.......I..SVF...E.VDGN..VS.......................T..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..Q...N...D..V...K...G.................................CH..LVGYFS.K..........E....KH....C....Q....Q.K.........Y.NVSC...IMILPQ..........Y.....Q.RK..G..........YGRF.LIDF..........S................Y.LL....S...K....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YMAYWKSVILEC.LY......H..Q.N..D.-K.............................QI.S.....I.K....KLSKLTGICPQDITSTLHHLR.MLDFRSDQFVII-rr.....................................................
#=GR G3S8U6_GORGO/562-749    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
C5G6S7_AJEDR/287-473               ............................................................l-VHPPGN.EIY......R.......D.............D............H.......V..SFF...E.VDGR..RQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMT..T...R...D..E...H...G.................................CH..LVGYFS.K..........E....KE....S....A....E.G.........Y.NVAC...ILTLPQ..........Y.....Q.RR..G..........FGRL.LIAF..........S................Y.EL....S...K....R...E.....N..............K..L..........G.SPE...........KPLSDLGLL..G.YRQYWRETIVDI.LM......E..P.G..R.E-.............................SI.S.....E.S....ELASLSAMTEKDVHETLVVLN.LLRYNVSRK----ldhr...................................................
#=GR C5G6S7_AJEDR/287-473    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
D8QKG5_SCHCM/221-371               ............................................................m-FHPPGR.RVY......Q.......R.............G............A.......H..TIW...E.IDGA..KE.......................K..I..YCQNLALFGKLFIDIKTVF..FD.......L.DN.....FFFYVTT..D...G...E..T...K...Q.................................DN..PVGYFS.K..........E....KV....S....Y....D.D.........Y.NLAC...ITVFPP..........Y.....Q.RK..A..........FGIL.MIEF..........S................-.--....-...-....-...-.....-..............K..V..........G.SPE...........RPLSDLGLR..S.YLAYWVAAIVRL.LR......Q..L.-..-.--.............................--.-.....-.-....---------------------.-------------ltvvpqkrvtygmt.........................................
#=GR D8QKG5_SCHCM/221-371    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G7E6K3_MIXOS/321-493               ............................................................m-AHPPGR.KVY......Q.......R.............G............A.......H..ILW...E.IDGA..QH.......................K..L..FCQNLALFGKLFIDHKYMF..YD.......V.DD.....FLFYIVT..E...A...E..P...S...R.................................DY..VLGYFS.K..........E....KV....S....Y....D.N.........Y.NLAC...IVTFPP..........F.....Q.KR..G..........YGNL.LIEF..........S................Y.EI....A...R....R...T.....D..............P..Aa.......ppG.TPE...........RPLSDLGLR..G.YLTYWTGAIVRH.LR......T..L.F..Q.SD.............................AF.P.....I.N....---------------------.-------------qkltitktspkrqspr.......................................
#=GR G7E6K3_MIXOS/321-493    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q0IJ11_XENTR/278-470               ............................................................l-RHPPGN.EIY......R.......K.............G............T.......I..SFF...E.IDGR..KN.......................K..S..YSQNLCLLAKCFLDHKTLY..YD.......T.DP.....FLFYIMT..E...Y...D..C...K...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKL.LIEF..........S................Y.EL....S...K....V...E.....G..............K..T..........G.TPE...........KPLSDLGLL..S.YRSYWSQTILEI.LM......E..L.K..T.ETge.........................rpQI.T.....I.N....EISEITSIKKEDVISTLQYLN.LINYYKGQYILT-ls.....................................................
#=GR Q0IJ11_XENTR/278-470    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G1N326_MELGA/481-668               .............................................................WFHPPAN.EIY......R.......R.............N............D.......L..SVF...E.VDGN..VS.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..K...N...D..E...K...G.................................CH..LVGYFS.K..........E....KL....C....Q....Q.K.........Y.NVSC...IMIMPQ..........Y.....Q.RQ..G..........FGRF.LIDF..........S................Y.LL....S...R....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YLAYWKSVILEY.LN......C..H.H..E.-K.............................QI.S.....I.K....GMSRATGMCPHDIATTLQQHS.MIDKREDRFVI--irr....................................................
#=GR G1N326_MELGA/481-668    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
D2HID3_AILME/773-960               .............................................................WFHPPAN.EIY......R.......R.............K............D.......L..SVF...E.VDGN..MS.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..K...N...D..E...K...G.................................CH..LVGYFS.K..........E....KL....C....Q....Q.K.........Y.NVSC...IMIMPQ..........H.....Q.RQ..G..........FGRF.LIDF..........S................Y.LL....S...R....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YLAYWKSVILEY.LY......H..H.Q..E.R-.............................HI.S.....I.K....AISRATGMCPHDIATTLQHLH.MIDKRDGRFVI--irr....................................................
#=GR D2HID3_AILME/773-960    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E7R1V6_PICAD/239-429               ............................................................s-QRPPGT.EIY......R.......A.............S............R.......L..AMF...E.IDGR..KN.......................V..V..YCQNLCLFAKLFLNSKTLY..YD.......V.EP.....FMFYVLC..E...I...D..E...D...G.................................YH..FVGYFS.K..........E....KL....N....G....T.N.........Y.NLSC...ILTLPI..........Y.....Q.RR..G..........YGNF.LIDF..........S................Y.LL....S...R....R...E.....F..............R..L..........G.TPE...........KPLSDLGLF..S.YRNYWKISVAKA.LKs...lvE..A.D..K.AH.............................QV.S.....V.D....DICNLTGMIHNDVIVGLEQLK.ALVRD--------petekygi...............................................
#=GR E7R1V6_PICAD/239-429    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
C5DQT6_ZYGRC/294-496               ............................................................h-FRPPGN.EIY......R.......D.............G............K.......I..SVW...E.IDGR..EN.......................V..I..YCQNLCLLAKLFLNSKTLY..YD.......V.EP.....FIFYVLT..E...R...E..D...V...Gtg............................ipkFH..LVGYFS.K..........E....KL....N....S....T.D.........Y.NLSC...ILTLPI..........Y.....Q.RK..G..........YGHF.LMEF..........S................Y.LL....S...R....R...E.....F..............K..W..........G.TPE...........KPLSDLGLL..S.YRNYWKVKCAQV.LV......D..L.K..I.LLqnsd.....................fsnlQI.S.....L.V....EMSNLTGMIPTDVVFGLEQLK.VLVRRT-------ksdgkvqya..............................................
#=GR C5DQT6_ZYGRC/294-496    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
ESA1_CRYNB/339-525                 ............................................................l-LHPPGN.EIY......R.......H.............E............G.......I..SFF...E.IDGR..KQ.......................R..T..WCRNLCLISKCFLDHKTLY..YD.......V.DP.....FLYYCMT..V...K...D..D...Y...G.................................CH..LIGYFS.K..........E....KE....S....A....E.G.........Y.NVAC...ILTLPQ..........H.....Q.RK..G..........YGRL.LIEF..........S................Y.EL....S...K....V...E.....G..............K..L..........G.SPE...........KPLSDLGLL..G.YRAYWQEKIVEL.LL......D..S.D..Y.--.............................EI.S.....L.D....EIAQKTSITHGDIMHTCQALQ.MIKYYKNSHIIHLt......................................................
#=GR ESA1_CRYNB/339-525      pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
#=GR ESA1_CRYNB/339-525      sAS   ..........................................................................................................................................................................................................................................................................................................................................*...........................................................................................................................................................................................................................................................................................................................................
F1LRU3_RAT/393-580                 .............................................................WKHPPGD.EIY......R.......K.............G............S.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LIGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LH......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQALQ.MLKYWKGKHLV--lkr....................................................
#=GR F1LRU3_RAT/393-580      pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
C9STR2_VERA1/278-467               ............................................................l-QHPPGN.EIY......R.......D.............D............S.......I..SFF...E.IDGR..RQ.......................R..T..WCRNLCLLSKMFLDHKTLY..YD.......V.DP.....FLFYVMT..T...R...D..D...K...G.................................FH..FVGYFS.K..........E....KE....S....A....D.G.........Y.NVAC...ILTLPQ..........Y.....Q.RK..G..........YGRL.LIQF..........S................Y.EL....S...K....I...E.....G..............R..L..........G.SPE...........KPLSDLGLL..S.YRQYWGENIIDL.LL......G..L.N..E.RE............................dKA.T.....I.E....TISTQLSMTTQDVEHTLGALR.MQIYHRGEHKIV-ip.....................................................
#=GR C9STR2_VERA1/278-467    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H2MKG3_ORYLA/566-752               .............................................................WFHPPAN.EIY......R.......K.............D............D.......V..SVF...E.VDGN..VS.......................T..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..Q...N...D..S...K...G.................................CH..LVGYFS.K..........E....KH....C....Q....Q.K.........Y.NVSC...IMILPQ..........Y.....Q.RQ..G..........YGRF.LIDF..........S................Y.LL....S...K....R...E.....G..............Q..P..........G.SPE...........KPLSDLGRL..S.YMAYWRSVVLEC.LH......E..L.R..D.R-.............................QI.S.....I.R....QLSKMTGICPQDITSSLHSLG.MLEQR--------gdglvlvr...............................................
#=GR H2MKG3_ORYLA/566-752    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A0PJC5_MOUSE/101-288               .............................................................WFHPPAN.EIY......R.......K.............N............N.......I..SVF...E.VDGN..VS.......................T..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..Q...N...D..V...K...G.................................CH..LVGYFS.K..........E....KH....C....Q....Q.K.........Y.NVSC...IMILPQ..........Y.....Q.RK..G..........YGRF.LIDF..........S................Y.LL....S...K....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YMAYWKSVILEC.LY......H..Q.N..D.-K.............................QI.S.....I.K....KLSKLTGVCPQDITSTLHHLR.MLDFRSDQFVII-rr.....................................................
#=GR A0PJC5_MOUSE/101-288    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A8IKV3_DROSI/565-753               ............................................................r-RRPPGR.EIY......R.......K.............G............N.......I..SIY...E.VNGK..EE.......................S..L..YCQLLCLMAKLFLDHKVLY..FD.......M.DP.....FLFYILC..E...T...D..K...E...G.................................SH..IVGYFS.K..........E....KK....S....L....E.N.........Y.NVAC...ILVLPP..........H.....Q.RK..G..........FGKL.LIAF..........S................Y.EL....S...R....K...E.....G..............V..I..........G.SPE...........KPLSDLGRL..S.YRSYWAYTLLEL.MK......T..R.C..A.PE.............................QI.T.....I.K....ELSEMSGITHDDIIYTLQSMK.MIKYWKGQNVICVt......................................................
#=GR A8IKV3_DROSI/565-753    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H3G293_PRIPA/842-1028              ............................................................i-RCPPGD.EVY......R.......D.............A............H.......S..PAG...I.I--S..VF.......................R..H..YCQQLSLFGMLFISDKAVY..ID.......L.AH.....FDYFVVTifM...A...D..R...G...G.................................FR..PVGYFS.K..........Q....RL....S....Q....M.K.........H.NLCC...FCVFPC..........Y.....Q.NK..G..........LGRF.IIDF..........S................Y.QL....S...I....M...S.....K..............W..P..........G.GPE...........RPLSPFGRV..S.YTSYWKRCVVLA.IH......K..A.G..G.--.............................EI.D.....M.A....DLELKLGMRKEDIIEVIENLF.SVQSNNQELVI--sgs....................................................
#=GR H3G293_PRIPA/842-1028   pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A7TMV8_VANPO/369-569               ............................................................h-THPPGN.EIY......R.......D.............G............K.......I..SVW...E.VDGR..EN.......................V..I..YCQNLCLLAKLFLNSKTLY..YD.......V.EP.....FIFYILT..E...R...E..D...E...Gyq............................cprFH..LVGYYS.H..........E....KL....N....S....T.D.........Y.NLSC...ILTLPI..........Y.....Q.RK..G..........YGHF.LMDF..........S................Y.LL....T...K....R...A.....Y..............K..L..........G.TPE...........KPLSDLGLL..S.YRNFWKIKCAQV.LL......K..I.K..E.TIltn......................sesiYI.T.....L.E....DISNLTGMIPTDVVLGLEQLG.VLYQKTV------idkeqen................................................
#=GR A7TMV8_VANPO/369-569    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F8MUN5_NEUT8/447-648               .......................................................kmveev-------.-IQ......D.......E.............G............E.......W..SIW...K.VDGA..ED.......................M..L..FCQNLSLFAKLFLDNKSVF..FD.......V.SG.....FHYFLLV..F...T...P..P...D...Pptdpdsd..................vtevvkprGQ..VVGFFS.K..........E....KM....S....W....D.N.........N.NLAC...ILIFPP..........W.....Q.RK..G..........LGAL.LMGV..........S................Y.EI....S...R....R...E.....G..............I..I..........G.GPE...........KPISELGKK..G.YKRFWAGEIARW.LL......S..L.E..P.TGttp......................geetVV.D.....I.E....DCSKATWIAPDDCLAVLREMD.VAE----------dagr...................................................
#=GR F8MUN5_NEUT8/447-648    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q16G59_AEDAE/8-107                 ..............................................lcqvqelcdcclkev-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...-...-..-...-...-.................................--..------.-..........-....--....-....-....-.-.........-.----...------..........-.....-.--..-..........----.---F..........C................Y.ML....T...R....V...E.....G..............K..I..........G.SPE...........KPLSDLGLI..S.YRSYWKDVLLAY.LC......S..R.A..G.-T.............................TL.S.....I.K....DISQEMAINSYDIVSTLQALG.MMKYWKGKHIIL-kk.....................................................
Q8SQM1_ENCCU/95-271                ..........................................................sqg---IPGR.HVYt....dK.......D.............E............G.......I..SVI...E.IDGG..CE.......................S..V..LCRRICTIGRAFIHRKTLH..LD.......V.DG.....YLFYVLL..I...-...-..-...-...G.................................GR..VAGFFS.K..........E....KE....S....E....K.-.........H.NLSC...LLVLPP..........H.....R.SR..G..........YGSL.MIDL..........S................Y.IL....G...-....-...-.....-..............-..P..........G.TPE...........KPLSKEGRA..V.YKRYWRNMVLKT.LR......K..M.G..G.E-.............................EM.S.....I.C....SISAESGLSIDDTIHGLELLG.IN-----------peshiydvs..............................................
#=GR Q8SQM1_ENCCU/95-271     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
ESA1_CRYNJ/339-525                 ............................................................l-LHPPGN.EIY......R.......H.............E............G.......I..SFF...E.IDGR..KQ.......................R..T..WCRNLCLISKCFLDHKTLY..YD.......V.DP.....FLYYCMT..V...K...D..D...Y...G.................................CH..LIGYFS.K..........E....KE....S....A....E.G.........Y.NVAC...ILTLPQ..........H.....Q.RK..G..........YGRL.LIEF..........S................Y.EL....S...K....V...E.....G..............K..L..........G.SPE...........KPLSDLGLL..G.YRAYWQEKIVEL.LL......D..S.D..Y.--.............................EI.S.....L.D....EIAQKTSITHGDIMHTCQALQ.MIKYYKNSHIIHLt......................................................
#=GR ESA1_CRYNJ/339-525      pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
#=GR ESA1_CRYNJ/339-525      sAS   ..........................................................................................................................................................................................................................................................................................................................................*...........................................................................................................................................................................................................................................................................................................................................
G6CZK5_DANPL/306-499               ............................................................l-KHPPGN.EIY......R.......K.............G............S.......I..SFF...E.IDGR..KN.......................K..C..YAQNLCLLAKLFLDHKTLY..YD.......T.DP.....FLFYVMT..E...F...D..S...R...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........Y.....Q.RK..G..........YGTL.LIEF..........S................Y.EL....S...K....F...E.....G..............K..T..........G.SPE...........KPLSDLGLL..S.YRSYWAQTILDI.LI......S..I.K..P.VGds........................ekpII.T.....I.N....EICELTSIKKEDVISTLQNLN.LINYYKGQYIISVn......................................................
#=GR G6CZK5_DANPL/306-499    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
C4XWF8_CLAL4/306-508               ............................................................n-NHPPGV.EIY......R.......D.............Se..........aK.......I..AIW...E.VDGR..KN.......................I..E..YCQNLCLLAKLFLNSKTLY..YD.......V.EP.....FLFYILT..E...I...D..D...H...Dp..............................siYH..FVGYFS.K..........E....KL....N....N....S.D.........Y.NVSC...IVTLPI..........Y.....Q.RK..G..........YGSL.LIDF..........S................Y.ML....S...R....S...E.....F..............K..F..........G.TPE...........KPLSDLGLL..S.YRAYWKVTIAYV.LR......D..L.H..N.KYlsqs....................ndnniML.S.....I.E....ILSKLTGMKPSDVVVGLEQLN.ALVK---------svetggyaiv.............................................
#=GR C4XWF8_CLAL4/306-508    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
C6LNH5_GIAIB/247-378               ...........................................................qk-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-----LE..E...H...D..D...D...S.................................YH..FVGFFS.K..........E....KQ....Q....E....N.-.........-.SLSC...IVALPC..........F.....Q.KK..G..........YGNM.MIDF..........S................Y.ML....S...S....R...E.....C..............R..L..........G.GPE...........MPLSDLGLM..S.YLSYWKRRICEV.LV......R..N.T..T.S-.............................EI.S.....L.F....EISKQTMISYRNLIMAMNKYG.LLKETPSNT----aiyfr..................................................
E2RRZ5_CANFA/390-577               .............................................................WKHPPGD.EIY......R.......K.............G............S.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LIGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LH......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQALQ.MLKYWKGKHLV--lkr....................................................
#=GR E2RRZ5_CANFA/390-577    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F9X7W5_MYCGM/526-616               ............................................................a-KHPPGD.EIY......R.......D.............Hvtnse..tgaetT.......L..SFF...E.VDGR..RN.......................P..L..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYIMT..E...N...D..E...F...G.................................CH..FVGYFS.K..........E....KR....-....-....-.-.........-.----...------..........-.....-.--..-..........----.----..........-................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------gcgsa..................................................
#=GR F9X7W5_MYCGM/526-616    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E9AP51_LEIMU/354-472               .........................................................fdae-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...-...D..W...D...G.................................DA..VMGYFS.R..........L....KH....H....P....D.H.........-.TLSC...IVTLPI..........F.....Q.RT..G..........VATF.LLDV..........A................Y.WM....T...R....Q...R.....Q..............R..VcgcgfcgrsgG.AIS...........RPFSPHGQS..L.LLSYWRRALLRS.LA......A..V.A..P.--.............................--.-.....-.-....---------------------.-------------lhrrvsrtaqpelrftlae....................................
#=GR E3MB58_CAERE/122-311    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H2V027_TAKRU/290-482               ............................................................l-RHPPGN.EIY......R.......K.............G............T.......I..SFF...E.IDGR..KN.......................K..S..YSQNLCLLAKCFLDHKTLY..YD.......T.DP.....FLFYVMT..E...Y...D..S...K...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKL.LIEF..........S................Y.EL....S...K....V...E.....G..............K..T..........G.TPE...........KPLSDLGLL..S.YRSYWSQTILEI.LM......D..L.K..P.DNge.........................rpQI.T.....I.N....EISEITSVKKEDVISTLQYLN.LINYYKGQYILT-ls.....................................................
#=GR H2V027_TAKRU/290-482    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G8YQB0_PICSO/124-327               ........................................................rypli-----GR.LVY......R.......D.............D............N.......N..GIFi.kK.VQGH..KH.......................K..L..FCQCMCLFSKLFLDDKSIY..YA.......V.DT.....FDFYVVY..G...R..cD..D...T...Sqgas.........................depqYI..PNGFFS.K..........E....KV....P....W....DpS.........N.NLAC...ICVFPP..........F.....Q.RR..S..........LGSL.MIEL..........S................Y.YL....A...N....I...V.....D..............RlsA..........S.GPE...........FPLSKFGKI..C.YLRFWSKKLAAViLT......E..L.S..S.EN.............................VF.D.....L.S....SLSDLTGFRKEDILLTLEFMG.VIYIQEHS-----gktslh.................................................
#=GR G8YQB0_PICSO/124-327    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H2YRS6_CIOSA/280-473               ............................................................l-RYPPGN.EIY......R.......K.............S............S.......I..SFF...E.IDGR..KN.......................K..S..YAQNLCLLAKCFLDHKTLY..YD.......T.DP.....FLFYVMT..E...Y...D..S...K...G.................................FH..LVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........H.....Q.RK..G..........FGKL.LIEF..........S................Y.AL....S...R....I...E.....G..............K..A..........G.TPE...........KPLSDLGLL..S.YRSYWTNTILSM.II......G..L.K..P.EPgq........................ekpQI.T.....I.N....EICEKTCVKKEDVISTLQHLN.LINYYKGQYIIVLs......................................................
#=GR H2YRS6_CIOSA/280-473    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
ESA1_NEUCR/278-467                 ............................................................l-HHPPGN.EIY......R.......D.............D............Y.......V..SFF...E.IDGR..RQ.......................R..T..WCRNLCLLSKMFLDHKTLY..YD.......V.DP.....FLFYVMT..T...R...D..D...R...G.................................CH..IIGYFS.K..........E....KE....S....T....D.G.........Y.NVAC...ILTLPQ..........Y.....Q.RK..G..........YGRL.LIQF..........S................Y.EL....S...K....I...E.....G..............K..L..........G.SPE...........KPLSDLGLL..S.YRQYWSENIIDI.LL......G..Y.N..E.RK............................eAC.T.....I.E....NIAVALAMTTQDVEHTLQALK.MQVYHKGEHKIV-vp.....................................................
#=GR ESA1_NEUCR/278-467      pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
#=GR ESA1_NEUCR/278-467      sAS   ..........................................................................................................................................................................................................................................................................................................................................*...........................................................................................................................................................................................................................................................................................................................................
D4A4Q5_RAT/301-488                 .............................................................WKHPPGD.EIY......R.......K.............G............S.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LIGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LH......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQALQ.MLKYWKGKHLV--lkr....................................................
#=GR D4A4Q5_RAT/301-488      pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q5ZK16_CHICK/390-577               .............................................................WKHPPGD.EIY......R.......K.............G............S.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LIGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LH......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQALQ.MLKYWKGKHLV--lkr....................................................
#=GR Q5ZK16_CHICK/390-577    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E1FVH2_LOALO/256-441               ............................................................r-KEPPGV.EIY......K.......E.............K............S.......M..SVY...E.VLGS..ND.......................K..V..YCQCLCLLAKLFLDHKTLY..FD.......V.EP.....FLFYVLC..E...V...D..S...R...G.................................AQ..MVGYFS.K..........E....QG....N....P....D.G.........N.NLAC...ICILPP..........F.....Q.RS..G..........YGKF.LIQL..........S................Y.EI....S...K....R...E.....G..............L..I..........G.SPE...........KPLSDLGKL..S.YRSYWSWAVLEV.LR......T..C.S..K.--.............................-I.S.....I.A....DLSRRTAIHVNDIIETLHSLK.LTRYWKGDHVLY-vt.....................................................
#=GR E1FVH2_LOALO/256-441    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B0DB55_LACBS/82-224                ............................................................r-KHPPGR.KVY......Q.......R.............G............A.......H..TIW...E.VDGA..KD.......................K..L..YCQNLSLFGKLFIDVKTLF..FD.......C.DN.....FLFYILT..D...A...T..P...S...T.................................DH..ILGFFS.K..........E....KH....S....F....D.E.........Y.NLAC...IMTLPQ..........Y.....Q.RM..G..........YGML.MIEF..........S................Y.EL....S...R....R...A.....G..............K..A..........G.TPE...........RPLSDLGLR..S.YLAYWVATLIRF.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------fr.....................................................
#=GR B0DB55_LACBS/82-224     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H0XAK1_OTOGA/285-477               ............................................................l-RHPPGN.EIY......R.......K.............G............T.......I..SFF...E.IDGR..KN.......................K..S..YSQNLCLLAKCFLDHKTLY..YD.......T.DP.....FLFYVMT..E...Y...D..C...K...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKL.LIEF..........S................Y.EL....S...K....V...E.....G..............K..T..........G.TPE...........KPLSDLGLL..S.YRSYWSQTILEI.LM......G..L.K..S.ESge.........................rpQI.T.....I.N....EISEITSIKKEDVISTLQYLN.LINYYKGQYILT-ls.....................................................
#=GR H0XAK1_OTOGA/285-477    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
C0SVV9_ARATH/227-413               ............................................................l-KHPPGD.EIY......R.......S.............S............T.......L..SMF...E.VDGK..KN.......................K..V..YAQNLCYLAKLFLDHKTLY..YD.......V.DL.....FLFYILC..E...C...D..D...R...G.................................CH..MVGYFS.K..........E....KH....S....E....E.A.........Y.NLAC...ILTLPP..........Y.....Q.RK..G..........YGKF.LIAF..........S................Y.EL....S...K....K...E.....G..............K..V..........G.TPE...........RPLSDLGLV..S.YRGYWTRILLDI.LK......K..H.K..G.--.............................NI.S.....I.K....ELSDMTAIKAEDILSTLQSLE.LIQYRKGQHVICAd......................................................
#=GR C0SVV9_ARATH/227-413    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q28ZY6_DROPS/767-955               .............................................................WKQPPGT.EIF......R.......Q.............G............N.......I..SVF...E.VDGN..VN.......................K..I..YCQNLCLLAKFFLDHKTLY..YD.......V.EP.....FLFYILT..K...N...D..Q...S...G.................................CH..LVGYFS.K..........E....KH....C....T....Q.K.........Y.NVSC...ILTMPQ..........Y.....Q.RQ..G..........YGRF.LIDF..........S................Y.LL....S...R....E...E.....G..............Q..L..........G.TPE...........KPLSDLGRL..S.YFSYWKSVVLEY.LY......K..Y.R..N.QP.............................KI.T.....F.K....DIAIKTGLAISDIALAFELLN.FIKLRKNDGDIR-yq.....................................................
#=GR Q28ZY6_DROPS/767-955    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G0P680_CAEBE/393-586               .............................................................WRAPPGK.EIY......R.......K.............D............N.......I..SIF...E.VDGH..KQ.......................K..K..YCEAVSLLMRCFLSSITNF..WD.......T.DL.....FLFYVIT..H...N...D..D...V...G.................................FH..FAGCFS.K..........E....KN....D....Q....S.T.........N.NLNC...IVALPC..........Y.....Q.DK..G..........YGRF.LIDV..........S................Y.AL....S...R....K...E.....K.............nW..I..........Q.GPE...........LPFSELGEK..A.YASYWRMAVAKA.LA......G..F.K..D.DIeg.........................gdGI.S.....V.T....DITHATGINVHDVLATLEAQQ.WIKLEKSTNK---envg...................................................
B4Q083_DROYA/313-506               ............................................................l-RHPPGN.EIY......R.......K.............H............T.......I..SFF...E.IDGR..KN.......................K..V..YAQNLCLLAKLFLDHKTLY..YD.......T.DP.....FLFYVMT..E...F...D..S...R...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTMPP..........Y.....Q.RK..G..........YGKL.LIEF..........S................Y.EL....S...K....F...E.....G..............K..T..........G.SPE...........KPLSDLGLL..S.YRSYWAQTILEI.FI......S..Q.N..P.STdg........................ekpTI.T.....I.N....DICECTSIKKEDVISTLQNLN.LINYYKGQYIVCIn......................................................
#=GR B4Q083_DROYA/313-506    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B4GQF8_DROPE/169-361               ............................................................l-RHPPGE.EIY......R.......K.............D............T.......I..SFF...E.IDGR..RS.......................M..T..YAQNLCLLSKLFLDEKTLY..HN.......T.DP.....FLFYIMT..V...F...D..S...R...G.................................FH..MVGYFS.K..........E....KV....S....E....D.N.........-.NLAC...VLTLPP..........Y.....Q.RM..G..........YGRL.LIEF..........S................Y.EL....S...K....C...E.....G..............K..T..........G.TPE...........KPLSDLGLL..S.YRSFWAQAILDV.LI......K..Q.K..L.DVae........................dkiTI.S.....I.N....EISEKTSISTDDVVSTLTHLK.LIKYYKSRYIVCVk......................................................
#=GR B4GQF8_DROPE/169-361    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B1A1S4_DROME/1-83                  .............................................................-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...-...-..-...-...-.................................--..------.-..........-....--....-....-....-.-.........-.----...------..........-.....-.--..-..........----.----..........-................Y.LL....T...R....V...E.....G..............K..I..........G.SPE...........KPLSDLGLI..P.YRSYWKDVLLDY.LC......N..R.S..G.N-.............................TI.A.....I.K....DVSQETAIYSYDIVSTLQALG.MMKYWKGKHIV--lkk....................................................
B2R8A7_HUMAN/285-477               ............................................................l-RHPPGN.EIY......R.......K.............G............T.......I..SFF...E.IDGR..KN.......................K..S..YSQNLCLLAKCFLDHKTLY..YG.......T.DP.....FLFYVMT..E...Y...D..C...K...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKL.LIEF..........S................Y.EL....S...K....V...E.....G..............K..T..........G.TPE...........KPLSDLGLL..S.YRSYWSQTILEI.LM......G..L.K..S.ESge.........................rpQI.T.....I.N....EISEITSIKKEDVISTLQYLN.LINYYKGQYILT-ls.....................................................
#=GR B2R8A7_HUMAN/285-477    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A7E4U0_SCLS1/591-780               .............................................................WKHPPGD.EIY......R.......D.............G............K.......I..MIF...E.VDGR..KN.......................P..L..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYVMT..E...Y...D..E...L...G.................................CH..FVGYFS.K..........E....KR....P....S....S.L.........N.NVSC...ILVLPI..........H.....Q.RK..G..........YGHL.LIDF..........S................Y.LL....T...R....V...E.....R..............K..T..........G.SPE...........KPLSDMGLV..S.YRNYWRLVLCYY.LQ......K..F.E..P.SG.............................RIpS.....I.K....AISDEMGLTPDDVISGLDAMG.TL-----------vrdpmtgtyamk...........................................
#=GR A7E4U0_SCLS1/591-780    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q0CXQ0_ASPTN/74-225                ...........................................................rt--APPGT.KVY......D.......H.............G............G.......Y..AVW...E.LDGE..DH.......................K..L..YAQNLSLFAKLFLDHKSVF..FD.......V.AS.....FLYYLLT..F...T...D..P...T...Dp..............................dnYY..ILGFFS.K..........E....KL....S....W....D.A.........N.NLAC...ILVFPP..........Y.....Q.HK..Q..........LGKL.LMGV..........S................Y.KL....S...S....W...E.....Kd...........ggL..I..........G.GPE...........KPLSEMGRK..S.YTRFWKERIARI.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------sewrr..................................................
#=GR Q0CXQ0_ASPTN/74-225     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H3CD29_TETNG/574-761               .............................................................WFHPPAN.EIY......R.......K.............N............D.......L..SVF...E.VDGN..VS.......................K..L..FCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYILT..K...N...D..E...K...G.................................CH..LVGYFS.K..........E....KL....C....Q....Q.K.........Y.NVSC...IMIMPQ..........Y.....Q.RQ..G..........FGRF.LIDF..........S................Y.LL....T...R....Q...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YLAYWKSVILEY.LY......K..H.P..D.K-.............................HI.S.....V.K....GISRATGMCPHDIASTLQQLG.MIDRQDGR-----ivlirr.................................................
#=GR H3CD29_TETNG/574-761    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A1CK57_ASPCL/76-293                ...........................................................rt--TPPGP.KIY......E.......Q.............G............G.......Y..AVW...E.VDGE..EN.......................K..L..YAQNLSLFAKLFLDHKSVF..FD.......V.AT.....FLYYILT..F...T...D..P...Q...Dp..............................dnYH..ILGFFS.K..........E....KL....S....W....D.A.........N.NLAC...ILIFPP..........Y.....Q.HK..Q..........LGKL.LMGI..........S................Y.KI....S...A....W...Ee..dgG..............F..I..........G.GPE...........KPLSEMGAR..S.YSRFWQERIERR.LL......S..E.N..T.DDadcdgspeqed......tgkvarkrpssiFM.S.....V.R....EIGQATGMLTEDVITALKGMS.VLQPET-------pskrrkvk...............................................
#=GR A1CK57_ASPCL/76-293     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F8MWF8_NEUT8/584-777               ............................................................a-KHPPGD.EIY......R.......H.............G............S.......I..SVF...E.VDGR..KN.......................P..V..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYVLC..E...Y...D..Q...Y...G.................................YH..FVGYFS.K..........E....KR....A....S....S.Q.........N.NVSC...ILTLPI..........H.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...R....V...E.....Q..............K..T..........G.SPE...........KPLSDMGLV..S.YRNYWRLVMCKY.LL......E..H.C..S.SDpk........................ekkGL.S.....I.K....KISDDTGLTPDDVISSLEGLR.CLVRDPQTQ----lyafr..................................................
#=GR F8MWF8_NEUT8/584-777    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B3MDW4_DROAN/762-950               .............................................................WKQPPGT.EIF......R.......Q.............G............N.......I..SVF...E.VDGN..VN.......................K..I..YCQNLCLLAKFFLDHKTLY..YD.......V.EP.....FLFYILT..K...N...D..Q...S...G.................................CH..LVGYFS.K..........E....KH....C....T....Q.K.........Y.NVSC...ILTMPQ..........Y.....Q.RQ..G..........YGRF.LIDF..........S................Y.LL....S...R....E...E.....G..............Q..L..........G.TPE...........KPLSDLGRL..S.YFSYWKSVVLEY.LY......K..Y.R..N.QK.............................KI.T.....F.K....DIAIKTGLAISDIALAFELLN.FIKLRKNDGDIR-yq.....................................................
#=GR B3MDW4_DROAN/762-950    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F1MP98_BOVIN/232-418               .............................................................WRQPPGK.EIY......R.......K.............S............N.......I..SVY...E.VDGK..DH.......................K..I..YCQNLCLLAKLFLDHKTLY..FD.......V.EP.....FVFYILT..E...V...D..R...Q...G.................................AH..IVGYFS.K..........E....KE....S....P....D.G.........N.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKF.LIAF..........S................Y.EL....S...K....L...E.....S..............T..V..........G.SPE...........KPLSDLGKL..S.YRSYWSWVLLEI.LR......D..F.R..G.--.............................TL.S.....I.K....DLSQMTSITQNDIISTLQSLN.MVKYWKGQHVICVt......................................................
#=GR F1MP98_BOVIN/232-418    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F1RRK3_PIG/233-258                 ............................................................l-RHPPGN.EIY......R.......K.............G............T.......I..SFF...E.IDGR..KN.......................K..-..-------------------..--.......-.--.....-------..-...-...-..-...-...-.................................--..------.-..........-....--....-....-....-.-.........-.----...------..........-.....-.--..-..........----.----..........-................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------.......................................................
D2A012_TRICA/234-427               ............................................................l-RHPPGN.EIY......R.......K.............E............N.......V..SFF...E.IDGR..KN.......................K..V..YAQNLCLLAKLFLDHKTLY..YD.......T.DP.....FLFYVMT..I...F...D..N...R...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........F.NVAC...ILTMPP..........Y.....Q.RK..G..........YGKL.LIEF..........S................Y.EL....S...K....F...E.....G..............K..T..........G.SPE...........KPLSDLGLL..S.YRSYWAQAILEI.LI......S..M.K..P.VGdn........................ekpQI.T.....I.N....EICELTSIKKEDVISTLQNLN.LINYYKGQYIITLn......................................................
#=GR D2A012_TRICA/234-427    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E3K100_PUCGT/340-529               ............................................................l-LHPPGN.EIY......R.......A.............E............E.......I..HFF...E.IDGR..RQ.......................K..T..WCRNLSLLSKCFLDHKTLY..YD.......V.DP.....FLYYVMC..Q...R...D..S...N...G.................................LH..LIGYFS.K..........E....KE....S....A....E.N.........Y.NVAC...ILTLPQ..........Y.....Q.RL..G..........FGKL.LIEF..........S................Y.EL....S...K....K...E.....G..............K..L..........G.SPE...........KPLSDLGLL..S.YRAYWEETIVGF.IL......D.cH.Q..K.NE.............................GV.S.....I.D....EIAQKTAIVHSDVMHVCQTLQ.LLKYRNKQHIICLs......................................................
#=GR E3K100_PUCGT/340-529    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E9APK8_LEIMU/276-465               ............................................................l-RHPPGN.EIY......R.......D.............Pv..........rR.......L..VVL...E.LDGS..LE.......................P..T..FCEHLALLSKLFLEHKALD..HD.......M.TP.....FLFYVLC..S...V...E..T...H...G.................................LQ..VLGYFS.K..........E....KQ....T....P....E.P.........Y.NLSC...ILVLPQ..........Y.....Q.SR..G..........IGRF.LIEL..........S................Y.EL....S...R....R...E.....G..............K..V..........G.TPE...........KPLSDLGEK..L.YLSYWADSVTMA.IA......R.aM.E..E.GH.............................CV.S.....V.D....YLVQATAMIQADVIRALQHQK.LLN----------ghqltised..............................................
#=GR E9APK8_LEIMU/276-465    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A5PLL3_HUMAN/562-749               .............................................................WFHPPAN.EIY......R.......K.............N............N.......I..SVF...E.VDGN..VS.......................T..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..Q...N...D..V...K...G.................................CH..LVGYFS.K..........E....KH....C....Q....Q.K.........Y.NVSC...IMILPQ..........Y.....Q.RK..G..........YGRF.LIDF..........S................Y.LL....S...K....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YMAYWKSVILEC.LY......H..Q.N..D.-K.............................QI.S.....I.K....KLSKLTGICPQDITSTLHHLR.MLDFRSDQFVII-rr.....................................................
#=GR A5PLL3_HUMAN/562-749    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
I1QCE3_ORYGL/232-418               ............................................................l-KHPPGD.EIY......R.......S.............G............T.......L..SMF...E.VDGK..KN.......................K..V..YGQNLCYLAKLFLDHKTLY..YD.......V.DL.....FLFYVLC..E...C...D..D...R...G.................................CH..MVGYFS.K..........E....KH....S....E....E.S.........Y.NLAC...ILTLPP..........Y.....Q.RK..G..........YGKF.LIAF..........S................Y.EL....S...K....K...E.....G..............K..V..........G.TPE...........RPLSDLGLL..S.YRGYWTRVLLEI.LK......K..H.K..S.--.............................NI.S.....I.K....ELSDMTAIKADDILSTLQSLD.LIQYRKGQHVICAd......................................................
#=GR I1QCE3_ORYGL/232-418    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F2PK11_TRIEC/270-452               ............................................................l-LHPPGN.EIY......R.......D.............D............H.......V..SFF...E.VDGR..RQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMT..T...R...D..A...N...G.................................CH..LVGYFS.K..........E....KE....S....A....E.G.........Y.NVAC...ILTLPQ..........Y.....Q.RR..G..........FGRL.LIAF..........S................Y.EL....S...K....R...E.....G..............K..L..........G.SPE...........KPLSDLGLL..S.YRQYWRETLVEL.LV......E..P.G..R.D-.............................AI.S.....E.S....ELATLSAMTEKDVHETLVVLG.LLRYNV-------spr....................................................
#=GR F2PK11_TRIEC/270-452    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B1H0Y6_XENTR/277-469               ............................................................l-RHPPGN.EIY......R.......K.............G............T.......I..SFF...E.IDGR..KN.......................K..S..YSQNLCLLAKCFLDHKTLY..YD.......T.DP.....FLFYIMT..E...Y...D..C...K...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKL.LIEF..........S................Y.EL....S...K....V...E.....G..............K..T..........G.TLE...........KPLSDLGLL..S.YRSYWSQTILEI.LM......E..L.K..T.ETge.........................rpQI.T.....I.N....EISEITSIKKEDVISTLQYLN.LINYYKGQYILT-ls.....................................................
#=GR B1H0Y6_XENTR/277-469    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H3A8L0_LATCH/282-465               .............................................................WRQPPGK.EIY......R.......K.............S............N.......I..SVY...E.VDGR..DH.......................K..I..YCQNLCLLAKLFLDHKTLY..FD.......V.EP.....FVFYILT..E...V...D..R...Y...G.................................AH..IVGYFS.K..........E....KE....S....P....D.G.........N.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKF.LIAF..........S...............kY.TL....H...V....R...S.....G..............A..T..........P.PPV...........GPTSEAQNHtaS.CRAYDFK-----.--......-..L.P..I.GQ.............................VI.I.....F.F....NSSLMTSITQNDIISTLQSLN.MVKYWKGQHVICVt......................................................
#=GR H3A8L0_LATCH/282-465    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E9NMQ9_DROIM/87-213                ............................................................r-RQPPGE.EIY......R.......K.............G............T.......I..SIF...E.VNGK..KE.......................P..L..YCQLLCLMAKLFLDHKGLF..FD.......M.DP.....FFFYVLC..E...I...D..K...E...G.................................SH..IVGYFS.K..........E....KR....S....Y....N.-.........-.NVAC...ILVLPP..........H.....Q.RK..G..........YGKL.LIAF..........S................Y.VL....S...R....K...E.....G..............I..I..........G.SPE...........IPLSDLGRL..S.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------.......................................................
#=GR E9NMQ9_DROIM/87-213     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F2R0A6_PICP7/239-425               ............................................................l-RHPPGN.EIY......R.......D.............D............V.......V..SFF...E.IDGR..RQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMT..I...R...D..D...L...G.................................HH..LVGYFS.K..........E....KE....S....A....D.N.........Y.NVAC...ILTLPQ..........Y.....Q.RH..G..........YGKL.LIQF..........S................Y.EL....S...K....T...E.....G..............K..V..........G.SPE...........KPLSDLGLL..S.YRAYWADTIVKL.LM......E..N.G..T.E-.............................-T.T.....I.D....EISAQTSMTTTDILHTLQTLN.MLKYYKGQHIICLt......................................................
#=GR F2R0A6_PICP7/239-425    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A4HGT1_LEIBR/150-258               ...........................................................rl--RPPGD.EVY......R.......D.............E............Mr.....gL..FLF...K.INGS..QH.......................V..T..YCRHLFLIGKSFLENKLAG..HD.......V.HS.....YYFYVLC..L...H...H..R...Y...Fphyv........................sdpsaMY..FAGFFT.W..........E....KH....V....-....S.E.........Y.NLAC...IVTLPC..........F.....G.RR..-..........----.----..........-................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------tsrq...................................................
#=GR A4HGT1_LEIBR/150-258    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F1NT94_CHICK/68-255                .............................................................WFHPPAN.EIY......R.......K.............N............N.......I..SVF...E.VDGN..VS.......................T..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..Q...N...D..V...K...G.................................CH..LVGYFS.K..........E....KH....C....Q....Q.K.........Y.NVSC...IMILPQ..........Y.....Q.RK..G..........YGRF.LIDF..........S................Y.LL....S...K....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YMAYWKSVILEC.LY......H..Q.H..D.-K.............................QL.S.....I.K....KLSKLTGICPQDITSTLHHLR.MLDFRSDQFVII-rr.....................................................
#=GR F1NT94_CHICK/68-255     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B4L1W3_DROMO/666-854               ............................................................v-RRPPGK.EIY......R.......K.............N............T.......I..SIF...E.VNGK..EQ.......................P..L..YCQLLCLMAKLFLDHKVLY..FD.......M.DP.....FYFYVLC..E...T...D..K...R...G.................................CH..IVGYFS.K..........E....KK....S....M....D.N.........N.NVAC...ILVLPP..........H.....Q.RK..G..........YGKL.LIAF..........S................Y.EL....S...R....K...E.....G..............V..I..........G.SPE...........KPLSDLGRL..S.YRSYWAYTLLEL.MK......G..R.C..S.AE.............................QT.T.....I.K....ELSEASGITHDDIIYTLQSMK.MIKYWKGQNVICVt......................................................
#=GR B4L1W3_DROMO/666-854    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H9JLW6_BOMMO/563-636               .............................................................WRHPPGD.EVY......R.......K.............D............D.......L..SVW...Q.VDGR..KH.......................K..Q..YCQQLCLLAKFFLDHKTLY..YD.......V.EP.....FLFYVMT..N...A...D..S...E...G.................................CH..IVGYFS.K..........-....--....-....-....-.-.........-.----...------..........-.....-.--..-..........----.----..........-................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------f......................................................
#=GR H9JLW6_BOMMO/563-636    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B1A1N4_DROME/1-83                  .............................................................-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...-...-..-...-...-.................................--..------.-..........-....--....-....-....-.-.........-.----...------..........-.....-.--..-..........----.----..........-................Y.LL....T...R....V...E.....G..............K..I..........G.SPE...........KPLSDLGLI..S.YRSYWKDVLLDY.LC......N..R.S..G.N-.............................TI.A.....I.K....DVSQETAIYSYDIVSTLQALG.MMKYWKGKHIV--lxk....................................................
#=GR C1GCV7_PARBD/77-228     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A1CWJ7_NEOFI/534-719               ............................................................a-KHPPGD.EIY......R.......D.............G............S.......I..SIF...E.VDGR..KN.......................P..V..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYVMT..E...F...D..D...L...G.................................CH..FVGYFS.K..........E....KR....P....S....S.A.........N.NVSC...ILTLPI..........H.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...R....I...E.....G..............K..T..........G.SPE...........KPLSDMGLV..S.YRNYWRLILSYQ.LR......N..Q.K..T.P-.............................-I.S.....I.A....ELSERTGMTADDVVSGLEGLR.AL-----------vrdpitktyal............................................
#=GR A1CWJ7_NEOFI/534-719    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G7X848_ASPKW/536-722               ............................................................a-KHPPGD.EIY......R.......E.............G............S.......I..SIF...E.VDGR..KN.......................P..V..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYVMT..E...F...D..D...L...G.................................CH..FVGYFS.K..........E....KR....P....S....S.A.........N.NVSC...ILTLPI..........H.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...R....I...E.....G..............K..T..........G.SPE...........KPLSDMGLV..S.YRNYWRLILSYQ.LR......S..Q.R..T.P-.............................-L.S.....I.T....ELSERTGMTADDIVSGLEALR.ALVRD--------pvtktyalr..............................................
#=GR G7X848_ASPKW/536-722    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B8LW12_TALSN/525-711               ............................................................a-KHPPGD.EIY......R.......D.............G............S.......V..SIY...E.VDGR..KN.......................P..V..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYVMT..E...Y...D..E...L...G.................................CH..FVGYFS.K..........E....KR....P....S....S.S.........N.NVSC...ILTLPI..........H.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...R....V...E.....K..............K..T..........G.SPE...........KPLSDMGLV..S.YRNYWRLVLSYQ.LR......N..Q.K..T.P-.............................-V.S.....I.A....ELSERTGMTADDIVSGLEGLR.ALVR---------dpvtktyalr.............................................
#=GR B8LW12_TALSN/525-711    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B9Q3K5_TOXGO/849-1039              ............................................................l-RHPPGD.EIY......R.......E.............G............R.......L..SVF...E.VDGS..VA.......................R..V..YSENLCFLAKLFLDHKTLQ..YD.......V.EP.....FLFYVLT..E...V...D..R...T...G.................................CH..LIGYFS.K..........E....KI....S....L....Q.A.........Y.NLAC...ILTMPQ..........H.....Q.RK..G..........YGRF.LISF..........S................Y.LL....S...L....R...E.....K..............K..K..........G.GPE...........RPLSDLGRL..S.YIGWWTWCLLTH.ME......S..D.A..Q.KRr...........................rKI.S.....I.E....DLVRNTAVREEDIQRTLEEIG.VLRYVQGHHLL--llh....................................................
#=GR B9Q3K5_TOXGO/849-1039   pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
D4DHH2_TRIVH/312-499               ............................................................l-LHPPGN.EIY......R.......D.............D............H.......V..SFF...E.VDGR..RQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMT..T...R...D..A...N...G.................................CH..LVGYFS.K..........E....KE....S....A....E.G.........Y.NVAC...ILTLPQ..........Y.....Q.RR..G..........FGRL.LIAF..........S................Y.EL....S...K....R...E.....G..............K..L..........G.SPE...........KPLSDLGLL..S.YRQYWRETLVEL.LV......E..P.G..R.D-.............................AI.S.....E.S....ELATLSAMTEKDVHETLVVLG.LLRYNKGNWVL--vlt....................................................
#=GR D4DHH2_TRIVH/312-499    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H2UIL3_TAKRU/331-518               .............................................................WKHPPGD.EIY......R.......K.............G............N.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LVGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LC......N..F.Q..G.K-.............................DI.S.....I.K....EISQETAVNPVDIVSTLQSLQ.MLKYWKGKHLI--lkr....................................................
#=GR H2UIL3_TAKRU/331-518    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B0WEL5_CULQU/260-445               ............................................................h-RQPPGN.EIY......R.......K.............G............T.......V..SIF...E.IDGK..DH.......................R..F..YCQTLCLMAKLFLDHKTLY..YD.......V.DP.....FFFYVLC..E...I...D..K...E...G.................................QH..IVGYFS.K..........E....KE....S....P....E.G.........N.NVAC...ILILPP..........Y.....Q.RK..G..........YGKL.LIAF..........S................Y.EL....S...R....R...E.....G..............I..I..........G.SPE...........KPLSDLGRL..S.YRSYWAYTLLEL.MK......E..Y.R..T.--.............................-T.T.....I.K....ELSELSGITQDDIVYTLQSMK.MVKYWKGQHVICVt......................................................
#=GR B0WEL5_CULQU/260-445    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
C3YGL3_BRAFL/220-408               .............................................................WRHPPGD.EIY......R.......K.............G............S.......I..SVF...E.VDGQ..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..G...T...G.................................CH..VVGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTLPQ..........Y.....M.RQ..G..........FGKM.LIDF..........S................Y.LL....T...R....V...E.....E..............K..T..........G.SPE...........RPLSDLGLI..S.YRSYWKGVLLKY.LH......E..H.K..H.DR.............................EI.S.....I.K....DLSTETGVNPYDIVSTLQAMS.MLKYWKGKHIV--lkr....................................................
#=GR C3YGL3_BRAFL/220-408    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H9JG69_BOMMO/247-440               ............................................................l-KHPPGN.EIY......R.......K.............G............S.......I..SFF...E.IDGR..KN.......................K..C..YAQNLCLLAKLFLDHKTLY..YD.......T.DP.....FLFYVMT..E...F...D..S...R...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........Y.....Q.RK..G..........YGKL.LIEF..........S................Y.EL....S...K....F...E.....G..............K..T..........G.SPE...........KPLSDLGLL..S.YRSYWAQTILDI.LL......H..I.K..P.VGdn........................ekpVI.T.....I.N....EICELTSIKKEDVISTLQNLN.LINYYKGQYIISVn......................................................
#=GR H9JG69_BOMMO/247-440    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A5DHG3_PICGU/121-318               .........................................................fpqt-----GR.LVY......R.......Dp...........iS............K.......Y..VIK...Q.VRGY..RH.......................Q..L..FCQNLCLFAKLFLDDKSVY..YN.......V.DA.....YEFFIIY..G...H...P..D...T...Gsei...........................drnMV..PMGYFS.H..........E....LG....A...wD....N.D.........N.NLAC...ICVFPP..........F.....Q.NR..R..........LGTL.LIDL..........S................Y.EV....P...R....A...H.....G..............Q..Se........pT.GPE...........YPLSPFGRA..T.YLRYWAKRLAHI.LS.....cS..L.Q..R.KT.............................SF.T.....L.Q....DLSDLTGFRKEDILLTLEFMQ.VLGKKV-------vsqnge.................................................
#=GR A5DHG3_PICGU/121-318    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E1Z613_CHLVA/65-255                ............................................................l-RHPPGD.EIY......R.......Spp.........ppS............N.......D..PMF...E.VDGK..KS.......................K..V..YCQNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYVLC..E...K...D..A...L...G.................................YH..IVGYFS.K..........E....KN....S....A....E.G.........N.NLAC...ILTLPP..........Y.....Q.RK..G..........YGRF.LIAF..........S................Y.EL....S...K....K...E.....G..............R..V..........G.SPE...........RPLSDLGAV..S.YRSYWTREILEV.LK......D..H.K..A.S-.............................-L.S.....I.K....DISDKTAIRTDDVVKTLESLS.LIKYWKGDHIISVt......................................................
#=GR E1Z613_CHLVA/65-255     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H3HBV1_PHYRM/202-389               ............................................................n-RHPPGN.EIY......R.......H.............E............N.......L..SVF...E.VDGA..IS.......................K..V..YCQNLCYLAKLFLDHKTLY..YD.......V.DP.....FLFYIIC..E...V...D..S...R...G.................................FH..PVGYFS.K..........E....KY....S....E....L.G.........Y.NLAC...ILTFPC..........H.....Q.RK..G..........YGHF.IIQF..........S................Y.EL....S...K....K...E.....E..............K..V..........G.SPE...........KPLSDLGLV..S.YRSYWTRELLRI.LK......D..Y.P..E.K-.............................EV.S.....I.M....ELTRMTSIKNEDIIATLQHLN.MIKYLGGQYVY--vvp....................................................
#=GR H3HBV1_PHYRM/202-389    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B3RUC0_TRIAD/447-635               ............................................................w-LHPPAN.EIY......R.......K.............H............E.......L..SVF...E.VDGM..TN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..K...N...D..E...Y...G.................................CH..LVGYFS.K..........E....KS....C....Q....Q.R.........Y.NVSC...IMTLPP..........Y.....Q.KQ..G..........FGRF.LIDF..........S................Y.LL....S...R....V...E.....G..............Q..P..........G.TPE...........KPLSPLGMI..S.YHRYWQSAILEY.FH......Y..H.S..N.DE.............................HV.T.....I.K....DISRASGIDPHDIAAMLEYMN.MIQRSDEGFVI--ivd....................................................
#=GR B3RUC0_TRIAD/447-635    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B4LPD8_DROVI/562-750               .............................................................WKQPPGT.EIF......R.......Q.............G............D.......I..SVF...E.VDGN..VN.......................K..I..YCQNLCLLAKFFLDHKTLY..YD.......V.EP.....FLFYILT..K...N...D..Q...V...G.................................CH..LVGYFS.K..........E....KH....C....S....Q.K.........Y.NVSC...ILTLPQ..........Y.....Q.RQ..G..........YGRF.LIDF..........S................Y.LL....S...R....E...E.....G..............Q..L..........G.TPE...........KPLSDLGRL..S.YFSYWKSVVLEY.LY......K..Y.R..N.NQ.............................TI.T.....F.K....DIAIKTGLAVSDIALAFELLN.FIKLRKNDGDI--rfq....................................................
#=GR B4LPD8_DROVI/562-750    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E1FSW2_LOALO/394-582               .............................................................WKHPPGN.EIY......R.......E.............G............R.......L..SFW...E.IDGI..DE.......................I..A..YCRRLCLLSKLFLFSKTLH..HE.......V.ET.....FLFYILT..E...Y...T..A...E...G.................................YV..LLGYFS.K..........E....KN....P....S....K.N.........N.NLSC...LLTLPS..........S.....Q.RT..G..........YGKF.LIDL..........S................Y.KL....S...L....R...E.....R..............K..I..........G.GPE...........HPLSDMGLI..T.YRSYWKAVIICY.IR......K..R.R..P.MN.............................SF.S.....I.K....EMSNETGIHSSDIINTMLENK.MLKYRDGNYLI--nkr....................................................
#=GR E1FSW2_LOALO/394-582    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
I1GBI6_AMPQE/209-402               ............................................................i-FHPPGN.EIY......R.......K.............D............T.......I..SFF...E.IDGR..KN.......................K..A..YSQNLCLLAKLFLDHKTLY..YD.......T.DP.....FLFYIMT..E...Y...D..E...H...G.................................FH..IVGYFS.K..........E....KE....S....S....E.D.........Y.NVAC...ILTLPC..........Y.....Q.RK..G..........YGKL.LIEF..........S................Y.EL....S...K....I...E.....G..............K..T..........G.SPE...........KPLSDLGLL..S.YRSYWTQTLLEV.LI......N..M.K..N.QEde........................tipFV.T.....I.N....ELCEQTSIRKDDVTSTLQYHN.LIHYYKGQYVISLs......................................................
#=GR I1GBI6_AMPQE/209-402    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G1MT57_MELGA/392-579               .............................................................WKHPPGD.EIY......R.......K.............G............S.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LIGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LH......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQALQ.MLKYWKGKHLV--lkr....................................................
#=GR G1MT57_MELGA/392-579    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E7R2K3_PICAD/234-421               ............................................................l-SHPPGN.EIY......R.......D.............D............Y.......V..SFF...E.IDGR..KQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMT..R...R...D..D...K...G.................................HH..LVGYFS.K..........E....KE....S....A....D.N.........Y.NVAC...ILTLPQ..........Y.....Q.RH..G..........YGKL.LIQF..........S................Y.EL....S...K....I...E.....G..............K..V..........G.SPE...........KPLSDLGLL..S.YRAYWAETICAL.LV......E..N.G..T.-T.............................DI.S.....I.D....EISQLTSMTTTDILHTLQTLN.MLRYYKGQHIIVLt......................................................
#=GR E7R2K3_PICAD/234-421    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q7S627_NEUCR/584-777               ............................................................a-KHPPGD.EIY......R.......H.............G............S.......I..SVF...E.VDGR..KN.......................P..V..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYVLC..E...Y...D..Q...Y...G.................................YH..FVGYFS.K..........E....KR....A....S....S.Q.........N.NVSC...ILTLPI..........H.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...R....V...E.....Q..............K..T..........G.SPE...........KPLSDMGLV..S.YRNYWRLVMCKY.LL......E..H.C..S.GDpk........................ekkGL.S.....I.K....KISDDTGLTPDDVISSLEGLR.CLVRDPQTQ----lyafr..................................................
#=GR Q7S627_NEUCR/584-777    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F2U7H2_SALS5/229-415               ............................................................r-RCPPGR.EIY......R.......K.............H............H.......I..SMY...E.IDGA..QE.......................K..L..YCQNLCLFAKLFLDRKTLY..FD.......V.GP.....FMFYVLT..H...V...D..D...T...G.................................AH..VVGYFS.K..........E....KE....S....H....E.N.........N.NLAC...ICTFPP..........Y.....Q.QR..G..........YGRF.LIEF..........S................Y.VL....S...R....L...E.....G..............R..I..........G.GPE...........KPLSDLGLI..G.YQSYWAWELLTA.LH......K..T.D..E.P-.............................-V.T.....T.A....QLSARTGITQDDVVATLQWLD.LIKYWRGHHTICYt......................................................
#=GR F2U7H2_SALS5/229-415    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q7YYD7_CRYPV/301-496               .......................................................qlrhpp-------.---......-.......-.............-............-.......-..-VF...E.IDGA..LT.......................R..G..YAENLCYLAKLFLDHKTLQ..YD.......V.EP.....FLFYIVT..E...V...D..E...E...G.................................CH..IVGYFS.K..........E....KV....S....L....L.H.........Y.NLAC...ILTLPC..........Y.....Q.RK..G..........YGKL.LVDL..........S................Y.KL....S...L....K...E.....G..............K..W..........G.HPE...........RPLSDLGRA..I.YNNWWAHRISEY.LL......E..Y.F..K.QNkicerggs............kqplqvsnySK.F.....I.D....NVVRSTGIRREDVIRILEENG.IMRNIKDQHYIF-cn.....................................................
#=GR Q7YYD7_CRYPV/301-496    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A1DFX1_NEOFI/280-467               ............................................................l-VHPPGN.EIY......R.......D.............D............Y.......I..SFF...E.VDGR..RQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMC..T...R...D..E...T...G.................................CH..LVGYFS.K..........E....KD....S....A....E.G.........Y.NLAC...ILTLPQ..........Y.....Q.RR..G..........FGRL.LISF..........S................Y.EL....S...K....R...E.....G..............K..L..........G.SPE...........KPLSDLGLL..G.YRQYWRETLVEI.LM......E..P.G..R.E-.............................TV.S.....E.N....ELALLTSMTEKDVHETLVVLN.MLRYYKGNWVIV-lt.....................................................
#=GR A1DFX1_NEOFI/280-467    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G8YRS2_PICSO/124-327               ........................................................rypli-----GR.LVY......R.......D.............D............K.......N..GIFi.kK.VQGH..KH.......................K..L..FCQCMCLFSKLFLDDKSIY..YA.......V.DT.....FDFYVVY..G...R..cD..D...A...Sqgas.........................dtpqYI..PNGFFS.K..........E....KV....P....W....DpS.........N.NLAC...ICVFPP..........F.....Q.RR..S..........LGSL.MIEL..........S................Y.YL....A...N....T...V.....D..............HlpA..........S.GPE...........FPLSKFGKI..C.YLRFWSKKLAAIiLT......E..L.S..S.VS.............................AF.D.....L.A....SLSDLTGFRKEDILLTLEYMG.VIYTQEHSG----ktslh..................................................
#=GR G8YRS2_PICSO/124-327    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A5DEH1_PICGU/217-418               ............................................................n-HHPPGT.EIY......R.......Dp...........eQ............R.......V..AFW...E.VDGR..KN.......................I..S..YCQNLCLLAKLFLNSKTLY..YD.......V.EP.....FIFYILT..E...I...D..A...S...Dp..............................stYH..FVGYFS.K..........E....KL....N....N....S.D.........Y.NVSC...ILTLPV..........Y.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....S...R....K...E.....F..............K..F..........G.TPE...........KPLSDLGLM..S.YRNYWKITIAHQ.LK......F..L.W..E.KYlknk.....................sdyvTI.S.....V.E....NLCKLTGMIPSDVVVGLEQLH.ALVK---------nfntnsygia.............................................
#=GR A5DEH1_PICGU/217-418    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G3W6G7_SARHA/467-654               .............................................................WFHPPAN.EIY......R.......R.............K............D.......L..SVF...E.VDGN..VS.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..K...N...D..E...K...G.................................CH..LVGYFS.K..........E....KL....C....Q....Q.K.........Y.NVSC...IMIMPQ..........Y.....Q.RQ..G..........FGRF.LIDF..........S................Y.LL....S...R....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YLAYWKSVILEY.LY......Y..H.H..E.K-.............................HI.S.....I.K....GISRATGMCPHDIATTLQHLR.MIDKREEKFVII-rr.....................................................
#=GR G3W6G7_SARHA/467-654    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B9WD26_CANDC/254-414               ............................................................m-KHPPGN.EIY......R.......D.............S............K.......V..SFW...E.IDGR..KQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYIMT..I...K...S..D...Q...G.................................HH..VVGYFS.K..........E....KE....S....A....D.G.........Y.NVAC...ILTLPC..........Y.....Q.KR..G..........FGKL.LIQF..........S................Y.ML....T...K....V...E.....R..............K..V..........G.SPE...........KPLSDLGLL..S.YRAYWTDTLVKL.LV......E..R.N..S.P-.............................--.-.....-.-....---------------------.-------------alfrknnpqleyd..........................................
#=GR B9WD26_CANDC/254-414    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B7Q8U7_IXOSC/389-556               .............................................................WVHPPAT.EIY......R.......K.............G............E.......V..SVF...E.VDGN..VS.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..R...N...D..S...K...G.................................CH..LVGYFS.K..........E....KH....C....Q....Q.R.........Y.NVSC...IMTMPQ..........Y.....Q.RQ..G..........FGRF.LIDF..........S................Y.LL....S...R....K...E.....G..............L..A..........G.TPE...........KPLSDLGRI..S.YVSYWKSILLEF.LD......S..Y.K..D.N-.............................QI.S.....I.Q....SPQ------------------.-------------hvqeasnrkeae...........................................
#=GR B7Q8U7_IXOSC/389-556    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F2PSP4_TRIEC/503-629               ..................................................yinfggyeiet-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...-...-..-...-...-.................................--..-----C.K..........E....KR....P....S....S.S.........N.NVSC...ILTLPI..........H.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...R....L...E.....G..............R..T..........G.SPE...........KPLSDMGLV..S.YRNYWRLVLCYK.FR......D..K.K..S.P-.............................-T.S.....I.T....AISEQTGMTPDDVISALEGLS.ALVR---------dpvtktyalr.............................................
C5K278_AJEDS/287-473               ............................................................l-VHPPGN.EIY......R.......D.............D............H.......V..SFF...E.VDGR..RQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMT..T...R...D..E...H...G.................................CH..LVGYFS.K..........E....KE....S....A....E.G.........Y.NVAC...ILTLPQ..........Y.....Q.RR..G..........FGRL.LIAF..........S................Y.EL....S...K....R...E.....N..............K..L..........G.SPE...........KPLSDLGLL..G.YRQYWRETIVDI.LM......E..P.G..R.E-.............................SI.S.....E.S....ELASLSAMTEKDVHETLVVLN.LLRYNVSRK----ldhr...................................................
#=GR C5K278_AJEDS/287-473    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F1RIR8_PIG/232-418                 .............................................................WRQPPGK.EIY......R.......K.............S............N.......I..SVY...E.VDGK..DH.......................K..I..YCQNLCLLAKLFLDHKTLY..FD.......V.EP.....FVFYILT..E...V...D..R...Q...G.................................AH..IVGYFS.K..........E....KE....S....P....D.G.........N.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKF.LIAF..........S................Y.EL....S...K....L...E.....S..............T..V..........G.SPE...........KPLSDLGKL..S.YRSYWSWVLLEI.LR......D..F.R..G.--.............................TL.S.....I.K....DLSQMTSITQNDIISTLQSLN.MVKYWKGQHVICVt......................................................
#=GR F1RIR8_PIG/232-418      pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
ESA1_YEAST/220-406                 ............................................................l-RHPPGN.EIY......R.......D.............D............Y.......V..SFF...E.IDGR..KQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMT..R...R...D..E...L...G.................................HH..LVGYFS.K..........E....KE....S....A....D.G.........Y.NVAC...ILTLPQ..........Y.....Q.RM..G..........YGKL.LIEF..........S................Y.EL....S...K....K...E.....N..............K..V..........G.SPE...........KPLSDLGLL..S.YRAYWSDTLITL.LV......E..H.Q..K.E-.............................-I.T.....I.D....EISSMTSMTTTDILHTAKTLN.ILRYYKGQHIIFLn......................................................
#=GR ESA1_YEAST/220-406      SS    ............................................................--SS-SSE.EEE......E.......-.............S............S.......E..EEE...E.EEGG..GS.......................H..H..HHHHHHHHHHTT-S--S-T..T-.......-.TT.....EEEEEEE..E...E...E..T...T...E.................................EE..EEEEEE.E..........E....SS....-....T....T.-.........E.EES-...EEE-GG..........G.....T.SS..S..........HHHH.HHHH..........H................H.HH....H...H....H...T.....T..............-..-..........B.EE-...........SS--HHHHH..H.HHHHHHHHHHHH.HH......H..T.-..S.E-.............................-E.E.....H.H....HHHHHH-B-HHHHHHHHHHTT.-EEEETTEEEEE--......................................................
#=GR ESA1_YEAST/220-406      AS    ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
#=GR ESA1_YEAST/220-406      sAS   ..........................................................................................................................................................................................................................................................................................................................................*...........................................................................................................................................................................................................................................................................................................................................
F6M9E3_9MUSC/84-212                ............................................................k-RKPPGR.EIY......R.......K.............G............T.......I..SIF...E.VNGK..EE.......................P..L..YCQLLCLMAKLFLDHKVLY..FD.......M.DP.....FYFYVLC..E...I...D..M...E...G.................................SH..IVGYFS.K..........E....KK....S....Q....D.N.........N.NVAC...ILVLPP..........H.....Q.RK..G..........YGKL.LIAF..........S................Y.EL....S...R....K...E.....G..............V..I..........G.SPE...........KPLSDLGRL..S.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------.......................................................
#=GR F6M9E3_9MUSC/84-212     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
#=GR D4D811_TRIVH/74-240     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E9PXP9_MOUSE/285-405               ............................................................l-RHPPGN.EIY......R.......K.............G............T.......I..SFF...E.IDGR..KN.......................K..S..YSQNLCLLAKCFLDHKTLY..YD.......T.DP.....FLFYVMT..E...Y...D..C...K...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKL.LIEF..........S...............eY.VL....P...D....Q...E.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------lagqacvg...............................................
#=GR E9PXP9_MOUSE/285-405    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G3QWY7_GORGO/390-577               .............................................................WKHPPGD.EIY......R.......K.............G............S.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LIGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LH......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQALQ.MLKYWKGKHLV--lkr....................................................
#=GR G3QWY7_GORGO/390-577    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F6UKV1_XENTR/332-519               .............................................................WKHPPGD.EIY......R.......K.............G............S.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...G...D..N...T...G.................................CH..LIGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....D..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LH......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQALQ.MLKYWKGKHLV--lkr....................................................
#=GR F6UKV1_XENTR/332-519    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B9QI24_TOXGO/246-429               ............................................................c-RHPPGN.EIY......R.......D.............K............D.......I..AMF...E.VDGN..HC.......................R..V..YCENLCFLSKLFLDHKTLR..HP.......V.SL.....FLFYVMT..E...I...D..D...K...G.................................YH..ITGYFS.K..........E....KY....S....-....-.K.........N.NVSC...ILTLPQ..........H.....Q.RK..G..........YGKF.LINF..........S................Y.AL....S...R....A...E.....R..............K..A..........G.TPE...........RPLSDLGKA..S.YIAFWTEAILAL.LE......R..N.E..G.--.............................RI.S.....V.Q....DLSRMTCIEQADILACLEHHG.VLKSK--------gecfflvl...............................................
#=GR B9QI24_TOXGO/246-429    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G3QAR2_GASAC/300-492               ............................................................l-RHPPGN.EIY......R.......K.............G............T.......I..SFF...E.IDGR..KN.......................K..T..YSQNLCLLAKCFLDHKTLY..YD.......T.DP.....FLFYVMT..E...Y...D..S...K...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKL.LIEF..........S................Y.EL....S...K....V...E.....G..............K..T..........G.TPE...........KPLSDLGLL..S.YRSYWSQTILEI.LM......D..L.K..P.DNge.........................rpQI.T.....I.N....EISEITSVKKEDVISTLQYLN.LINYYKGQYILT-ls.....................................................
#=GR G3QAR2_GASAC/300-492    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G0RWG0_HYPJQ/590-783               ............................................................a-KHPPGD.EIY......R.......H.............G............S.......V..SVF...E.VDGR..KN.......................P..V..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYVLC..E...Y...D..D...C...G.................................YH..FVGYFS.K..........E....KR....A....S....S.Q.........N.NVSC...ILTLPI..........H.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...K....V...E.....E..............K..T..........G.SPE...........KPLSDMGLV..S.YRNYWRLRLCRY.FI......E..T.M..K.DDqh........................kqtGL.S.....I.R....QISDDTGMTPDDVIAALEGLR.ALVRDPQTK----vyafr..................................................
#=GR G0RWG0_HYPJQ/590-783    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
#=GR C4JWA5_UNCRE/75-235     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B2RWN8_HUMAN/773-960               .............................................................WFHPPAN.EIY......R.......R.............K............D.......L..SVF...E.VDGN..MS.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..K...N...D..E...K...G.................................CH..LVGYFS.K..........E....KL....C....Q....Q.K.........Y.NVSC...IMIMPQ..........H.....Q.RQ..G..........FGRF.LIDF..........S................Y.LL....S...R....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YLAYWKSVILEY.LY......H..H.H..E.R-.............................HI.S.....I.K....AISRATGMCPHDIATTLQHLH.MIDKRDGRFVI--irr....................................................
#=GR B2RWN8_HUMAN/773-960    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q4E3G3_TRYCC/62-254                ..........................................................rfw---VPGD.EIY......Rc.....rR.............R............R.......F..VVF...E.IDGR..KMa.....................sV..P..YTRRIARLAKHFLEEKTTL..DD.......L.HF.....FAMVVLF..E...V...D..D...Y...G.................................YH..FVGYFS.K..........Ew..rKS....M....A....C.N.........N.SLSC...VMVLPP..........Y.....R.NK..G..........YGAF.LIEI..........S................Y.EM....G...R....I...E.....G..............I..P..........G.SPE...........RPLSAAGKK..V.FSRIWREEILQA.IF......S..L.N..E.KG............................lPL.T.....M.N....LLSWESGMAIEDVAVALHRLN.AVF----------fvnkhgpl...............................................
#=GR Q4E3G3_TRYCC/62-254     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
#=GR E0S903_ENCIT/95-272     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
I0Z823_9CHLO/166-355               ............................................................l-QHPPGD.EIY......R.......N.............Nt.........srN.......L..TSE...Q.VDGK..KE.......................K..Q..YCQNLCYLAKLFLDHKTLY..YD.......V.DL.....FLFYVLC..E...N...D..E...R...G.................................SH..IVGYFS.K..........E....KC....S....E....E.G.........Y.NLAC...ILTLPS..........Y.....Q.RK..G..........YGKF.LIAM..........S................Y.EL....S...K....I...E.....G..............K..V..........G.TPE...........RPLSDLGNV..S.YRGYWTRELLKV.LQ......V..R.E..G.--.............................SV.S.....I.K....ELSDITAIKTDDIISTLQHLN.LIQYQKGQHVICAa......................................................
#=GR I0Z823_9CHLO/166-355    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
C0NJW4_AJECG/548-734               ............................................................a-KHPPGD.EIY......R.......D.............G............S.......V..SVF...E.VDGR..KN.......................P..V..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYVMT..E...Y...D..E...L...G.................................CH..FVGYFS.K..........E....KR....P....S....S.S.........N.NVSC...ILTLPI..........H.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...R....V...E.....R..............K..T..........G.SPE...........KPLSDLGLV..S.YRNYWRLVLSYQ.LR......N..Q.K..S.P-.............................-V.S.....I.A....ELSERTGMTADDIVSGLEGLR.ALVRDPQT-----ktyalr.................................................
#=GR C0NJW4_AJECG/548-734    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A6ZMI7_YEAS7/126-314               ............................................................q-YRVPGK.IKY......K.......S.............P............E.......Y..TIR...R.VKGS..KY.......................Q..L..FCQCLCLFTKLYLDNKSMY..FK.......V.DH.....YEFYIVY..E...T...G..S...T...K.................................--..PMGFFS.K..........D....LV....S....Y....Q.Q.........N.NLAC...ILIFPP..........Y.....Q.RR..G..........LGLL.LIEF..........S................Y.KL....S...Q....L...E.....G..............V..I..........S.GPE...........VPLSPFGLI..G.YLKYWSQILCWH.LI......E..G.D..L.AHy...........................dKV.T.....L.E....DLSIVTGMRVNDVILTLKHLN.CIGENNQIYLQS-ln.....................................................
#=GR A6ZMI7_YEAS7/126-314    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E0VU52_PEDHC/717-907               .............................................................WRHPPAT.EIY......R.......C.............N............D.......L..SVF...E.VDGN..VN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..K...N...D..E...K...G.................................CH..LVGYFS.K..........E....KH....C....A....Q.K.........Y.NVSC...IMTMPQ..........Y.....Q.RQ..G..........YGRF.LIHF..........S................Y.LL....S...K....E...E.....G..............Q..P..........G.TPE...........KPLSDLGRV..S.YHAYWKSVILEY.LA......A..H.R..D.VGkd.........................nmQV.T.....I.D....AISKETGMYGHDIAATLQMMD.MICLIKV------sepaa..................................................
#=GR E0VU52_PEDHC/717-907    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E7Q9D0_YEASB/202-388               ............................................................l-RHPPGN.EIY......R.......D.............D............Y.......V..SFF...E.IDGR..KQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMT..R...R...D..E...L...G.................................HH..LVGYFS.K..........E....KE....S....A....D.G.........Y.NVAC...ILTLPQ..........Y.....Q.RM..G..........YGKL.LIEF..........S................Y.EL....S...K....K...E.....N..............K..V..........X.SPE...........KPLSDLGLL..S.YRAYWSDTLITL.LV......E..H.Q..K.E-.............................-I.T.....I.D....EISSMTSMTTTDILHTAKTLN.ILRYYKGQHIIFLn......................................................
#=GR E7Q9D0_YEASB/202-388    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E9NMR0_9MUSC/87-214                ............................................................k-RHPPGR.EIY......R.......K.............G............T.......I..SIF...E.VNGK..EE.......................P..L..YCQLLCLMAKLFLDHKGLF..FD.......M.DP.....FFFYVLC..E...I...D..M...E...G.................................SH..IVGYFS.K..........E....KW....Q....E....-.N.........N.NVAC...ILVLPP..........H.....Q.RK..G..........YGKL.LIAF..........S................Y.EL....S...R....K...E.....G..............V..I..........G.SPE...........KPLSDLGRL..S.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------.......................................................
#=GR E9NMR0_9MUSC/87-214     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F6SP03_MONDO/183-369               .............................................................WRQPPGK.EIY......R.......K.............N............N.......I..SVY...E.VDGK..DH.......................K..I..YCQNLCLLAKLFLDHKTLY..FD.......V.EP.....FVFYILT..E...V...D..R...Q...G.................................AH..IVGYFS.K..........E....KE....S....P....D.G.........N.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKF.LIAF..........S................Y.EL....S...K....L...E.....S..............T..V..........G.SPE...........KPLSDLGKL..S.YRSYWSWVLLEI.LR......D..F.R..G.--.............................TL.S.....I.K....DLSQMTSITQNDIISTLQSLN.MVKYWKGQHVICVt......................................................
#=GR F6SP03_MONDO/183-369    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
MOF_DROME/596-784                  ............................................................r-RRPPGR.EIY......R.......K.............G............N.......I..SIY...E.VNGK..EE.......................S..L..YCQLLCLMAKLFLDHKVLY..FD.......M.DP.....FLFYILC..E...T...D..K...E...G.................................SH..IVGYFS.K..........E....KK....S....L....E.N.........Y.NVAC...ILVLPP..........H.....Q.RK..G..........FGKL.LIAF..........S................Y.EL....S...R....K...E.....G..............V..I..........G.SPE...........KPLSDLGRL..S.YRSYWAYTLLEL.MK......T..R.C..A.PE.............................QI.T.....I.K....ELSEMSGITHDDIIYTLQSMK.MIKYWKGQNVICVt......................................................
#=GR MOF_DROME/596-784       pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
#=GR MOF_DROME/596-784       sAS   ..........................................................................................................................................................................................................................................................................................................................................*...........................................................................................................................................................................................................................................................................................................................................
G3RNG8_GORGO/232-418               .............................................................WRQPPGK.EIY......R.......K.............S............N.......I..SVY...E.VDGK..DH.......................K..I..YCQNLCLLAKLFLDHKTLY..FD.......V.EP.....FVFYILT..E...V...D..R...Q...G.................................AH..IVGYFS.K..........E....KE....S....P....D.G.........N.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKF.LIAF..........S................Y.EL....S...K....L...E.....S..............T..V..........G.SPE...........KPLSDLGKL..S.YRSYWSWVLLEI.LR......D..F.R..G.--.............................TL.S.....I.K....DLSQMTSITQNDIISTLQSLN.MVKYWKGQHVICVt......................................................
#=GR G3RNG8_GORGO/232-418    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E6RA41_CRYGW/402-562               ............................................................s-RHPPGD.EIY......R.......E.............G............A.......V..SVF...E.VDGR..KN.......................K..I..YCQNLCLLAKMFLDHKTLY..YD.......V.EP.....FLFYVMT..E...V...D..E...L...G.................................AR..FVGYFS.K..........E....KR....S....M....D.N.........-.NVSC...IMTLPV..........R.....Q.RK..G..........WGQL.LIDF..........S................Y.LL....S...K....K...E.....G..............R..T..........G.SPE...........KPLSGLGAV..S.YKSYWRFTVFKY.LL......N..A.I..S.--.............................--.-.....-.-....---------------------.-------------pssshtlelpripdv........................................
#=GR E6RA41_CRYGW/402-562    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F7HVC0_CALJA/773-959               .............................................................WFHPPAN.EIY......R.......R.............K............D.......L..SVF...E.VDGN..MS.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..K...N...D..E...K...G.................................CH..LVGYFS.K..........E....KL....C....Q....Q.K.........Y.NVSC...IMIMPQ..........H.....Q.RQ..G..........FGRF.LIDF..........S................Y.LL....S...R....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YLAYWKSVILEY.LY......H..H.H..E.R-.............................HI.S.....I.K....AISRA-GHVPHDIATTLQHLH.MIDKRDGRFVI--irr....................................................
#=GR F7HVC0_CALJA/773-959    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q4QGD7_LEIMA/354-472               .........................................................fdae-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...-...D..W...D...G.................................DA..VMGYFS.R..........L....KH....H....P....D.H.........-.TLSC...IVTLPM..........F.....Q.RT..R..........VATF.LLDV..........A................Y.WM....T...R....Q...R.....Q..............R..LcgcgfcgrsgG.AIS...........RPFSPHGQS..L.LLSYWRRALLRS.LA......E..V.A..-.--.............................--.-.....-.-....---------------------.-------------plhrrasrtaqpelrftlae...................................
F2UQ57_SALS5/306-394               ............................................................p-RHPPGD.EVY......R.......R.............G............K.......L..SLW...E.IDGG..KK.......................K..V..YCQNLCLLSKLFLESKTLW..RD.......V.QP.....FLFYVLT..E...W...D..D...T...G.................................AT..IVGYFS.K..........R....ES....H....-....-.-.........-.----...------..........-.....-.--..-..........----.----..........-................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------clnmdqpgqcmv...........................................
#=GR F2UQ57_SALS5/306-394    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B4JPK1_DROGR/146-339               ............................................................l-RHPPGN.EIY......R.......K.............D............T.......I..SFF...E.FDGS..RD.......................E..L..YARKLCLLTKLFLDHKSVD..VK.......L.SR.....FLFYVMT..E...S...D..S...R...G.................................FH..IVGYFS.K..........E....KH....S....D....N.D.........Y.NLSC...ILTLPP..........Y.....Q.RK..G..........YGKL.LIDF..........S................Y.QL....S...K....I...E.....G..............K..T..........G.CPE...........KPLSDLGLL..S.YRSYWSETILEL.LI......G..T.S..S.NKng........................erpSV.S.....I.N....DISERTSIRKEDVTFAMDSLK.IINYLNGNNRLC-in.....................................................
#=GR B4JPK1_DROGR/146-339    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E7KUJ5_YEASL/220-406               ............................................................l-RHPPGN.EIY......R.......D.............D............Y.......V..SFF...E.IDGR..KQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMT..R...R...D..E...L...G.................................HH..LVGYFS.K..........E....KE....S....A....D.G.........Y.NVAC...ILTLPQ..........Y.....Q.RM..G..........YGKL.LIEF..........S................Y.EL....S...K....K...E.....N..............K..V..........G.SPE...........KPLSDLGLL..S.YRAYWSDTLITL.LV......E..H.Q..K.E-.............................-I.T.....I.D....EISSMTSMTTTDILHTAKTLN.ILRYYKGQHIIFLn......................................................
#=GR E7KUJ5_YEASL/220-406    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H3JNF8_STRPU/1-114                 .............................................................-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...-...-..-...-...-.................................--..------.-..........E....KE....S....P....D.G.........N.NVAC...ILILPP..........F.....Q.RK..G..........YGKF.LIAF..........S................Y.EL....S...K....L...E.....N..............C..V..........G.SPE...........KPLSDLGKL..S.YRSYWSWVLLEI.LR......D..F.K..G.--.............................TL.S.....I.R....DLSQMTSITQPDIISTLQALN.MIKYWKGQHVICVt......................................................
Q4P9B1_USTMA/692-878               ............................................................m-RHPPGD.EIY......R.......D.............G............N.......I..CVY...E.VDGR..KN.......................K..I..YCQNLCLLAKMFLDHKTLY..YD.......V.EP.....FLFYIVT..E...G...D..S...T...G.................................DH..FVGYFS.K..........E....KR....S....P....M.N.........Y.NVSC...IMTLPV..........R.....Q.RR..G..........WGNF.LIDI..........S................F.LL....S...K....K...E.....G..............R..T..........G.TPE...........KPLSDLGLL..S.YRNYWTLAVFYY.LR......T..A.P..D.--.............................EV.S.....M.D....DISRATAMQLEDIYYVLAEKD.MIVVYDGNNA---nsrt...................................................
#=GR Q4P9B1_USTMA/692-878    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E9AUD7_LEIMU/59-253                ..........................................................afw---IPGD.EVY......R.......D.............E............Er.....rF..CVF...A.LDGR..KPh.....................cA..A..MSRRICLLSKLFLVDKVTL..DD.......V.HF.....FSFNALF..E...V...D..D...E...G.................................FH..FVGYFS.K..........E....WT....S....S....S.Sc.......mN.TLSC...VMVLPP..........F.....R.SK..G..........YGSF.LVRL..........S................Y.EM....A...R....L...E.....G..............M..V..........G.TPE...........RPLSKSGNA..L.FRKVWREEVLFA.VF......A..L.E..A.RG............................sPV.T.....V.G....ELSKVSGLIVEDVLVALQGLD.VL-----------fsvgkqgpllv............................................
#=GR E9AUD7_LEIMU/59-253     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q5ACY2_CANAL/131-323               .......................................................rkrpsk-----GK.LLY......H.......D.............Q............An.....gY..IIR...E.VRGF..QD.......................P..L..FCQNLCLFGKLFLDDKSVY..YN.......I.DH.....FDFYIVF..G...K...D..D...S...S.................................YI..PMGFFS.K..........E....VL....S....Y....DnD.........N.NLAC...ICVFPP..........F.....Q.RR..H..........LGSL.LIEF..........S................Y.QL....A...A....VtpgQ.....L..............K..S..........S.GPE...........FPLSPYGKV..T.YLRFWSKRLATK.IH......E..L.Q..G.S-.............................-F.T.....L.S....HLSKETGFRKEDILLTLEYMQ.ILVTD--------dlgnvtls...............................................
#=GR Q5ACY2_CANAL/131-323    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q4UHT8_THEAN/219-414               ............................................................l-RHPPGN.EIY......R.......D.............E............N.......L..AMF...E.VDGA..MS.......................T..V..YCENLCFLSKLFLDHKSLR..HT.......V.FL.....FIFYVMT..E...F...D..E...N...G.................................YH..ITGYFS.K..........E....KH....S....K....-.-.........N.NVSC...ILSLPQvldyglitlqH.....Q.RK..G..........YGKY.LTAF..........S................Y.LL....S...K....K...E.....G..............K..T..........G.TPE...........RPLSDLGKA..S.YMSYWSEVLLEI.LF......D..P.K..H.E-.............................NL.T.....I.Q....ELSQMTAFEPNDIISCLEELG.ILHTLS-------ngnsviti...............................................
#=GR Q4UHT8_THEAN/219-414    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
ESA1_KLULA/214-400                 ............................................................l-RHPPGN.EIY......R.......D.............D............Y.......V..SFF...E.IDGR..KQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMT..R...R...D..E...L...G.................................HH..IVGYFS.K..........E....KE....S....A....D.A.........Y.NVAC...ILTLPQ..........Y.....Q.RM..G..........YGRL.LIEF..........S................Y.EL....S...K....K...E.....G..............K..V..........G.SPE...........KPLSDLGLL..S.YRAYWADTLIKL.LV......E..H.G..Q.E-.............................-I.T.....I.D....EVSSISSMTTTDILHTAKALE.ILRFYRGQHVLY-ln.....................................................
#=GR ESA1_KLULA/214-400      pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
#=GR ESA1_KLULA/214-400      sAS   ..........................................................................................................................................................................................................................................................................................................................................*...........................................................................................................................................................................................................................................................................................................................................
H2MQA9_ORYLA/397-584               .............................................................WKHPPGD.EIY......R.......K.............T............N.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMA..E...A...D..N...T...G.................................CH..LVGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKDVLLRY.MN......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQALQ.MLKYWKGKHLV--lkr....................................................
#=GR H2MQA9_ORYLA/397-584    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A8NSI3_BRUMA/463-654               ............................................................l-RHPPGN.EIY......R.......K.............D............S.......V..SVF...E.VDGY..CS.......................R..I..YCQNICLLAKLFLDHKTLY..YD.......V.EP.....FLFYVVT..K...N...D..N...S...G.................................CH..FVGYFS.K..........E....KY....S....A....Q.K.........Y.NLSC...IMTLPS..........Y.....Q.RQ..G..........FGRF.LIDF..........S................F.LL....S...R....K...E.....G..............M..T..........G.TPE...........RPLSDLGRL..S.YRSYWQSAICEY.LY......K..T.V..A.PDk..........................tkRL.T.....L.R....GIARGTGISVYDVMETLQSLN.LLQRINSQMIITLn......................................................
#=GR A8NSI3_BRUMA/463-654    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B0Y6S5_ASPFC/546-731               ............................................................a-KHPPGD.EIY......R.......D.............G............S.......I..SIF...E.VDGR..KN.......................P..V..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYVMT..E...F...D..D...L...G.................................CH..FVGYFS.K..........E....KR....P....S....S.A.........N.NVSC...ILTLPI..........H.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...R....I...E.....G..............K..T..........G.SPE...........KPLSDMGLV..S.YRNYWRLILSYQ.LR......N..Q.K..T.P-.............................-I.S.....I.A....ELSERTGMTADDVVSGLEGLR.AL-----------vrdpitktyal............................................
#=GR B0Y6S5_ASPFC/546-731    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H2LTD2_ORYLA/314-506               ............................................................l-RHPPGN.EIY......R.......K.............G............T.......I..SFF...E.IDGR..KN.......................K..N..YSQNLCLLAKCFLDHKTLY..YD.......T.DP.....FLFYVMT..E...Y...D..S...K...G.................................FH..IVGYFS.K..........E....VK....N....X....E.D.........Y.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKL.LIEF..........S................Y.EL....S...K....V...E.....G..............K..T..........G.TPE...........KPLSDLGLL..S.YRSYWSQTILEI.LM......D..L.K..P.DNge.........................rpQI.T.....I.N....EISEITSVKKEDVISTLQYLN.LINYYKGQYILT-ls.....................................................
#=GR H2LTD2_ORYLA/314-506    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H9LIX7_CRAAR/1-182                 ............................................................g-------.---......-.......-.............-............N.......I..SFF...E.IDGR..KN.......................K..S..YAQNLCLLAKLFLDHKTLY..YD.......T.DP.....FLFYVMC..E...Q...D..C...K...G.................................YH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........F.....Q.KK..G..........FGKL.LIEF..........S................Y.EL....S...K....C...E.....G..............K..T..........G.SPE...........KPLSDLGLL..S.YRSYWSQTILEI.LI......N..M.T..P.SEgn........................drpVI.T.....I.N....DISEMTSIKKEDVISTLQHLN.LINYYKGQYIITLs......................................................
#=GR H9LIX7_CRAAR/1-182      pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G2QEZ5_THIHA/573-766               ............................................................a-KHPPGD.EIY......R.......H.............G............S.......V..SVF...E.VDGR..KN.......................P..V..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYVLC..E...Y...D..D...L...G.................................YH..FVGYFS.K..........E....KR....A....S....S.Q.........N.NVSC...ILTLPI..........H.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...R....V...E.....K..............K..T..........G.SPE...........KPLSDMGLV..S.YRNYWRLVMCRY.LL......S..H.F..S.EEss........................gkaGL.S.....I.K....QISDDTGLTPDDVISALEGLR.CLVRDPQTQ----lyafr..................................................
#=GR G2QEZ5_THIHA/573-766    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G2HE23_PANTR/74-266                ............................................................l-RHPPGN.EIY......R.......K.............G............T.......I..SFF...E.IDGR..KN.......................K..S..YSQNLCLLAKCFLDHKTLY..YD.......T.DP.....FLFYVMT..E...Y...D..C...K...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKL.LIEF..........S................Y.EL....S...K....V...E.....G..............K..T..........G.TPE...........KPLSDLGLL..S.YRSYWSQTILEI.LM......G..L.K..S.ESge.........................rpQI.T.....I.N....EISEITSIKKEDVISTLQYLN.LINYYKGQYILT-ls.....................................................
#=GR G2HE23_PANTR/74-266     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A7TH51_VANPO/221-407               ............................................................l-RHPPGN.EIY......R.......D.............D............Y.......V..SFF...E.IDGR..KQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMT..R...R...D..E...L...G.................................HH..LVGYFS.K..........E....KE....S....A....D.G.........Y.NVAC...ILTLPQ..........Y.....Q.RM..G..........YGKL.LIEF..........S................Y.EL....S...K....R...E.....G..............K..V..........G.SPE...........KPLSDLGLL..S.YRAFWSDTLIAL.LA......E..H.G..N.E-.............................-I.T.....I.D....EISSITAMTTTDILHTSKTLN.ILRYYKGQHIIFLs......................................................
#=GR A7TH51_VANPO/221-407    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H2XN29_CIOIN/214-274               ............................................................l-RYPPGN.EIY......R.......K.............S............N.......I..SFF...E.IDGR..KN.......................K..S..YAQNLCLLAKCFLDHKTLY..YD.......T.DP.....FLFYVMT..E...Y...D..-...-...-.................................--..------.-..........-....--....-....-....-.-.........-.----...------..........-.....-.--..-..........----.----..........-................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------.......................................................
#=GR H2XN29_CIOIN/214-274    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G1T6D0_RABIT/318-510               ............................................................l-RHPPGN.EIY......R.......K.............G............T.......I..SFF...E.IDGR..KN.......................K..S..YSQNLCLLAKCFLDHKTLY..YD.......T.DP.....FLFYVMT..E...Y...D..C...K...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKL.LIEF..........S................Y.EL....S...K....V...E.....G..............R..T..........G.TPE...........KPLSDLGLL..S.YRSYWSQTILEI.LM......G..L.K..S.ESge.........................rpQI.T.....I.N....EISEITSIKKEDVISTLQYLN.LINYYKGQYILT-ls.....................................................
#=GR G1T6D0_RABIT/318-510    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E9NMR1_9MUSC/87-215                ............................................................k-RKPPGR.EIY......R.......K.............G............T.......I..SIF...E.VNGK..EE.......................P..L..YCQLLCLMAKLFLDHKVLY..FD.......M.DP.....FYFYVLC..E...I...D..M...E...G.................................SH..IVGYFS.K..........E....KK....S....Q....D.N.........N.NVAC...ILVLPP..........H.....Q.RK..G..........YGKL.LIAF..........S................Y.EL....S...R....K...E.....G..............V..I..........G.SPE...........KPLSDLGRL..S.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------.......................................................
#=GR E9NMR1_9MUSC/87-215     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G9MNK9_HYPVG/278-476               .....................................................yveevvqd-------.---......-.......E.............G............E.......W..SLW...E.VDGE..QD.......................V..L..FCQNLSLFAKLFLDNKSVF..FD.......V.TG.....FNYFLLV..Y...T...P..P...T...Vatpsgm.....................pappvtPQ..ITGFFS.K..........E....KM....S....W....D.N.........N.NLAC...ILIFPP..........W.....Q.RK..G..........LGAL.LMGA..........S................Y.EI....S...R....R...E.....G..............I..M..........G.GPE...........KPISDLGKK..G.YQRFWAGEIARW.LL......G..L.D..V.AQtdpe....................ngqetLV.D.....V.E....DCSQATWITPEDCLGVLRDMG.VVE----------dag....................................................
#=GR G9MNK9_HYPVG/278-476    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F7FU99_MACMU/233-389               ............................................................l-RHPPGN.EIY......R.......K.............G............T.......I..SFF...E.IDGR..KN.......................K..S..YSQNLCLLAKCFLDHKTLY..YD.......T.DP.....FLFYVMT..E...Y...D..C...K...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKL.LIEF..........S................Y.EL....S...K....V...E.....G..............K..T..........G.TPE...........KPLSDLGLL..S.YRSYWSQTILEI.LM......G..L.K..S.ES.............................--.-.....-.-....---------------------.-------------gerpqiti...............................................
#=GR F7FU99_MACMU/233-389    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G5C7I6_HETGA/774-889               .............................................................WFHPPAN.EIY......R.......R.............K............D.......L..SVF...E.VDGN..MS.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..K...N...D..E...K...G.................................CH..LVGYFS.K..........E....KL....C....Q....Q.K.........Y.NVSC...IMIMPQ..........H.....Q.RQ..G..........FGRF.LIDF..........S................K.PL....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------devcgpiy...............................................
#=GR G5C7I6_HETGA/774-889    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E2A1C2_CAMFO/1003-1188             .............................................................WRHPPAT.EIY......R.......C.............N............G.......L..SVF...E.IDGN..VN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYAMT..K...N...D..K...Y...G.................................CH..LIGYFS.K..........E....KH....C...pA....Q.R.........Y.NVSC...IMTLPQ..........Y.....Q.RQ..G..........FGRF.LIEF..........S................Y.LL....S...K....V...E.....G..............I..P..........G.TPE...........KPLSDLGRV..S.YHSFWKSVVLEY.LD......A..H.R..N.AV.............................DI.K.....L.G....DITKMTGVSAHDIATAMQLLG.FIRS---------vhlpgd.................................................
#=GR E2A1C2_CAMFO/1003-1188  pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B8N378_ASPFN/125-311               ............................................................a-KHPPGD.EIY......R.......D.............G............S.......I..SIF...E.VDGR..KN.......................P..V..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYIMT..E...F...D..D...L...G.................................CH..FVGYFS.K..........E....KR....P....S....S.A.........N.NVSC...ILTLPI..........H.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...R....I...E.....G..............K..T..........G.SPE...........KPLSDMGLV..S.YRNYWRLILSYQ.LH......K..Q.K..T.P-.............................-L.S.....I.V....ELSERTGMTADDIVSGLEALR.ALVRD--------pvtktyalr..............................................
#=GR B8N378_ASPFN/125-311    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H8X5R3_9ASCO/247-409               ............................................................m-KHPPGN.EIY......R.......D.............S............K.......V..SFW...E.IDGR..KQ.......................R..T..WCRNLCLLCKLFLDHKTLY..YD.......V.DP.....FLFYVMT..I...K...S..E...Q...G.................................HH..VVGFFS.K..........E....KE....S....A....D.G.........Y.NVAC...ILTLPC..........Y.....Q.KR..G..........FGKL.LIQF..........S................Y.ML....S...A....V...E.....K..............K..V..........G.SPE...........KPLSDLGLL..S.YRAYWTDTLIKL.LV......E..R.N..N.PT.............................--.-.....-.-....---------------------.-------------lfkknnshpadedd.........................................
#=GR H8X5R3_9ASCO/247-409    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A2EPN6_TRIVA/166-352               ............................................................e-KTPPGK.EIY......R.......E.............G............N.......I..SIY...E.LKGW..RQ.......................K..I..PCQCLCLLSKLFLDHKTLT..YD.......V.DG.....FVFYVLC..E...C...D..D...D...G.................................AH..VAAYYS.R..........E....TA....S....Q....-.N.........N.ILAC...ITTLPP..........Y.....Q.KK..G..........YGRI.LISL..........S................Y.EI....A...K....R...Q.....F..............K..V..........G.GPE...........RPLSDLGRK..A.YRAYWHDTILET.LR......D..H.R..D.E-.............................IK.S.....V.E....NLSTLTSIQNDDVIIALKQIG.LAVKVKGEY----elnit..................................................
#=GR A2EPN6_TRIVA/166-352    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q4WXI3_ASPFU/75-287                ...........................................................rt--TPPGA.QVY......E.......H.............G............G.......F..SVW...E.VDGD..EH.......................K..L..YAQNLSLFAKLFLDHKSVF..FD.......V.AT.....FLYYILT..F...T...D..PgnpE...K.................................YH..ILGFFS.K..........E....KL....S....W....D.A.........N.NLAC...ILVFPP..........Y.....Q.HK..Q..........LGKL.LMGV..........S................Y.KI....S...A....W...E.....Ed...........agF..I..........G.GPE...........KPLSDMGAR..S.YSRFWQERIGRR.LL......L..D.D..T.DAsgqetqpar...........etrkrhsatFM.T.....V.R....DIGEATGMLTEDVITALRGMG.VVQPET-------pskrrkak...............................................
#=GR Q4WXI3_ASPFU/75-287     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B9H794_POPTR/230-416               ............................................................l-KHPPGD.EIY......R.......S.............G............T.......L..SMF...E.IDGK..KN.......................K..V..YGQNLCYLAKLFLDHKTLY..YD.......V.DL.....FLFYVLC..E...C...D..D...R...G.................................CH..MVGYFS.K..........E....KH....S....E....E.S.........Y.NLAC...ILTLPP..........Y.....Q.RK..G..........YGKF.LIAF..........S................Y.EL....S...K....K...E.....G..............K..V..........G.TPE...........RPLSDLGLL..S.YRGYWTRVLLDI.LK......R..H.K..G.--.............................NI.S.....I.K....ELSDMTAIKAEDILTTLQSLE.LIQYRKGQHVICAd......................................................
#=GR B9H794_POPTR/230-416    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q5B1E0_EMENI/539-724               ............................................................a-KHPPGD.EIY......R.......E.............G............S.......I..SIF...E.VDGR..KN.......................P..V..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYVMT..E...F...D..D...L...G.................................CH..FVGYFS.K..........E....KR....P....S....S.A.........N.NVSC...ILTLPI..........H.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...R....I...E.....G..............K..T..........G.SPE...........KPLSDMGLV..S.YRNYWRLVLSYQ.LR......N..Q.K..T.P-.............................-V.S.....I.A....ELSERTGMTADDVVSGLEALR.ALV----------rdpvtrtyal.............................................
#=GR Q5B1E0_EMENI/539-724    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
C9SGJ0_VERA1/408-618               .......................................................veevvq-------.---......D.......Q.............G............E.......W..SVW...E.VDGE..VD.......................G..L..FCQNLSLFAKLFLDNKSVF..FD.......V.TG.....FTYFLLV..Y...T...P..P...A...Rpptgppgdpsq..........pavdtsdekpvrPH..IVGFFS.K..........E....KM....S....W....D.N.........N.NLAC...ILVFPP..........W.....Q.RK..G..........LGAL.LMGV..........S................Y.EI....S...R....R...E.....G..............V..L..........G.GPE...........KPISDLGRK..G.YRRFWGGEIARW.LL......G..I.G..G.IAgafd....................sseetLV.D.....V.G....DCSRGTWIALDDCLITLREMG.LLQ----------dagvg..................................................
#=GR C9SGJ0_VERA1/408-618    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B4KLV6_DROMO/730-918               .............................................................WKQPPGT.EIF......R.......Q.............G............D.......I..SVF...E.VDGN..VN.......................K..I..YCQNLCLLAKFFLDHKTLY..YD.......V.EP.....FLFYILT..K...N...D..Q...V...G.................................CH..LVGYFS.K..........E....KH....C....S....Q.K.........Y.NVSC...ILTLPQ..........Y.....Q.RQ..G..........YGRF.LIDF..........S................Y.LL....S...R....E...E.....G..............Q..L..........G.TPE...........KPLSDLGRL..S.YFSYWKSVVLEY.LY......K..Y.R..N.NR.............................TI.T.....F.K....DIAIKTGLAISDIALAFELLN.FIKLRKNDGDIR-yq.....................................................
#=GR B4KLV6_DROMO/730-918    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H1V8F2_COLHI/378-581               ...................................................apkyteeyvt-------.---......D.......E.............G............E.......W..SVW...E.VDGE..QD.......................V..L..FCQNLSLFAKLFLDNKSVF..FD.......V.RG.....FNYFLLV..Y...T...P..P...L...Kpdsp........................xppprPH..IVGFFS.K..........E....KM....S....W....D.N.........N.NLAC...ILVFPP..........W.....Q.RK..G..........LGAL.LMGV..........S................Y.EI....S...R....R...E.....G..............V..L..........G.GPE...........KPISELGRK..G.YKRFWGGEVARW.LL......D..C.P..T.NGrgggg..................dtdpalLV.D.....V.E....DCSRATWITLEDCLGTLREMG.VV-----------veagkgp................................................
#=GR H1V8F2_COLHI/378-581    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A4H724_LEIBR/353-475               ......................................................fdaegwd-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...-...-..-...-...G.................................DA..VMGYFS.R..........L....KH....Y....-....P.D.........H.TLSC...IVTLPM..........F.....Q.RA..R..........VATF.LLDV..........A................Y.WM....T...R....Q...R.....Q..............R..VcgcgfcgksgG.AIS...........RPFSPHGES..L.LLSYWRRALLRS.LA......A..V.A..P.--.............................--.-.....-.-....---------------------.-------------syrrvsrtaqpelrftleelral................................
C0SAR5_PARBP/256-443               ............................................................l-VHPPGN.EIY......R.......D.............D............N.......V..SFF...E.VDGR..RQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMT..T...R...D..E...H...G.................................CH..LVGYFS.K..........E....KE....S....A....E.G.........Y.NVAC...ILTLPQ..........Y.....Q.RR..G..........FGRL.LIAF..........S................Y.EL....S...K....R...E.....S..............K..L..........G.SPE...........KPLSDLGLL..G.YRQYWRETLVDI.LM......E..P.G..R.E-.............................SI.S.....E.S....ELANLSAMTEKDVHETLVVLN.LLRYNKGNWVIV-lt.....................................................
#=GR C0SAR5_PARBP/256-443    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H2LGN0_ORYLA/354-541               .............................................................WKHPPGD.EVY......R.......K.............G............S.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LVGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........FGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.MC......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQSLQ.MLKYWKGKHLV--lkr....................................................
#=GR H2LGN0_ORYLA/354-541    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H2YRS8_CIOSA/202-395               ............................................................l-RYPPGN.EIY......R.......K.............S............S.......I..SFF...E.IDGR..KN.......................K..S..YAQNLCLLAKCFLDHKTLY..YD.......T.DP.....FLFYVMT..E...Y...D..S...K...G.................................FH..LVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........H.....Q.RK..G..........FGKL.LIEF..........S................Y.AL....S...R....I...E.....G..............K..A..........G.TPE...........KPLSDLGLL..S.YRSYWTNTILSM.II......G..L.K..P.EPgq........................ekpQI.T.....I.N....EICEKTCVKKEDVISTLQHLN.LINYYKGQYIIVLs......................................................
#=GR H2YRS8_CIOSA/202-395    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
C5DCQ5_LACTC/271-473               ............................................................l-RHPPGN.EIY......R.......E.............G............N.......I..SIW...E.VDGR..EN.......................V..I..YCQNLCLLAKLFLNSKTLY..YD.......V.EP.....FIFYVLT..E...R...E..D...T...Gee.............................sqFH..FVGYFS.K..........E....KL....T....S....T.D.........Y.NLSC...ILTLPI..........Y.....Q.RK..G..........YGHF.LVDF..........S................Y.LL....T...R....R...E.....Y..............K..W..........G.TPE...........KPLSDLGLL..S.YRNFWKTKICEV.LG......E..L.K..E.EInhaek...................kgeilHC.S.....I.E....DLSNLTGMIPTDVVFGLEQIG.ALHYYKGESK---lqfa...................................................
#=GR C5DCQ5_LACTC/271-473    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A1CEC6_ASPCL/278-465               ............................................................l-VHPPGN.EIY......R.......D.............D............Y.......I..SFF...E.VDGR..RQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMC..T...R...D..E...T...G.................................CH..LVGYFS.K..........E....KD....S....A....E.G.........Y.NLAC...ILTLPQ..........Y.....Q.RR..G..........FGRL.LISF..........S................Y.EL....S...K....R...E.....G..............K..L..........G.SPE...........KPLSDLGLL..G.YRQYWRETLVNI.LM......E..P.E..R.E-.............................AI.S.....E.N....ELALLTSMTEKDVHETLVVFN.MLRYHKGNWVIV-lt.....................................................
#=GR A1CEC6_ASPCL/278-465    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A2E091_TRIVA/141-328               ............................................................c-QRPPGR.EIY......R.......C.............G............N.......I..SMF...E.VSGA..KH.......................K..V..FCQCLSLLSKLFLDDVAVF..YN.......V.CQ.....FNFFVLC..E...C...D..E...F...G.................................AH..VVSFFS.R..........D....YQ....W....R....D.N.........N.ILAC...ILVLPP..........W.....Q.KH..G..........YGRL.MISI..........A................Y.EI....A...R....R...N.....R..............I..V..........G.GPE...........KPLSDLGKL..A.FKAYWRDTIIKT.MF......E..Y.K..D.K-.............................IR.N.....V.D....DFQAITSIAKVDLLKTMKDMN.LLYHTNE------gwtttln................................................
E7Q7U2_YEASB/126-314               ............................................................q-YRVPGK.IKY......K.......S.............P............E.......Y..TIR...R.VKGS..KY.......................Q..L..FCQCLCLFTKLYLDNKSMY..FK.......V.DH.....YEFYIVY..E...T...G..S...T...K.................................--..PMGFFS.K..........D....LV....S....Y....Q.Q.........N.NLAC...ILIFPP..........Y.....Q.RR..G..........LGLL.LIEF..........S................Y.KL....S...Q....L...E.....G..............V..I..........S.GPE...........VPLSPFGLI..G.YLKYWSQILCWH.LI......E..G.D..L.AHy...........................dKV.T.....L.E....DLSIVTGMRVNDVILTLKHLN.CIGENNQIYLQS-ln.....................................................
#=GR E7Q7U2_YEASB/126-314    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F4RA27_MELLP/232-421               ............................................................l-LHPPGN.EIY......R.......S.............D............D.......I..HFF...E.IDGR..RQ.......................K..T..WCRNLSLLSKCFLDHKTLY..YD.......V.DP.....FMYYVMC..L...R...D..S...N...G.................................LH..MIGYFS.K..........E....KE....S....A....E.N.........Y.NVAC...ILTLPQ..........Y.....Q.RH..G..........FGKL.LIEF..........S................Y.EL....S...K....K...E.....G..............K..L..........G.SPE...........KPLSDLGLL..S.YRAYWEEIIVGF.IL......E..CvS..K.NE.............................DV.S.....I.D....EIAQKTAIVHGDVMHVCQTLH.MLKYHDKQHVICLs......................................................
#=GR F4RA27_MELLP/232-421    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G8YKY2_PICSO/264-467               ............................................................n-NHPPGV.EIY......R.......Dv...........eS............R.......I..AIW...E.VDGR..KN.......................I..N..YCQNLCLLAKLFLNSKTLY..YD.......V.EP.....FIFYVLT..E...L...D..H...D...Dp..............................tnYH..FVGYFS.K..........E....KL....N....N....S.D.........Y.NVSC...ILTLPI..........Y.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...R....S...E.....F..............K..Y..........G.TPE...........KPLSDLGLV..S.YRNYWKITIASK.LK......L..L.H..D.KYilnskt.................enterfSI.S.....I.E....CLSKLTGMTPSDVVVGLEQLN.ALIK---------npgtttyg...............................................
#=GR G8YKY2_PICSO/264-467    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
C0PK30_MAIZE/221-407               ............................................................l-KHPPGD.EIY......R.......S.............G............T.......L..SMF...E.VDGK..KN.......................K..V..YGQNLCYLAKLFLDHKTLY..YD.......V.DL.....FLFYVLC..E...C...D..D...R...G.................................CH..MVGYFS.K..........E....KH....S....E....E.S.........Y.NLAC...ILTLPP..........Y.....Q.RK..G..........YGKF.LIAF..........S................Y.EL....S...K....K...E.....G..............K..V..........G.TPE...........RPLSDLGLL..S.YRGYWTRVLLEI.LK......K..H.K..G.--.............................NI.S.....I.K....ELSDMTAIKADDILSTLQSLD.LIQYRKGQHVICAd......................................................
#=GR C0PK30_MAIZE/221-407    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
C8ZEY2_YEAS8/126-314               ............................................................q-YRVPGK.IKY......K.......S.............P............E.......Y..TIR...R.VKGS..KY.......................Q..L..FCQCLCLFTKLYLDNKSMY..FK.......V.DH.....YEFYIVY..E...T...G..S...T...K.................................--..PMGFFS.K..........D....LV....S....Y....Q.Q.........N.NLAC...ILIFPP..........Y.....Q.RR..G..........LGLL.LIEF..........S................Y.KL....S...Q....L...E.....G..............V..I..........S.GPE...........VPLSPFGLI..G.YLKYWSQILCWH.LI......E..G.D..L.AHy...........................dKV.T.....L.E....DLSIVTGMRVNDVILTLKHLN.CIGENNQIYLQS-ln.....................................................
#=GR C8ZEY2_YEAS8/126-314    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q1RPX1_CIOIN/287-475               .............................................................WRHPPGD.EIY......R.......K.............G............T.......I..SVF...E.VDGK..KN.......................K..I..YSQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..L...T...G.................................CH..MVGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........H.....M.RK..G..........YGKM.MIDF..........S................Y.LL....S...R....K...E.....G..............K..T..........G.SPE...........RPLSDLGLL..S.YRSYWTDIIISY.LS......K..L.D..A.AA.............................DL.V.....I.R....DISQETAVHPADIVSTLQALQ.MLKYWKGKHIIL-kk.....................................................
#=GR Q1RPX1_CIOIN/287-475    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
D6X346_TRICA/664-787               .....................................................laqtrqlv-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...-...-..-...-...-.................................--..------.Q..........E....KN....S....F....L.N.........Y.NVSC...ILTLPP..........Y.....Q.RQ..G..........YGRL.LIEF..........S................Y.LL....T...K....V...E.....G..............K..I..........G.SPE...........KPLSDLGLI..S.YRSYWKDVLLAY.LC......S..G.P..G.-T.............................QL.S.....V.K....DISQEMAIHSYDIVSTLQALG.MMKYWKGKHIIL-kk.....................................................
G0S3X6_CHATD/275-464               ............................................................l-QHPPGN.EIY......R.......D.............D............Y.......V..SFF...E.IDGK..RQ.......................R..T..WCRNLCLLSKMFLDHKTLY..YD.......V.DP.....FLFYVMT..R...R...D..E...K...G.................................CH..IVGYFS.K..........E....KE....S....A....D.G.........Y.NVAC...ILTLPQ..........Y.....Q.RK..G..........YGRL.LIQF..........S................Y.EL....S...K....I...E.....G..............K..M..........G.SPE...........KPLSDLGLL..S.YRQYWSEQIIDL.LL......G..Y.A..E.RD............................eKC.T.....I.E....GIATTLAMTTQDVEHTLQALK.MQVYHKGEHKIV-ip.....................................................
#=GR G0S3X6_CHATD/275-464    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
KAT7_RAT/391-578                   .............................................................WKHPPGD.EIY......R.......K.............G............S.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LIGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LH......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQALQ.MLKYWKGKHLV--lkr....................................................
#=GR KAT7_RAT/391-578        pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
#=GR KAT7_RAT/391-578        sAS   ..........................................................................................................................................................................................................................................................................................................................................*...........................................................................................................................................................................................................................................................................................................................................
H2NVL2_PONAB/390-577               .............................................................WKHPPGD.EIY......R.......K.............G............S.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LIGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LH......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQALQ.MLKYWKGKHLV--lkr....................................................
#=GR H2NVL2_PONAB/390-577    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B4R499_DROSI/313-506               ............................................................l-RHPPGN.EIY......R.......K.............H............T.......I..SFF...E.IDGR..KN.......................K..V..YAQNLCLLAKLFLDHKTLY..YD.......T.DP.....FLFYVMT..E...F...D..S...R...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTMPP..........Y.....Q.RK..G..........YGKL.LIEF..........S................Y.EL....S...K....F...E.....G..............K..T..........G.SPE...........KPLSDLGLL..S.YRSYWAQTILEI.FI......S..Q.N..P.STdg........................ekpTI.T.....I.N....DICECTSIKKEDVISTLQNLN.LINYYKGQYIVCIn......................................................
#=GR B4R499_DROSI/313-506    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
I1JI23_SOYBN/180-301               ...............................nmatgqlyshlipltlllvdgsspidvtds-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.-Q.....WELYIVC..Q...K...K..T...D...Qqg............................eiqYR..LTGFTA.V..........Y....RFyhypD....D....S.R.........L.RLSQ...ILVLPP..........Y.....Q.HK..G..........YGRF.LLEV..........L................Y.DV....A...I....S...E.....N..............V..F..........DfTVE...........EPLDHFQRV..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------rtcv...................................................
H8WW58_9ASCO/217-414               ............................................................n-HHPPGT.EIY......R.......D.............S............N.......V..SVW...E.VDGR..KN.......................I..N..YCQNICLLAKLFLNSKTLY..YD.......V.EP.....FVFYVLT..E...R...D..P...N...Tp..............................skHH..FVGYFS.K..........E....KL....N....N....S.D.........Y.NVSC...ILTLPI..........Y.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...R....N...E.....F..............K..F..........G.TPE...........KPLSDLGLL..S.YRNYWKVTIAYK.LR......E..L.Y..Q.KYrds.......................gglNV.S.....L.S....VLCKMTGMTPANVVVALEQLH.ALHWKQN------geetkfa................................................
#=GR H8WW58_9ASCO/217-414    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A2G4N9_TRIVA/144-328               .............................................................WTHPPGD.EIY......R.......H.............G............H.......I..SAY...E.IDGG..VA.......................S..R..WCTNLCLITKFFLFHKSAY..YG.......T.DE.....FLFYVMC..F...N...D..T...R...G.................................AH..PCGFFS.K..........E....KR....A....E....C.Q.........N.NLSC...ILSFPA..........Y.....Q.KT..G..........VGRF.LIQL..........S................Y.EL....S...K....I...E.....K..............R..T..........G.GPE...........TPLSDLGLM..A.YSSYWKAAVLKC.IV......E..H.E..G.E-.............................KL.S.....V.A....SISAMTGMTEADVMTG-----.-------------arkggylvkvddrsqw.......................................
#=GR A2G4N9_TRIVA/144-328    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E2QT63_CANFA/232-418               .............................................................WRQPPGK.EIY......R.......K.............S............N.......I..SVY...E.VDGK..DH.......................K..I..YCQNLCLLAKLFLDHKTLY..FD.......V.EP.....FVFYILT..E...V...D..R...Q...G.................................AH..IVGYFS.K..........E....KE....S....P....D.G.........N.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKF.LIAF..........S................Y.EL....S...K....L...E.....S..............T..V..........G.SPE...........KPLSDLGKL..S.YRSYWSWVLLEI.LR......D..F.R..G.--.............................TL.S.....I.K....DLSQMTSITQNDIISTLQSLN.MVKYWKGQHVICVt......................................................
#=GR E2QT63_CANFA/232-418    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A7F8C8_SCLS1/276-465               ............................................................l-QHPPGN.EIY......R.......D.............D............Y.......V..SFF...E.IDGR..RQ.......................R..T..WCRNLCLISKMFLDHKTLY..YD.......V.DP.....FLFYVMC..S...V...D..E...K...G.................................FH..LVGYFS.K..........E....KE....S....A....D.G.........Y.NVAC...ILTLPQ..........Y.....Q.RK..G..........YGRL.LINF..........S................Y.EL....S...K....I...E.....G..............K..L..........G.SPE...........KPLSDLGLL..S.YRQYWTERIVEE.LL......I..H.N..E.RD............................eRI.S.....I.E....GLSQKLSMTSADVEHTLQALK.MQVYHKGEHKMV-lp.....................................................
#=GR A7F8C8_SCLS1/276-465    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q3UJQ1_MOUSE/285-477               ............................................................l-RHPPGN.EIY......R.......K.............G............T.......I..SFF...E.IDGR..KN.......................K..S..YSQNLCLLAKCFLDHKTLY..YD.......T.DP.....FLFYVMT..E...Y...D..C...K...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKL.LIEF..........S................Y.EL....S...K....V...E.....G..............K..T..........G.TPE...........KPLSDLGLL..S.YRSYWSQTILEI.LM......G..L.K..S.ESge.........................rpQI.T.....I.N....EISEITSIKKEDVISTLQYLN.LINYYKGQYILT-ls.....................................................
#=GR Q3UJQ1_MOUSE/285-477    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
D6RM30_COPC7/1119-1302             ............................................................a-RNPPGD.EIY......R.......D.............G............P.......I..SIF...E.VDGR..RN.......................K..I..YCQNLCLLSKMFLDHKSLF..YD.......V.EP.....FLFYVVT..E...V...D..D...I...G.................................AR..FVGYFS.K..........E....KR....S....P....K.D.........Y.NLSC...IMTLPV..........R.....Q.RQ..G..........WGNL.LIDF..........S................Y.LL....S...K....K...E.....G..............R..L..........G.SPE...........KPLSALGQI..G.YRRYWTLAVMRY.LE......H..A.P..D.--.............................QI.R.....L.E....DIAKATSMTLEDICQTLIEQN.MIF----------ireptppi...............................................
#=GR D6RM30_COPC7/1119-1302  pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F9FD34_FUSOF/270-459               ............................................................l-QHPPGN.ELY......R.......N.............E............D.......I..SFF...E.IDGR..RQ.......................R..T..WCRNLCLLSKMFLDHKTLY..YD.......V.DP.....FLFYVMT..T...R...T..E...K...G.................................CH..LVGYFS.K..........E....KE....S....A....D.G.........Y.NVAC...ILTMPQ..........Y.....Q.RK..G..........YGRL.LIQF..........S................Y.EL....S...R....I...E.....G..............K..L..........G.SPE...........KPLSDLGLL..S.YRQYWSENILEL.LM......G..Y.N..E.RE............................eKV.T.....I.E....AISAALAMTTQDVEHTLQALR.MQVYHKSDHKIV-ip.....................................................
#=GR F9FD34_FUSOF/270-459    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E7LP90_TRYCR/216-433               ............................................................f-RRPPGI.LLY......N.......D.............K............E.......CgrRVY...Y.VDGA..KH.......................L..H..YGRCLSLLGKAFIESKQLG..SD.......V.DI.....YEFFVVT..A...P...R..A...S...Lpyvlgemeettfr.......reaasfdaahwdgDV..VVGYFS.R..........I....KH....S....P....D.H.........-.CLSC...ILTLPM..........F.....Q.QK..G..........VAVF.MLDV..........A................Y.AL....T...E....M...R.....Q..............R..L..........C.GCEaacgrrggaisRPFSPHGQA..L.LLSYWRQRVTEA.LM......Q..S.A..A.SP.............................PI.D.....T.E....ATAKSAAEDDDNVASTV----.-------------pfsvvhekv..............................................
#=GR E7LP90_TRYCR/216-433    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E9JCW7_SOLIN/657-735               .............................................................WKHPPGH.EVY......R.......K.............D............K.......I..GVW...E.VDGK..RY.......................K..Q..YCQNLCLLAKFFLDHKTLY..YD.......V.EP.....FLFYVMT..I...G...D..S...E...G.................................CH..TVGYFS.K..........-....--....-....-....-.-.........-.----...------..........-.....-.--..-..........----.----..........-................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------vstyll.................................................
#=GR E9JCW7_SOLIN/657-735    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q4XXB4_PLACH/266-449               ............................................................i-RHPPGN.EIY......R.......N.............D............K.......I..SIF...E.IDGN..YF.......................R..I..YCENLCFLSKLFLDHKTLK..HR.......V.NL.....FLFYVIT..E...F...D..E...Y...G.................................YH..ITGYFS.K..........E....KY....S....-....-.K.........N.NVSC...ILTLPQ..........H.....Q.KK..G..........YGKF.LINF..........S................Y.FL....S...Q....T...E.....K..............R..T..........G.TPE...........RPLSDLGAA..S.YMAYWYETLLKV.LI......N..Y.E..Q.--.............................-L.S.....I.Q....ELSEITSIETYDIVACLEEKE.IIKSVSN------genvyyi................................................
#=GR Q4XXB4_PLACH/266-449    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
C5FUI4_ARTOC/533-719               ............................................................a-KHPPGD.EIY......R.......E.............G............S.......V..SIF...E.VDGR..KN.......................P..V..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYVMT..E...Y...D..E...W...G.................................CH..FVGYFS.K..........E....KR....P....S....S.S.........N.NVSC...ILTLPI..........H.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...R....L...E.....G..............R..T..........G.SPE...........KPLSDMGLV..S.YRNYWRLVLCYK.FR......N..Q.K..S.P-.............................-T.S.....I.T....AISEQTGMTPDDVISALEGLS.ALVR---------dpvtktyalr.............................................
#=GR C5FUI4_ARTOC/533-719    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A5DV21_LODEL/165-374               .................................................pkvgslayydye-------.---......-.......-.............K............G.......I..VIR...E.VRGY..QD.......................P..L..FCQNLCLFGKLFLDDKSVY..YN.......V.DH.....FNFYIYY..A...K...P..Da.kE...N.................................YK..PMGFFS.K..........E....MI....A....Y....D.N........sN.NLAC...ICVFPP..........Y.....Q.RR..G..........IGQL.LIEL..........L................Y.MLesspT...S....N...S.....D..............R..R..........T.GPE...........VPLSPYGKA..A.YLKYWSACVVQS.LL......E..Y.G..S.VSnggtelf...............skntdllKV.T.....L.D....QLGAANHLRKEDVLFTMEHMG.ILITENDK-----vyvslk.................................................
#=GR A5DV21_LODEL/165-374    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E7QJB6_YEASZ/126-314               ............................................................q-YRVPGK.IKY......K.......S.............P............E.......Y..TIR...R.VKGS..KY.......................Q..L..FCQCLCLFTKLYLDNKSMY..FK.......V.DH.....YEFYIVY..E...T...G..S...T...K.................................--..PMGFFS.K..........D....LV....S....Y....Q.Q.........N.NLAC...ILIFPP..........Y.....Q.RR..G..........LGLL.LIEF..........S................Y.KL....S...Q....L...E.....G..............V..I..........S.GPE...........VPLSPFGLI..G.YLKYWSQILCWH.LI......E..G.D..L.AHy...........................dKV.T.....L.E....DLSIVTGMRVNDVILTLKHLN.CIGENNQIYLQS-ln.....................................................
#=GR E7QJB6_YEASZ/126-314    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B0WGS2_CULQU/602-682               .............................................................WRHPPGD.EIY......R.......K.............G............K.......L..GVW...Q.VDGK..RH.......................K..Q..YCQHLCLLAKFFLDHKTLY..YD.......V.EP.....FLFYVMT..L...A...D..S...D...G.................................CH..TVGYFS.K..........K....R-....-....-....-.-.........-.----...------..........-.....-.--..-..........----.----..........-................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------prrrtp.................................................
#=GR B0WGS2_CULQU/602-682    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E3WWJ0_ANODA/489-678               .............................................................WRNPPGT.EIY......R.......H.............D............G.......V..SVF...E.VDGN..AN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..R...Y...D..R...K...G.................................YH..LVGYFS.K..........E....KH....C....Q....Q.K.........Y.NVSC...IMTMPQ..........Y.....Q.RQ..G..........YGRF.LIDF..........S................Y.LL....S...R....E...E.....G..............Q..P..........G.TPE...........KPLSDLGRV..S.YYAYWKSTVLNF.LQ......D..H.R..P.GIqg........................grnAF.S.....L.K....QISQETGMVIPDIVLALQLLS.FIKYRKI------drg....................................................
#=GR E3WWJ0_ANODA/489-678    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q4S3F3_TETNG/59-246                .............................................................WFHPPAN.EIY......R.......K.............N............D.......L..SVF...E.VDGN..VS.......................K..L..FCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYILT..K...N...D..E...K...G.................................CH..LVGYFS.K..........E....KL....C....Q....Q.K.........Y.NVSC...IMIMPQ..........Y.....Q.RQ..G..........FGRF.LIDF..........S................Y.LL....T...R....Q...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YLAYWKSVILEY.LY......K..H.P..D.K-.............................HI.S.....V.K....GISRATGMCPHDIASTLQQLG.MIDRQDGR-----ivlirr.................................................
#=GR Q4S3F3_TETNG/59-246     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G3NR96_GASAC/401-588               .............................................................WKHPPGD.EIY......R.......K.............V............N.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..S...T...G.................................CH..LVGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGGR.KECF..........G................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LN......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQSLQ.MLKYWKGKHLV--lkr....................................................
#=GR G3NR96_GASAC/401-588    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H9K8H4_APIME/682-776               .............................................................WRHPPGH.EVY......R.......K.............D............K.......I..GVW...E.VDGK..RY.......................K..Q..YCQNLCLLAKFFLDHKTLY..YD.......V.EP.....FLFYVMT..I...G...D..S...E...G.................................CH..TVGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTLPX..........-.....-.--..-..........----.----..........-................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------xxxx...................................................
#=GR H9K8H4_APIME/682-776    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G4ZD94_PHYSP/308-405               ...........................................................fh-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...-...-..-...-...-.................................--..------.-..........-....--....-....-....-.-.........-.----...------..........-.....P.RK..G..........YGHF.IIQF..........S................Y.EL....S...K....K...E.....E..............K..V..........G.SPE...........KPLSDLGLV..S.YRSYWTRELLRI.LK......E..Y.P..E.K-.............................EV.S.....I.M....ELTRMTSIKNEDIIATLQHLN.MIKYLGGQYVY--vvp....................................................
H0GL43_9SACH/126-314               ............................................................q-YRVPGK.IKY......K.......S.............P............E.......Y..TIR...R.VKGS..KY.......................Q..L..FCQCLCLFTKLYLDNKSMY..FK.......V.DH.....YEFYIVY..E...T...G..S...T...K.................................--..PMGFFS.K..........D....LV....S....Y....Q.Q.........N.NLAC...ILIFPP..........Y.....Q.RR..G..........LGLL.LIEF..........S................Y.KL....S...Q....L...E.....G..............V..I..........S.GPE...........VPLSPFGLI..G.YLKYWSQILCWH.LI......E..G.D..L.AHy...........................dKV.T.....L.E....DLSIVTGMRVNDVILTLKHLN.CIGENNQIYLQS-ln.....................................................
#=GR H0GL43_9SACH/126-314    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F6S9I7_MONDO/1-170                 ............................................................f-------.---......-.......-.............-............-.......-..---...-.VDGN..VS.......................T..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..Q...N...D..V...K...G.................................CH..LVGYFS.K..........E....KH....C....Q....Q.K.........Y.NVSC...IMILPQ..........Y.....Q.RK..G..........YGRF.LIDF..........S................Y.LL....S...K....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YMAYWKSVILEC.LY......H..Q.N..D.-K.............................QI.S.....I.K....KLSKLTGICPQDITSTLHHLR.MLDFRSDQFVII-rr.....................................................
#=GR F6S9I7_MONDO/1-170      pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
I1BNV5_RHIO9/229-415               ............................................................l-HHPPGN.EVY......R.......H.............D............E.......I..SFF...E.IDGR..KQ.......................K..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMT..E...R...D..E...N...G.................................YH..LIGYFS.K..........E....KE....S....S....E.N.........Y.NVAC...ILTLPQ..........Y.....Q.RL..G..........YGRL.LIAF..........S................Y.EL....S...K....A...E.....G..............R..T..........G.SPE...........KPLSDLGLL..S.YRAFWTETIIEY.LL......Q..A.Q..K.E-.............................-A.T.....I.E....EISQRTSITIQDILHTLQNIG.ALKYYRGQHIICLg......................................................
#=GR I1BNV5_RHIO9/229-415    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E2ACJ8_CAMFO/1-83                  .............................................................-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...-...-..-...-...-.................................--..------.-..........-....--....-....-....-.-.........-.----...------..........-.....-.--..-..........----.----..........-................Y.LL....T...R....V...E.....K..............K..I..........G.SPE...........KPLSDLGLI..S.YRSYWKDVLLQY.LC......N..F.G..G.K-.............................EI.S.....V.K....DISKEMAIDSYDIVSTLQALG.MMKYWKGKHIIL-kk.....................................................
F7HQQ5_CALJA/773-960               .............................................................WFHPPAN.EIY......R.......R.............K............D.......L..SVF...E.VDGN..MS.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..K...N...D..E...K...G.................................CH..LVGYFS.K..........E....KL....C....Q....Q.K.........Y.NVSC...IMIMPQ..........H.....Q.RQ..G..........FGRF.LIDF..........S................Y.LL....S...R....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YLAYWKSVILEY.LY......H..H.H..E.R-.............................HI.S.....I.K....AISRATGMCPHDIATTLQHLH.MIDKRDGRFVI--irr....................................................
#=GR F7HQQ5_CALJA/773-960    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F6UXD9_HORSE/285-477               ............................................................l-RHPPGN.EIY......R.......K.............G............T.......I..SFF...E.IDGR..KN.......................K..S..YSQNLCLLAKCFLDHKTLY..YD.......T.DP.....FLFYVMT..E...Y...D..C...K...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKL.LIEF..........S................Y.EL....S...K....V...E.....G..............K..T..........G.TPE...........KPLSDLGLL..S.YRSYWSQTILEI.LM......G..L.K..S.ESge.........................rpQI.T.....I.N....EISEITSIKKEDVISTLQYLN.LINYYKGQYILT-ls.....................................................
#=GR F6UXD9_HORSE/285-477    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G4TC41_PIRID/450-634               ............................................................s-RHPPGD.EIY......R.......D.............G............S.......I..SIF...E.VDGR..LN.......................K..I..YCQNLCLLSKMFLDHKSLF..YD.......V.EP.....FLFYVMT..E...V...D..D...I...G.................................AH..FVGYFS.K..........E....KR....S....P....K.D.........F.NVSC...IMTLPV..........R.....Q.KS..G..........WGNL.LIDF..........S................Y.LL....T...E....K...E.....K..............R..Y..........G.TPE...........RPLSKLGAI..A.YGRYWQLSVFKF.LN......Q..C.S..P.SD.............................NI.R.....M.E....DICRKTRMTLEDVFNTLRTHQ.LIS----------ltapptp................................................
#=GR G4TC41_PIRID/450-634    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H0ELF3_GLAL7/561-750               .............................................................WKHPPGD.EIY......R.......D.............G............N.......I..SMF...E.VDGR..KQ.......................S..L..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYVLT..E...Y...D..D...L...G.................................YH..FVGYFS.K..........E....KR....P....T....S.L.........N.NVSC...ILVLPI..........F.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...R....V...E.....K..............K..T..........G.SPE...........KPLSDMGLV..S.YRNYWRLVLCHY.LK......D..F.K..A.GD.............................QIpS.....I.K....TMSDDLGLTPDDIVSALEQLK.ALI----------rdpvtgtyalq............................................
#=GR H0ELF3_GLAL7/561-750    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
ESA1_DEBHA/250-419                 ............................................................m-KHPPGN.EIY......R.......D.............S............K.......V..SFW...E.IDGR..KQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYIMT..V...K...S..S...Q...G.................................HH..VVGYFS.K..........E....KE....S....A....D.G.........Y.NVAC...ILTLPC..........Y.....Q.KM..G..........FGKL.LIQF..........S................Y.ML....S...N....V...E.....N..............K..V..........G.SPE...........KPLSDLGLL..S.YRAFWTDTLVKL.LV......E..R.N..N.PH.............................LF.K.....K.-....---------------------.-------------nnpqllteasskdssvs......................................
#=GR ESA1_DEBHA/250-419      pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
#=GR ESA1_DEBHA/250-419      sAS   ..........................................................................................................................................................................................................................................................................................................................................*...........................................................................................................................................................................................................................................................................................................................................
F6W581_MONDO/590-777               .............................................................WFHPPAN.EIY......R.......R.............K............D.......L..SVF...E.VDGN..VS.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..K...N...D..E...K...G.................................CH..LVGYFS.K..........E....KL....C....Q....Q.K.........Y.NVSC...IMIMPQ..........Y.....Q.RQ..G..........FGRF.LIDF..........S................Y.LL....S...R....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YLAYWKSVILEY.LY......Y..H.H..E.K-.............................HI.S.....I.K....GISRATGMCPHDIATTLQHLS.MIDKREEKFVII-rr.....................................................
#=GR F6W581_MONDO/590-777    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G8YNB4_PICSO/264-468               ............................................................n-NHPPGV.EIY......R.......Dv...........eS............R.......I..AIW...E.VDGR..KN.......................I..N..YCQNLCLLAKLFLNSKTLY..YD.......V.EP.....FIFYVLT..E...L...D..H...D...Dp..............................tnYH..FVGYFS.K..........E....KL....N....N....S.D.........Y.NVSC...ILTLPI..........Y.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...R....S...E.....F..............K..Y..........G.TPE...........KPLSDLGLV..S.YRNYWKITIASK.LK......L..F.H..D.IYilnset.................enrehfPI.S.....V.E....CLSKLTGMTPSDVVVGLEQLN.ALIKNS-------dtttygi................................................
#=GR G8YNB4_PICSO/264-468    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G2QKQ9_THIHA/271-460               ............................................................l-QHPPGN.EIY......R.......D.............D............F.......I..SFF...E.IDGR..RQ.......................R..T..WCRNLCLLCKMFLDHKTLY..YD.......V.DP.....FLFYVMT..S...R...D..E...K...G.................................SH..IIGFFS.K..........E....KE....S....A....D.G.........Y.NVAC...ILTLPP..........Y.....Q.RK..G..........YGRL.LIQF..........S................Y.EL....S...K....I...E.....G..............K..L..........G.SPE...........KPLSDLGLL..S.YRQYWAENIIDL.LL......G..Y.S..E.SG............................eKC.T.....I.E....TIATRLAMTTQDVEHTLQALK.MQVYHKGEHKIV-ip.....................................................
#=GR G2QKQ9_THIHA/271-460    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H0WHS0_OTOGA/388-575               .............................................................WKHPPGD.EIY......R.......K.............G............S.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LIGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LH......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQALQ.MLKYWKGKHLV--lkr....................................................
#=GR H0WHS0_OTOGA/388-575    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G8JNR5_ERECY/210-396               ............................................................l-RHPPGN.EIY......R.......D.............D............Y.......I..SFF...E.IDGR..KQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMT..H...R...D..D...L...G.................................HH..LVGYFS.K..........E....KE....S....A....D.G.........Y.NVAC...ILTLPQ..........Y.....Q.RM..G..........YGRL.LIEF..........S................Y.EL....S...K....K...E.....N..............K..V..........G.SPE...........KPLSDLGLL..S.YRAYWSDTLIKL.LV......E..N.G..S.--.............................EV.T.....I.D....EISNMTSMTTTDILHTAKALN.ILLYYKGQHILFLn......................................................
#=GR G8JNR5_ERECY/210-396    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B1A1N2_DROME/1-83                  .............................................................-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...-...-..-...-...-.................................--..------.-..........-....--....-....-....-.-.........-.----...------..........-.....-.--..-..........----.----..........-................Y.LL....T...R....V...E.....G..............K..I..........G.SPE...........KPLSDLGLI..S.YRSYWKDVLLDY.LC......N..R.S..G.N-.............................TI.A.....I.K....DVSQEAAICSYDIVSTLQALG.MMKYWKGKHIV--lkk....................................................
A9RJM4_PHYPA/185-371               ............................................................l-KHPPGD.EIY......R.......Q.............G............S.......L..SMF...E.VDGK..KN.......................K..I..YGQNLCYLAKLFLDHKTLY..YD.......V.DL.....FLFYILC..E...C...D..D...R...G.................................CH..MVGYFS.K..........E....KH....S....E....E.G.........Y.NLAC...ILTLPP..........Y.....Q.RK..G..........YGKF.LIAF..........S................Y.EL....S...K....K...E.....G..............K..V..........G.TPE...........RPLSDLGLL..S.YRGYWTRILLDI.LK......K..H.R..G.--.............................NV.S.....I.K....ELSDMTAIKTEDVITTLQTLE.LIQYRKGQHVICAd......................................................
#=GR A9RJM4_PHYPA/185-371    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G5BYC4_HETGA/168-354               .............................................................WRQPPGK.EIY......R.......K.............S............N.......I..SVY...E.VDGK..DH.......................K..I..YCQNLCLLAKLFLDHKTLY..FD.......V.EP.....FVFYILT..E...V...D..R...Q...G.................................AH..IVGYFS.K..........E....KE....S....P....D.G.........N.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKF.LIAF..........S................Y.EL....S...K....L...E.....S..............T..V..........G.SPE...........KPLSDLGKL..S.YRSYWSWVLLEI.LR......D..F.R..G.--.............................TL.S.....I.K....DLSQMTSITQNDIISTLQSLN.MVKYWKGQHVICVt......................................................
#=GR G5BYC4_HETGA/168-354    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q4SBB6_TETNG/364-549               .............................................................WKHPPVM.RST......W.......K.............S............N.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LVGYFS.K..........-....--....-....-....M.V.........F.DIEI...MLTRPK..........I.....KsQY..G..........YKNLyLMCF.........qG................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LC......N..F.Q..G.K-.............................DI.S.....I.K....EISQETAVNPVDIVSTLQSLQ.MLKYWKGKHLI--lkr....................................................
#=GR Q4SBB6_TETNG/364-549    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G0SAK1_CHATD/592-785               ............................................................a-KHPPGD.EIY......R.......H.............G............S.......V..SVF...E.VDGR..KN.......................P..V..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYVLC..E...Y...D..E...L...G.................................YH..FVGYFS.K..........E....KR....A....S....S.Q.........N.NVSC...ILTLPI..........H.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...R....V...E.....K..............K..T..........G.SPE...........KPLSDMGLV..S.YRNYWRLVMCRY.LL......E..H.F..S.EEks........................gkmGL.S.....I.K....QISEDTGMTPDDVISALEGLR.ALVKDPQTQ----lyalr..................................................
#=GR G0SAK1_CHATD/592-785    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H9GJ04_ANOCA/562-749               .............................................................WFHPPAN.EIY......R.......K.............S............N.......V..SVF...E.VDGN..VS.......................T..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..Q...N...D..V...K...G.................................CH..LVGYFS.K..........E....KH....C....Q....Q.K.........Y.NVSC...IMILPQ..........Y.....Q.RK..G..........YGRF.LIDF..........S................Y.LL....S...K....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YMAYWKSVILEC.LY......H..Q.N..D.-K.............................QI.S.....I.K....KLSKLTGICPQDITSTLHHLR.MLDFRSDQFVIV-rr.....................................................
#=GR H9GJ04_ANOCA/562-749    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F9XIV7_MYCGM/285-478               ............................................................l-FHPPGN.EIY......R.......D.............D............N.......V..SFF...E.IDGR..RQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMT..T...R...S..E...H...G.................................HH..LIGYFS.K..........E....KE....S....A....E.G.........Y.NVAC...ILTLPQ..........H.....Q.RK..G..........YGAL.LIQF..........S................Y.EL....S...K....I...E.....G..............K..L..........G.SPE...........KPLSDLGLL..G.YRAYWQEMIVDV.LL......E..R.E..A.ENpg........................stgGI.A.....V.E....ELGATLAMTTNDVLHTLQNLN.MLRYSQKNHVIVLt......................................................
#=GR F9XIV7_MYCGM/285-478    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A8NQL2_BRUMA/261-446               ............................................................r-RQPPGD.EIY......R.......D.............G............N.......L..SVY...E.VDGK..TN.......................K..A..YCQCLCLLSKLFLDHKTLF..FD.......V.ET.....FLFYVLC..E...V...D..E...V...G.................................AH..VVGHFS.K..........E....RL....S....A....-.-.........N.NLAC...IMVLPP..........F.....Q.RK..G..........YGKL.LIQL..........S................Y.EL....S...S....R...E.....G..............V..I..........G.TPE...........KPLSDLGKV..S.YRSYWWWILLEA.LD......R..L.N..I.D-.............................DV.T.....V.S....DLSSASGVAEDDIISTLQTMQ.LIKYWKGDHVVR-mt.....................................................
#=GR A8NQL2_BRUMA/261-446    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
C4XWL1_CLAL4/92-291                ........................................................ayppl-----GT.LVY......A.......D.............S............Ks.....rR..VIK...R.IRGF..RH.......................E..L..FCQNLALFGKLFLDDKSVY..YN.......V.DA.....FDFYVVY..A...P...E..T...N...Hdag..........................erarLK..PMGFFS.K..........E....VN....A...wD....E.D.........N.NLAC...ICVFPP..........F.....Q.RL..R..........LGSL.LVEF..........S................Y.AL....A...R....V...Tp...gQ..............A..R..........S.GPE...........FPLSPFGQA..T.YLRFWAKRLAFV.IW.....nD..F.S..T.AE.............................SV.S.....L.R....DLADKTGFRKDDCLLALEYMG.VLFE---------aeeviler...............................................
#=GR C4XWL1_CLAL4/92-291     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
D2HQM4_AILME/200-386               .............................................................WRQPPGK.EIY......R.......K.............S............N.......I..SVY...E.VDGR..DH.......................K..I..YCQNLCLLAKLFLDHKTLY..FD.......V.EP.....FVFYILT..E...V...D..R...Q...G.................................AH..IVGYFS.K..........E....KE....S....P....D.G.........N.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKF.LIAF..........S................Y.EL....S...K....L...E.....S..............T..V..........G.SPE...........KPLSDLGKL..S.YRSYWSWVLLEI.LR......D..F.R..G.--.............................TL.S.....I.K....DLSQMTSITQNDIISTLQSLN.MVKYWKGQHVICVt......................................................
#=GR D2HQM4_AILME/200-386    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q383C5_TRYB2/257-365               ...........................................................hl--HPPGL.EIY......R.......D.............D............Tr.....gF..SMF...E.VNGS..RH.......................V..T..YCRHLFLLGKSFLENKLAG..HD.......V.HN.....YYFYVVC..L...H...H..R...H...Yphyt........................ddtsaMY..FVGYFT.W..........E....KQ....V....T....D.N.........-.NLAC...IVTLPY..........F.....M.GG..G..........----.----..........-................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------ass....................................................
#=GR Q383C5_TRYB2/257-365    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F2SE58_TRIRC/74-240                ...........................................................kd--SPLGT.QVY......K.......H.............G............G.......Y..SVW...E.VDGE..DQ.......................K..L..FAQNLSLFAKLFLDHKSVF..FD.......V.SS.....FLYYLLV..Y...TnpaD..P...D...D.................................YH..VLGFFS.K..........E....KM....S....W....D.A.........N.NLAC...ILIFPP..........Y.....Q.HK..Q..........LGKL.LMGI..........S................Y.KL....S...A....W...Ew..ndG..............V..I..........G.GPE...........KPLSEMGHK..S.YVRFWEERMARF.LL......H..V.S..T.S-.............................--.-.....-.-....---------------------.-------------gvkdeqpkasnak..........................................
#=GR F2SE58_TRIRC/74-240     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F2QR92_PICP7/243-441               ............................................................k-YMPPGN.EIY......R.......D.............R............C.......V..SVF...E.VDGR..KN.......................T..I..YCQNLCLLAKLFLNSKTLY..YD.......V.EP.....FMFYVLY..E...I...K..P...A...S.................................EHysFVGYFS.K..........E....KL....N....S....T.N.........Y.NVSC...ILTLPT..........H.....Q.RK..G..........YGNF.LIEF..........S................Y.LL....T...R....R...E.....Y..............K..L..........G.TPE...........KPLSELGLL..S.YRNYWKHTVCRS.IK......W..I.I..D.NVspem.....................lpflTV.S.....I.S....DICDISGMVANDVVTALEQLE.MLVKQHDQK----ygilv..................................................
#=GR F2QR92_PICP7/243-441    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G9NAG4_HYPVG/274-463               ............................................................l-QHPPGN.EIY......R.......D.............D............Y.......V..SFF...E.IDGR..RQ.......................R..T..WCRNLCLLSKMFLDHKTLY..YD.......V.DP.....FLFYVMT..M...R...T..D...K...G.................................CH..IVGYFS.K..........E....KE....S....A....D.A.........Y.NVAC...ILTLPQ..........Y.....Q.RK..G..........YGRL.LIQF..........S................Y.EL....S...K....I...E.....G..............K..L..........G.SPE...........KPLSDLGLL..S.YRQYWSENILDL.LL......G..Y.N..E.RD............................eKV.T.....I.E....AISSALAMTTQDVEHTLQAMK.MQVYHKSDHKIV-ip.....................................................
#=GR G9NAG4_HYPVG/274-463    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q9U3C3_CAEEL/241-443               ............................................................v-RQPPGN.EIY......R.......K.............D............H.......L..SVY...E.VDGS..GQklfqpffa......pfppklpifQ..L..YCQCLCLLSKLFMDHKTLY..FD.......V.DD.....FMFYVLC..E...T...D..E...H...G.................................AH..IVGYFS.R..........E....VE....S....-....-.A.........N.NLAC...IMVFPP..........F.....Q.KK..G..........YGKL.LIQF..........S................Y.EL....S...R....R...E.....G..............Y..I..........G.MPE...........KPLSDLGKV..S.YRSYWWWRLMKL.FH......I..H.Q..G.-H.............................TV.T.....A.T....FLSNESGIAVDDIVSTLITMR.MCRQYKEPEFI--pge....................................................
#=GR Q9U3C3_CAEEL/241-443    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G6CN11_DANPL/553-740               .............................................................WRHPPGD.EVY......R.......K.............D............N.......L..SVW...Q.VDGR..KH.......................K..Q..YCQQLCLLAKFFLDHKTLY..YD.......V.EP.....FLFYVMT..C...A...D..D...E...G.................................CH..IVGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTLPP..........Y.....Q.RQ..G..........YGRL.LIDF..........S................Y.LL....T...K....V...E.....G..............K..V..........G.SPE...........TPLSDLGLI..S.YRSYWKEALLKR.LC......S..A.S..G.S-.............................TL.C.....I.R....DLSKDLAIASSDIVSTLQERG.LMKYWKGKHIV--lkk....................................................
#=GR G6CN11_DANPL/553-740    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B4KHA7_DROMO/222-416               ............................................................l-KHPPGS.EIY......R.......K.............D............S.......I..SFF...E.IDGR..QN.......................K..L..YAQNLCLLAKLFLDHKMVD..FD.......T.DP.....FLFYVLT..E...F...D..S...R...G.................................FH..IVGYFS.K..........E....KI....S....V....E.D.........Y.NLAC...VLTLPP..........Y.....Q.RK..G..........YGKL.LIEF..........S................Y.EL....S...K....Y...E.....G..............K..T..........G.TPE...........KPLSDLGLL..S.YRSFWARAILEL.II......K..Q.N..Q.SAaeg.......................vrpST.S.....I.N....DICEQTAIKKDDVIYTLKWLN.LLTYCRGQHIVCIs......................................................
#=GR B4KHA7_DROMO/222-416    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B9WKY3_CANDC/282-488               ............................................................n-NHPPGL.EIY......R.......Dp...........kN............K.......I..SIW...E.VDGR..KN.......................I..S..YCQNLCLLAKLFLNSKTLY..YD.......V.EP.....FIFYVLT..E...I...D..E...K...Np..............................snYH..FVGYFS.K..........E....KL....N....S....S.D.........Y.NVSC...ILTLPI..........Y.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....S...R....N...E.....F..............K..Y..........G.TPE...........KPLSDLGLL..S.YRNYWRVTIAYK.LK......Q..I.Y..D.KYlannang...............dsnnsrlSL.S.....V.D....ILCKLTGMIPSDVIVGLEQLD.S------------lvrnplthtyai...........................................
#=GR B9WKY3_CANDC/282-488    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q6GPW8_XENLA/396-583               .............................................................WKHPPGD.EIY......R.......K.............S............S.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...A...G.................................CH..LIGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....D..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LH......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQALQ.MLKYWKGKHLV--lkr....................................................
#=GR Q6GPW8_XENLA/396-583    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E1F974_GIAIA/251-379               ..........................................................pnd-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...Q...D..D...D...S.................................YH..FVGFFS.K..........E....KQ....Q....E....N.-.........-.SLSC...IVALPC..........F.....Q.KK..G..........YGNM.MINF..........S................Y.ML....S...S....R...E.....C..............R..L..........G.GPE...........MPLSDLGLM..S.YLSYWKRRICEV.LV......R..N.T..T.S-.............................EI.S.....L.F....EISKQTMISYRNLIMAMNKYG.LLKETPSN-----taiyf..................................................
KAT7_MOUSE/392-579                 .............................................................WKHPPGD.EIY......R.......K.............G............S.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LIGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LH......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQALQ.MLKYWKGKHLV--lkr....................................................
#=GR KAT7_MOUSE/392-579      pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
#=GR KAT7_MOUSE/392-579      sAS   ..........................................................................................................................................................................................................................................................................................................................................*...........................................................................................................................................................................................................................................................................................................................................
C4R6T5_PICPG/239-425               ............................................................l-RHPPGN.EIY......R.......D.............D............V.......V..SFF...E.IDGR..RQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMT..I...R...D..D...L...G.................................HH..LVGYFS.K..........E....KE....S....A....D.N.........Y.NVAC...ILTLPQ..........Y.....Q.RH..G..........YGKL.LIQF..........S................Y.EL....S...K....T...E.....G..............K..V..........G.SPE...........KPLSDLGLL..S.YRAYWADTIVKL.LM......E..N.G..T.E-.............................-T.T.....I.D....EISAQTSMTTTDILHTLQTLN.MLKYYKGQHIICLt......................................................
#=GR C4R6T5_PICPG/239-425    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G6DER4_DANPL/215-401               ............................................................a-RQPQGS.EIY......R.......K.............G............T.......I..AIF...E.ADGK..EH.......................K..I..YCQNLCLLAKLFLDHKTLY..FD.......I.EQ.....FLFYILC..E...V...D..K...H...G.................................AH..LVGYFS.K..........E....KD....S....P....E.G.........N.NVAC...ILTLPP..........Y.....Q.RQ..G..........YGKL.LIAF..........S................Y.EL....S...R....L...E.....Q..............V..V..........G.SPE...........KPLSDLGKL..S.YRSYWSYVLLEV.LS......A..S.R..G.--.............................TL.S.....I.K....DLSQMTGISQTDIISTLQSMN.MVKYWKGQHVICVt......................................................
#=GR G6DER4_DANPL/215-401    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E2A1K0_CAMFO/226-412               ............................................................h-RQPVGK.EIY......R.......K.............G............T.......L..SIW...E.VDGR..EH.......................K..I..YCQNLCLLAKLFLDHKTLY..FD.......V.EP.....FLFYILC..E...V...D..K...H...G.................................AH..LVGYFS.K..........E....KE....S....P....D.G.........N.NVAC...ILTLPP..........F.....Q.RQ..G..........YGKL.LIAF..........S................Y.EL....S...R....I...E.....Q..............T..V..........G.SPE...........KPLSDLGKL..S.YRSYWSWILLEI.LR......D..F.R..G.--.............................TL.S.....I.K....DLSQMTSISQTDIISTLQSMN.MVKYWKGQHVICVt......................................................
#=GR E2A1K0_CAMFO/226-412    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E2R922_CANFA/561-748               .............................................................WFHPPAN.EIY......R.......K.............N............N.......I..SVF...E.VDGN..VS.......................T..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..Q...N...D..V...K...G.................................CH..LVGYFS.K..........E....KH....C....Q....Q.K.........Y.NVSC...IMILPQ..........Y.....Q.RK..G..........YGRF.LIDF..........S................Y.LL....S...K....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YMAYWKSVILEC.LY......H..Q.N..D.-K.............................QI.S.....I.K....KLSKLTGICPQDITSTLHHLR.MLDFRSDQFVII-rr.....................................................
#=GR E2R922_CANFA/561-748    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
D7RTH9_LEIDO/276-465               ............................................................l-RHPPGN.EIY......R.......D.............Pv..........rR.......L..VVL...E.LDGS..LE.......................P..T..FCEHLALLSKLFLEHKALD..HD.......M.TP.....FLFYVLC..S...M...E..T...H...G.................................LQ..VLGYFS.K..........E....KQ....T....P....E.P.........Y.NLSC...ILVLPQ..........Y.....Q.SR..G..........IGRF.LIEL..........S................Y.EL....S...R....R...E.....G..............K..V..........G.TPE...........KPLSDLGEK..L.YLSYWADSVTMA.IA......R.aM.E..E.GH.............................CV.S.....V.D....YLVQATAMIQADVIRALQHQK.LLN----------ghqltised..............................................
#=GR D7RTH9_LEIDO/276-465    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
D4B5X6_ARTBC/294-481               ............................................................l-LHPPGN.EIY......R.......D.............D............H.......V..SFF...E.VDGR..RQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMT..T...R...D..A...N...G.................................CH..LVGYFS.K..........E....KE....S....A....E.G.........Y.NVAC...ILTLPQ..........Y.....Q.RR..G..........FGRL.LIAF..........S................Y.EL....S...K....R...E.....G..............K..L..........G.SPE...........KPLSDLGLL..S.YRQYWRETLVEL.LV......E..P.G..R.D-.............................AI.S.....E.S....ELATLSAMTEKDVHETLVVLG.LLRYNKGNWVL--vlt....................................................
#=GR D4B5X6_ARTBC/294-481    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H2UZF9_TAKRU/348-535               .............................................................WKHPPGD.EVY......R.......K.............G............S.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LVGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........FGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.MY......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQSLQ.MLKYWKGKHLV--lkr....................................................
#=GR H2UZF9_TAKRU/348-535    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H2UGV9_TAKRU/573-759               .............................................................WFHPPAN.EIY......R.......K.............E............D.......V..SVF...E.VDGN..VS.......................T..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..Q...N...D..S...K...G.................................CH..LVGYFS.K..........E....KH....C....Q....Q.K.........Y.NVSC...IMILPQ..........Y.....Q.RK..G..........YGRF.LIDF..........S................Y.LL....S...K....R...E.....G..............Q..P..........G.SPE...........KPLSDLGRL..S.YMAYWRSVVLEC.LH......E..V.Q..D.R-.............................QI.T.....I.R....QLSKLTGICPQDITTTLHSLN.MLEQRGD------rlvlvr.................................................
#=GR H2UGV9_TAKRU/573-759    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E2B5G0_HARSA/1-83                  .............................................................-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...-...-..-...-...-.................................--..------.-..........-....--....-....-....-.-.........-.----...------..........-.....-.--..-..........----.----..........-................Y.LL....T...R....V...E.....K..............K..I..........G.SPE...........KPLSDLGLI..S.YRSYWKDVLLQY.LC......N..F.G..G.K-.............................EL.S.....V.K....DISKEMAIDSYDIVSTLQALG.MMKYWKGKHIIL-kk.....................................................
E9EPL9_METAR/581-774               ............................................................t-KHPPGD.EIY......R.......H.............E............S.......V..SIF...E.VDGR..KH.......................P..V..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYVLC..E...F...D..D...T...G.................................YH..FVGYFS.K..........E....KR....A....S....S.Q.........N.NVSC...ILTLPI..........H.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...K....A...E.....E..............K..T..........G.SPE...........KPLSDMGLV..S.YRNYWRLELCRY.FL......G..Y.M..E.SDtr........................rreGL.S.....I.K....KISTNTGMTPDDVVSALEGLR.ALVRDPQTH----lyafr..................................................
#=GR E9EPL9_METAR/581-774    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G4VKY3_SCHMA/838-967               ....................................................iktrnvylr-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...-...-..-...-...-.................................--..------.-..........-....--....-....-....-.-.........-.----...------..........H.....I.KQ..A..........YGRF.LIDF..........S................F.LL....S...R....I...E.....G..............Q..P..........G.SPE...........KPLSQLGNL..S.YQSYWRSKVLPF.LL......C..S.M..K.DCkllnstmpncetdsdclanpvgsigfrdfVI.T.....I.H....EISSTTGIDPHDVASTIQQLA.-------------ttitlsad...............................................
E9NMR3_9MUSC/87-215                ............................................................k-RKPPGR.EIY......R.......K.............G............T.......I..SIF...E.VNGK..EE.......................P..L..YCQLLCLMAKLFLDHKVLY..FD.......M.DP.....FFFYVLC..E...I...D..M...E...G.................................SH..IVGYFS.K..........E....KK....S....Q....D.N.........N.NVAC...ILVLPP..........H.....Q.RK..G..........YGKL.LIAF..........S................Y.EL....S...R....K...E.....G..............V..I..........G.SPE...........KPLSDLGRL..S.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------.......................................................
#=GR E9NMR3_9MUSC/87-215     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q9DF19_CHICK/235-282               ............................................................l-RHPPGN.EIY......R.......K.............G............T.......I..SFF...E.IDGR..KN.......................K..S..YSQNLCLLAKCFLDHKTLY..YD.......-.--.....-------..-...-...-..-...-...-.................................--..------.-..........-....--....-....-....-.-.........-.----...------..........-.....-.--..-..........----.----..........-................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------.......................................................
#=GR Q9DF19_CHICK/235-282    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B4LS29_DROVI/599-790               .............................................................WRHPPGD.EIY......R.......K.............G............K.......L..QVW...Q.VDGK..RY.......................K..Q..YCQHLCLLAKFFLDHKTLY..YD.......V.EP.....FLFYIMT..L...A...D..V...D...G.................................CH..IVGYFS.K..........HipflQE....K....N....S.F.........Y.NVSC...ILTLPP..........Y.....Q.RK..G..........YGRL.LIDF..........S................Y.LL....T...R....V...E.....G..............K..I..........G.SPE...........KPLSDLGLI..S.YRSYWKDVLLDY.LC......N..R.S..G.N-.............................TL.C.....I.K....DVSQEMAIYSYDIVSTLQALG.MMKYWKGKHIV--lkk....................................................
#=GR B4LS29_DROVI/599-790    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E3MHB0_CAERE/738-833               .........................................................yepd-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...-...-..-...-...-.................................--..------.-..........-....--....-....-....-.-.........-.----...------..........-.....-.--..-..........----.VIDL..........R................Y.AL....S...R....R...E.....G..............W..N..........G.GPE...........QPLSDLGKK..A.YGGYWKNTSAVS.LV......K..M.K..D.RIef........................ggrGI.S.....I.E....DIAHDTGINSHDVISVVCSLG.WAKIMT-------gislck.................................................
Q29NY2_DROPS/605-796               .............................................................WRHPPGD.EIY......R.......K.............G............K.......L..QVW...Q.VDGK..RH.......................K..Q..YCQHLCLLAKFFLDHKTLY..YD.......V.EP.....FLFYIMT..L...A...D..I...D...G.................................CH..IVGYFS.K..........HipflQE....K....N....S.F.........Y.NVSC...ILTLPP..........Y.....Q.RK..G..........YGRL.LIDF..........S................Y.LL....T...R....V...E.....G..............K..I..........G.SPE...........KPLSDLGLI..S.YRSYWKDVLLDY.LC......N..R.S..G.N-.............................TL.N.....I.K....DVSQEMAIYSYDIVSTLQALG.MMKYWKGKHIV--lkk....................................................
#=GR Q29NY2_DROPS/605-796    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
KAT7_HUMAN/390-577                 .............................................................WKHPPGD.EIY......R.......K.............G............S.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LIGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LH......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQALQ.MLKYWKGKHLV--lkr....................................................
#=GR KAT7_HUMAN/390-577      pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
#=GR KAT7_HUMAN/390-577      sAS   ..........................................................................................................................................................................................................................................................................................................................................*...........................................................................................................................................................................................................................................................................................................................................
C4JS19_UNCRE/543-623               ............................................................v-KHPPGD.EIY......R.......E.............G............T.......I..SVF...E.VDGR..KN.......................P..V..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYVMT..E...Y...D..E...L...G.................................FH..FVGYFS.K..........E....KR....P....K....-.-.........-.----...------..........-.....-.--..-..........----.----..........-................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------rkv....................................................
#=GR C4JS19_UNCRE/543-623    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A4HQM2_LEIBR/73-267                ..........................................................afw---IPGD.EVY......R.......D.............E............Eh.....rF..CVF...A.LDGR..KP.......................Q..CvaLARRICLLSKLFLVDKVTL..DD.......V.HF.....FSFMALF..E...V...D..D...E...G.................................FH..FVGYFS.K..........E....WT....S....S....T.Sc.......vN.TLSC...VMVLPP..........F.....R.SK..G..........YGGF.LVRL..........S................Y.EM....A...R....V...E.....G..............I..V..........G.TPE...........RPLSTSGNA..L.FRRVWREEVLFA.VF......A..L.E..E.RG............................iPI.T.....I.G....ELSKASSLIIEDVLVALQDLD.VL-----------fsvgkqgpllv............................................
#=GR A4HQM2_LEIBR/73-267     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
I1GS50_BRADI/217-403               ............................................................l-KHPPGD.EIY......R.......C.............G............T.......L..SMF...E.VDGK..KN.......................K..V..YGQNLCYLAKLFLDHKTLY..YD.......V.DL.....FLFYILC..E...C...D..D...R...G.................................CH..MVGYFS.K..........E....KH....S....E....E.S.........Y.NLAC...ILTLPP..........Y.....Q.RK..G..........YGKF.LIAF..........S................Y.EL....S...K....K...E.....G..............K..V..........G.TPE...........RPLSDLGLL..S.YRGYWTRVLLEI.LK......K..H.K..S.--.............................NI.S.....I.K....ELSDMTAIKADDILSTLQSLD.LIQYRKGQHVICAd......................................................
#=GR I1GS50_BRADI/217-403    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B1A1U4_DROME/4-35                  ..........................................................flq-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...-...-..-...-...-.................................--..------.-..........-....-E....K....N....S.F.........Y.NVSC...ILTLPP..........Y.....Q.RK..G..........YGRL.LIDF..........-................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------.......................................................
E9NMR5_9MUSC/87-215                ............................................................k-RKPPGR.EIY......R.......K.............G............T.......I..SIF...E.VNGK..EE.......................P..L..YCQLLCLMAKLFLDHKVLY..FD.......M.DP.....FYFYVLC..E...I...D..M...E...G.................................SH..IVGYFS.K..........E....KK....S....Q....D.N.........N.NVAC...ILVLPP..........H.....Q.RK..G..........YGKL.LIAF..........S................Y.EL....S...R....K...E.....G..............V..I..........G.SPE...........KPLSDLGRL..S.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------.......................................................
#=GR E9NMR5_9MUSC/87-215     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A4ICE0_LEIIN/59-253                ..........................................................afw---IPGD.EIY......R.......D.............E............Er.....rL..CVF...V.LDGR..KPh.....................cA..A..MARRICLLSKLFLIDKVTL..DD.......V.HF.....FSFNALF..E...V...D..D...E...G.................................FH..FVGYFS.K..........E....WM....S....S....S.Sc.......vN.TLSC...VMVLPP..........F.....R.SK..G..........YGSF.LVRL..........S................Y.EI....A...R....L...E.....G..............M..V..........G.TPE...........RPLSKSGNA..L.FRKVWREEVLLA.VF......A..L.S..E.QG............................sPV.T.....L.G....ELSKVSSLIVEDVLVALQDLN.VLF----------svgkqgpllv.............................................
#=GR A4ICE0_LEIIN/59-253     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G0PAD0_CAEBE/659-853               .............................................................WRAPPGV.EIY......R.......K.............D............N.......I..SIF...E.VDGH..KQ.......................K..R..YCESLCLLSRCFLESKTNF..WD.......T.DA.....FFFYIIT..Q...N...D..E...V...G.................................CH..FAGYFS.K..........E....KY....E....S....E.N.........-.NVNC...IVALPC..........Y.....Q.AK..G..........YGRF.LIDV..........S................Y.AL....S...R....K..qE.....N..............W..I..........A.GPE...........LPFSELGER..A.YASYWKTAVAKA.LA......D..F.K..E.DIegr.......................sgdGI.S.....V.V....DITHATGINVHDVLKTLQDLK.WIKLERGEKK---kekt...................................................
#=GR G0PAD0_CAEBE/659-853    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B1A1Q0_DROME/1-83                  .............................................................-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...-...-..-...-...-.................................--..------.-..........-....--....-....-....-.-.........-.----...------..........-.....-.--..-..........----.----..........-................Y.LL....T...R....V...E.....G..............K..I..........G.SPE...........KPLSDLGLI..S.YRSYWKDVLLDY.LC......N..R.S..G.N-.............................TI.A.....I.K....DVSQETAIYSYDIVSTLQALG.MMKYWKGKHIV--lke....................................................
Q2QEH8_TOXGO/285-475               ............................................................l-RHPPGD.EIY......R.......E.............G............R.......L..SVF...E.VDGS..VA.......................R..V..YSENLCFLAKLFLDHKTLQ..YD.......V.EP.....FLFYVLT..E...V...D..R...T...G.................................CH..LIGYFS.K..........E....KI....S....L....Q.A.........Y.NLAC...ILTMPQ..........H.....Q.RK..G..........YGRF.LISF..........S................Y.LL....S...L....R...E.....K..............K..K..........G.GPE...........RPLSDLGRL..S.YIGWWTWCLLTH.ME......S..D.A..Q.KRr...........................rKI.S.....I.E....DLVRNTAVREEDIQRTLEEIG.VLRYVQGHHLL--llh....................................................
#=GR Q2QEH8_TOXGO/285-475    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E2RE53_CANFA/233-425               ............................................................l-RHPPGN.EIY......R.......K.............G............T.......I..SFF...E.IDGR..KN.......................K..S..YSQNLCLLAKCFLDHKTLY..YD.......T.DP.....FLFYVMT..E...Y...D..C...K...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKL.LIEF..........S................Y.EL....S...K....V...E.....G..............K..T..........G.TPE...........KPLSDLGLL..S.YRSYWSQTILEI.LM......G..L.K..S.ESge.........................rpQI.T.....I.N....EISEITSIKKEDVISTLQYLN.LINYYKGQYILT-ls.....................................................
#=GR E2RE53_CANFA/233-425    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E9E0M7_METAQ/579-772               ............................................................t-KHPPGD.EIY......R.......H.............E............S.......V..SIF...E.VDGR..KH.......................P..V..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYVLC..E...F...D..D...T...G.................................YH..FVGYFS.K..........E....KR....A....S....S.Q.........N.NVSC...ILTLPI..........H.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...K....A...E.....E..............K..T..........G.SPE...........KPLSDMGLV..S.YRNYWRLELCRY.FL......G..Y.M..E.SDar........................rreGL.S.....I.K....KISINTGMTPDDVVSALEGLR.ALVRDPQTH----lyafr..................................................
#=GR E9E0M7_METAQ/579-772    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
MST2_SCHPO/156-342                 ............................................................w-SYPPGD.EIY......R.......D.............K............N.......I..SIF...E.VDGQ..RQ.......................P..I..YCQNLCLLAKMFLHSKMLY..YD.......V.EP.....FLFYVLT..E...F...D..G...Q...E.................................CK..VIGYFS.K..........E....KR....S....A....S.D.........Y.NVSC...ILTLPI..........Y.....Q.RR..G..........YGVF.LIDF..........S................Y.LL....T...Q....V...E.....G..............K..L..........G.SPE...........KPLSDLGLV..T.YRSYWKMRVAKA.LL......E..I.T..T.P-.............................-I.S.....I.N....AIAKSTSMVCDDVISTLESLS.VFKYDPLKKKY--vlq....................................................
#=GR MST2_SCHPO/156-342      pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
#=GR MST2_SCHPO/156-342      sAS   ..........................................................................................................................................................................................................................................................................................................................................*...........................................................................................................................................................................................................................................................................................................................................
I1CVJ9_RHIO9/231-320               .........................................................nnin-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...-...-..-...-...-.................................--..------.-..........-....--....-....-....-.-.........-.----...------..........-.....-.--..-..........----.--EL..........G................Y.EL....S...K....H...E.....L..............K..I..........G.SPE...........KPLSPLGAL..G.YQSYWSSTIIAT.LL......H..F.R..G.--.............................DV.T.....I.E....EICKETCIHEQDVIDTLSRLD.LLRFRREED----krehic.................................................
I1C292_RHIO9/222-405               ............................................................v-RYPPGN.EVY......R.......E.............N............K.......I..SIF...E.VDGR..KN.......................K..I..YCQNLCLMAKMFLDHKTLY..YD.......V.EP.....FLFYIMT..E...V...D..E...H...G.................................YH..FIGYFS.K..........E....KR....S....A....M.N.........Y.NVSC...ILTMPI..........Y.....Q.RK..G..........YGQF.LIDF..........S................Y.LL....S...K....K...E.....H..............K..A..........G.TPE...........RPLSDLGLL..S.YRSYWKTAVFKE.LK......L..Q.K..G.P-.............................-I.S.....I.E....ETNQM----------------.-------------lnhdpvtntysilidpktiedhlnhvd............................
#=GR I1C292_RHIO9/222-405    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G1PHE9_MYOLU/390-577               .............................................................WKHPPGD.EIY......R.......K.............G............S.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LIGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LH......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQALQ.MLKYWKGKHLV--lkr....................................................
#=GR G1PHE9_MYOLU/390-577    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E5RYE8_TRISP/104-266               ............................................................l-FHPPGD.EIY......R.......Q.............G............N.......L..SFF...E.VDGN..KS.......................K..A..YCQNLCLLAKLFIDHKTLL..YD.......V.EP.....FLFYVLT..L...K...D..K...T...G.................................FH..LVGYFS.K..........E....KF....N....V....Q.K.........F.NVSC...IMTLPA..........F.....Q.KK..G..........YGRF.LIDF..........S................Y.LL....S...K....R...E.....G..............I..L..........G.TPE...........RPLSELGRI..S.YESYWRYVIMKY.LS......E..H.R..N.EK.............................TL.S.....C.K....---------------------.-------------gkhelviff..............................................
#=GR E5RYE8_TRISP/104-266    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
ESA1_YARLI/243-430                 ............................................................l-RHPPGN.EIY......R.......D.............E............A.......V..SFF...E.IDGR..KQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMT..R...R...D..E...K...G.................................HH..LVGYFS.K..........E....KE....S....A....E.G.........Y.NVAC...ILTLPQ..........Y.....Q.RH..G..........YGRL.LIDF..........S................Y.AL....S...K....A...E.....G..............K..T..........G.SPE...........KPLSDLGLL..S.YRAYWADTIIEL.LM......E..K.G..K.-Q.............................EM.T.....I.E....DIASVTAMTTTDVLHTLQTYN.MLKYYKGQHIICLt......................................................
#=GR ESA1_YARLI/243-430      pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
#=GR ESA1_YARLI/243-430      sAS   ..........................................................................................................................................................................................................................................................................................................................................*...........................................................................................................................................................................................................................................................................................................................................
H2UGW3_TAKRU/600-786               .............................................................WFHPPAN.EIY......R.......K.............E............D.......V..SVF...E.VDGN..VS.......................T..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..Q...N...D..S...K...G.................................CH..LVGYFS.K..........E....KH....C....Q....Q.K.........Y.NVSC...IMILPQ..........Y.....Q.RK..G..........YGRF.LIDF..........S................Y.LL....S...K....R...E.....G..............Q..P..........G.SPE...........KPLSDLGRL..S.YMAYWRSVVLEC.LH......E..V.Q..D.R-.............................QI.T.....I.R....QLSKLTGICPQDITTTLHSLN.MLEQRGD------rlvlvr.................................................
#=GR H2UGW3_TAKRU/600-786    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H3DH88_TETNG/564-750               .............................................................WFHPPAN.EIY......R.......K.............D............D.......V..SVF...E.VDGN..VS.......................T..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..Q...N...D..S...K...G.................................CH..LVGYFS.K..........E....KH....C....Q....Q.K.........Y.NVSC...IMILPQ..........Y.....Q.RK..G..........YGRF.LIDF..........S................Y.LL....S...K....R...E.....G..............Q..P..........G.SPE...........KPLSDLGRL..S.YMAYWRSVVLEC.LH......E..V.Q..D.R-.............................QI.T.....I.R....QLSKLTGICPQDITTTLHSLG.MLEQRGD------rlvlvr.................................................
#=GR H3DH88_TETNG/564-750    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G4MSW6_MAGO7/600-793               ............................................................a-KHPPGD.EIY......R.......H.............G............S.......V..SVF...E.VDGR..KN.......................P..V..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYVLC..E...Y...D..E...Y...G.................................YH..FVGYFS.K..........E....KR....A....S....S.Q.........N.NVSC...ILTLPI..........H.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...R....V...E.....K..............K..T..........G.SPE...........KPLSDMGLV..S.YRNYWRLVLCQY.FI......E..H.V..P.EDke........................kqiGL.S.....V.K....QISDDTGMTADDVVAALEGLR.CLVRDPQTE----lyafr..................................................
#=GR G4MSW6_MAGO7/600-793    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B7FPT7_PHATC/73-269                ............................................................t-RQPPGK.RIY......H.......Qplpn.....dedaS............Y.......L..DVY...E.LDGQ..DA.......................K..L..YCQKLCLLAKLFLDHKTLY..YD.......V.TP.....FYFYVVA..K...V...D..D...H...G.................................SH..IVGYFS.K..........E....KV....S....G....E.G.........Y.NLAC...ILTFPP..........Y.....Q.KA..G..........FGKF.IISL..........S................Y.EL....S...K....R...E.....N..............K..T..........G.SPE...........KPLSDLGKV..S.YRSYWTHVLLSV.LY......E..H.D..P.QQ.............................DL.S.....I.A....DLSLTTGIKQEDILSTLQQLE.MIKVWKGQHVVY-vk.....................................................
#=GR B7FPT7_PHATC/73-269     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G7PPH5_MACFA/318-510               ............................................................l-RHPPGN.EIY......R.......K.............G............T.......I..SFF...E.IDGR..KN.......................K..S..YSQNLCLLAKCFLDHKTLY..YD.......T.DP.....FLFYVMT..E...Y...D..C...K...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKL.LIEF..........S................Y.EL....S...K....V...E.....G..............K..T..........G.TPE...........KPLSDLGLL..S.YRSYWSQTILEI.LM......G..L.K..S.ESge.........................rpQI.T.....I.N....EISEITSIKKEDVISTLQYLN.LINYYKGQYILT-ls.....................................................
#=GR G7PPH5_MACFA/318-510    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E9C2U4_CAPO3/290-476               ............................................................l-RHPPGN.EIY......R.......K.............D............T.......L..SVF...E.IDGR..KH.......................R..N..YAQNLCLLAKLFLDHKTLY..YD.......T.DP.....FLFYIMC..E...I...D..D...R...G.................................SH..LVGYFS.K..........E....KE....S....S....E.D.........Y.NVAC...ILTLPQ..........Y.....Q.RK..G..........YGRL.LIEF..........S................Y.EL....S...K....I...E.....A..............K..V..........G.SPE...........KPLSDLGLL..S.YRSYWSFAILET.LR......N..Y.Q..G.S-.............................-M.A.....I.A....DLSAYTCIKREDVLSTLQHLN.LIKYYKGQYVIV-ip.....................................................
#=GR E9C2U4_CAPO3/290-476    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F8PYZ2_SERL3/366-549               ............................................................a-RHPPGD.EIY......R.......D.............G............A.......V..SIF...E.VDGR..KN.......................K..I..YCQNLCLLSRMFLDHKSLF..YD.......V.EP.....FLFYVMT..E...V...D..D...V...G.................................AR..FVGYFS.K..........E....KR....S....P....K.D.........Y.NVSC...IMTLPV..........R.....Q.RQ..G..........WGGL.LIDF..........S................Y.LL....S...K....K...E.....Q..............R..S..........G.SPE...........KPLSGLGAL..G.YKNYWTLAVMRY.LA......T..A.P..D.D-.............................-P.H.....L.E....DISKATSMTIEDIHVTLTQQN.MIFHR--------eatpqp.................................................
#=GR F8PYZ2_SERL3/366-549    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G2WSR7_VERDV/407-618               .....................................................hveevvrd-------.---......-.......Q.............G............E.......W..SVW...E.VDGE..VD.......................G..L..FCQNLSLFAKLFLDNKSVF..FD.......V.TG.....FTYFLLV..Y...T...P..P...A...Ppptgppddpsq..........pavdtsdekpvrPH..IVGFFS.K..........E....KM....S....W....D.N.........N.NLAC...ILVFPP..........W.....Q.RK..G..........LGAL.LMGV..........S................Y.EI....S...R....R...E.....G..............V..L..........G.GPE...........KPISDLGRK..G.YRRFWGGEIARW.LL......G..I.G..G.IAgald....................sseetLV.D.....V.G....DCSRGTWIALDDCLATLREMG.LLQ----------dagvg..................................................
#=GR G2WSR7_VERDV/407-618    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B9GUG6_POPTR/227-413               ............................................................l-KHPPGD.EIY......R.......S.............G............T.......L..SMF...E.IDGK..KN.......................K..V..YGQNLCYLAKLFLDHKTLY..YD.......V.DL.....FLFYILC..E...C...D..D...R...G.................................CH..MVGYFS.K..........E....KH....S....E....E.S.........Y.NLAC...ILTLPP..........Y.....Q.RK..G..........YGKF.LIAF..........S................Y.EL....S...K....K...E.....G..............K..V..........G.TPE...........RPLSDLGLL..S.YRGYWTRVLLDI.LK......R..H.K..G.--.............................NI.S.....I.K....ELSDMTAIKAEDILTTLQSLE.LIQYRKGQHVICAd......................................................
#=GR B9GUG6_POPTR/227-413    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H2UIL0_TAKRU/392-579               .............................................................WKHPPGD.EIY......R.......K.............G............N.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LVGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LC......N..F.Q..G.K-.............................DI.S.....I.K....EISQETAVNPVDIVSTLQSLQ.MLKYWKGKHLI--lkr....................................................
#=GR H2UIL0_TAKRU/392-579    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F0XSR0_GROCL/276-465               ............................................................l-QHPPGN.EIY......R.......D.............S............Y.......V..SFF...E.IDGR..RQ.......................R..T..WCRNLCLLSKMFLDHKTLY..YD.......V.DP.....FLFYVMA..A...R...D..E...R...G.................................VH..LVGYFS.K..........E....KE....S....A....D.N.........Y.NVAC...ILTLPQ..........F.....Q.RK..G..........YGRL.LIQF..........S................Y.EL....S...R....I...E.....G..............K..L..........G.SPE...........KPLSDLGLL..S.YRQYWTENIIDL.LA......G..Y.N..E.RG............................dKC.S.....I.E....IIANALAMTTQDVEHTLQALH.MQVYHKGEHKV--vip....................................................
#=GR F0XSR0_GROCL/276-465    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E4ZQ49_LEPMJ/273-460               ............................................................l-LHPPGN.EIY......R.......D.............D............Y.......V..SFF...E.IDGR..RQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMC..T...R...D..E...H...G.................................CH..FVGYFS.K..........E....KE....S....A....E.G.........Y.NVAC...ILTLPQ..........Y.....Q.RK..G..........FGKL.LIDF..........S................Y.LL....S...K....R...E.....G..............R..L..........G.SPE...........KPLSDLGLL..G.YRAYWQEILVDL.LM......E..P.G..R.Q-.............................EA.N.....I.E....DLGAATAMTTNDVLHTLQNLN.MLRYSKNQHVIVLt......................................................
#=GR E4ZQ49_LEPMJ/273-460    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G1SDY4_RABIT/561-743               .............................................................WFHPPAN.EIY......R.......K.............N............N.......I..SVF...E.VDGN..VS.......................T..I..YCQNLAMSLDPFLKHILNY..YS.......GlFC.....VIFYLII..K...T...R..-...-...-.................................--..-LCFLH.Q..........E....KH....C....Q....Q.K.........Y.NVSC...IMILPQ..........Y.....Q.RK..G..........YGRF.LIDF..........S................Y.LL....S...K....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YMAYWKSVILEC.LY......H..Q.N..D.-K.............................QI.S.....I.K....KLSKLTGICPQDITSTLHHLR.MLDFRSDQFVII-rr.....................................................
Q7YTZ9_DROME/290-481               .............................................................WRHPPGD.EIY......R.......K.............G............K.......L..QVW...Q.VDGK..RY.......................K..Q..YCQHLCLLAKFFLDHKTLY..YD.......V.EP.....FLFYIMT..L...A...D..V...D...G.................................CH..IVGYFS.K..........HipflQE....K....N....S.F.........Y.NVSC...ILTLPP..........Y.....Q.RK..G..........YGRL.LIDF..........S................Y.LL....T...R....V...E.....G..............K..I..........G.SPE...........KPLSDLGLI..S.YRSYWKDVLLDY.LC......N..R.S..G.N-.............................TI.A.....I.K....DVSQETAIYSYDIVSTLQALG.MMKYWKGKHIV--lkk....................................................
#=GR Q7YTZ9_DROME/290-481    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
C1MNM5_MICPC/217-408               ............................................................m-YHPPGD.EIY......R.......N.............E............Trg...rtA..AFF...E.IDGK..KD.......................K..I..FCQNLCYLAKLFLDHKTLY..YD.......V.DL.....FLFYVLC..E...V...D..E...R...G.................................YH..IVGYFS.K..........E....KC....S....E....E.G.........Y.NLAC...ILTLPA..........Y.....Q.RK..G..........YGKM.LISF..........S................Y.EL....S...K....K...E.....G..............K..V..........G.TPE...........RPLSDLGLV..S.YRGYWTRELLAI.LK......D..P.S..R.A-.............................VM.S.....I.K....DLSELTMIKTEDIISTLQHLN.LLAYQKGAYVIC-aa.....................................................
#=GR C1MNM5_MICPC/217-408    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G0RIY0_HYPJQ/158-364               .....................................................yveevvqd-------.---......-.......E.............G............E.......W..SLW...E.VDGE..KD.......................V..L..FCQNLSLFAKLFLDNKSVF..FD.......V.TG.....FNYFLLV..Y...T...P..P...P...Avatsag....................vapppvtPQ..ITGFFS.K..........E....KM....S....W....D.N.........N.NLAC...ILIFPP..........W.....Q.RK..G..........LGAL.LMGA..........S................Y.EI....S...R....R...E.....G..............I..M..........G.GPE...........KPISDLGKK..G.YQRFWAGEIARW.LL......S..L.D..V.APadae....................sgqetLV.D.....V.E....DCSQATWISPEDCLGVLRDMG.VAED---------agmqmqase..............................................
#=GR G0RIY0_HYPJQ/158-364    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G6CY59_DANPL/701-887               .............................................................WRHPPAT.EIY......R.......C.............G............D.......I..SVF...E.VDGN..AN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..K...N...D..S...K...G.................................CH..LVGYFS.K..........E....KH....C....Q....Q.K.........Y.NVSC...IMTMPQ..........Y.....Q.RQ..G..........YGRF.LIHF..........S................Y.LL....S...K....E...E.....G..............Q..A..........G.TPE...........KPLSDLGRV..S.YHAYWKSVILEY.LH......D..H.R..D.K-.............................PF.T.....F.E....DIALSTGMHMNDIAVTFQLLG.FVRYVPDKD----dikl...................................................
#=GR G6CY59_DANPL/701-887    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
KAT6A_HUMAN/562-749                .............................................................WFHPPAN.EIY......R.......K.............N............N.......I..SVF...E.VDGN..VS.......................T..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..Q...N...D..V...K...G.................................CH..LVGYFS.K..........E....KH....C....Q....Q.K.........Y.NVSC...IMILPQ..........Y.....Q.RK..G..........YGRF.LIDF..........S................Y.LL....S...K....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YMAYWKSVILEC.LY......H..Q.N..D.-K.............................QI.S.....I.K....KLSKLTGICPQDITSTLHHLR.MLDFRSDQFVII-rr.....................................................
#=GR KAT6A_HUMAN/562-749     SS    .............................................................-SS-SSE.EEE......E.......E.............T............T.......E..EEE...E.EETT..TT.......................H..H..HHHHHHHHHHTT-SS---T..T-.......-.TT.....EEEEEEE..E...E...E..T...T...E.................................EE..EEEEEE.E..........E....SS....-....T....T.-.........E.CESE...EEE-GG..........G.....T.TS..S..........HHHH.HHHH..........H................H.HH....H...H....C...T.....T..............-..-..........B.EE-...........SS--HHHHH..H.HHHHHHHHHHHH.HH......C..-.S..S.--.............................--.S.....C.C....CCCCCH-BTHHHHHHHHHCTT.---XXXXXXXXX---.....................................................
#=GR KAT6A_HUMAN/562-749     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
#=GR KAT6A_HUMAN/562-749     sAS   ..........................................................................................................................................................................................................................................................................................................................................*...........................................................................................................................................................................................................................................................................................................................................
Q6FY84_CANGA/252-458               ...........................................................dh--RPPGN.EIY......R.......D.............E............N.......V..SVW...E.IDGR..EN.......................V..V..YCQNLCLLAKLFLNSKTLY..YD.......V.EP.....FVFYVLT..E...R...E..V...S...Edgr...........................tvkNH..FVGYFS.K..........E....KL....N....S....S.G.........Y.NLSC...IITLPL..........Y.....Q.RR..G..........YGHF.LMDF..........S................Y.LL....S...K....R...E.....F..............S..Q..........G.TPE...........KPLSDLGLI..T.YRNFWKLKCAET.LL......Y..L.K..N.ELnledse.................sddkfpLV.S.....I.E....DLANLTGMLPTDVILGLEELG.VFY----------rcpdpnqntts............................................
#=GR Q6FY84_CANGA/252-458    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G2RE94_THITE/271-460               ............................................................l-LHPPGN.EIY......R.......D.............D............F.......V..SFF...E.IDGR..RQ.......................R..T..WCRNLCLLSKMFLDHKTLY..YD.......V.DP.....FLFYVMT..S...R...D..E...K...G.................................SH..IIGYFS.K..........E....KE....S....A....D.G.........Y.NVAC...ILTLPQ..........Y.....Q.RK..G..........YGRL.LIQF..........S................Y.EL....S...K....I...E.....G..............K..L..........G.SPE...........KPLSDLGLL..S.YRQYWSENIIDL.LL......G..Y.S..E.RE............................eKC.T.....I.E....GIASHLAMTTQDVEHTLQALK.MQVYHKGEHKIV-ip.....................................................
#=GR G2RE94_THITE/271-460    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q4RDR2_TETNG/1-35                  .............................................................-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...-...-..-...-...-.................................--..----FL.Q..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------.......................................................
Q4CKI2_TRYCC/130-347               ............................................................f-RRPPGI.LLY......N.......D.............K............D.......CgrRVY...Y.VDGA..KH.......................L..H..YGRCLSLLGKAFIESKQLG..SD.......V.DI.....YEFFVVT..A...P...R..A...S...Lpyvlgemeettfr.......reaasfdavhwdgDV..VVGYFS.R..........I....KH....R....P....D.H.........-.CLSC...ILTLPM..........F.....Q.QK..G..........VAVF.MLDV..........A................Y.AL....T...E....M...R.....Q..............R..L..........C.GCEaacgrrggaisRPFSPHGQA..L.LLSYWRQRVTEA.LM......Q..S.A..A.SP.............................PI.D.....T.E....ATATSAAEDDDNVASTV----.-------------pfsvvhekv..............................................
#=GR Q4CKI2_TRYCC/130-347    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F7FB22_CALJA/562-749               .............................................................WFHPPAN.EIY......R.......K.............N............N.......I..SVF...E.VDGN..VS.......................T..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..Q...N...D..V...K...G.................................CH..LVGYFS.K..........E....KH....C....Q....Q.K.........Y.NVSC...IMILPQ..........Y.....Q.RK..G..........YGRF.LIDF..........S................Y.LL....S...K....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YMSYWKSVILEC.LY......H..Q.N..D.-K.............................QI.S.....I.K....KLSKLTGICPQDITSTLHHLR.MLDFRSDQFVII-rr.....................................................
#=GR F7FB22_CALJA/562-749    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H2UIK8_TAKRU/395-582               .............................................................WKHPPGD.EIY......R.......K.............G............N.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LVGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LC......N..F.Q..G.K-.............................DI.S.....I.K....EISQETAVNPVDIVSTLQSLQ.MLKYWKGKHLI--lkr....................................................
#=GR H2UIK8_TAKRU/395-582    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
#=GR E3K9A4_PUCGT/745-954    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H2UAR8_TAKRU/780-967               .............................................................WFHPPAN.EIY......R.......K.............D............N.......L..SVF...E.VDGN..VS.......................K..L..FCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYILT..K...N...D..E...K...G.................................CH..LVGYFS.K..........E....KL....C....Q....Q.K.........Y.NVSC...IMIMPQ..........Y.....Q.RQ..G..........FGRF.LIDF..........S................Y.LL....T...R....Q...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YLAYWKSVILEY.LY......K..H.P..D.K-.............................HI.S.....V.K....GISRATGMCPHDIASTLQQLG.MIDRQDGR-----ivlirr.................................................
#=GR H2UAR8_TAKRU/780-967    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E0W2D9_PEDHC/554-639               .............................................................WRHPPGE.EVY......R.......-.............-............-.......L..SVW...E.VDGK..RY.......................K..Q..YCQNLCLLAKFFLDHKTLY..YD.......V.EP.....FLFYVMT..I...S...D..S...E...G.................................CH..TVGYFS.K..........V....RE....K....-....-.-.........-.----...------..........-.....-.--..-..........----.----..........-................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------tiiitshyhvti...........................................
#=GR E0W2D9_PEDHC/554-639    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q4PFB3_USTMA/325-482               ............................................................n-THPPGR.KVY......Q.......R.............G............A.......H..IIW...E.VDGA..AQ.......................K..L..YCQNLSLFGKLFIDHKTIY..FD.......V.ES.....FVFYILT..D...A...A..N...A...T................................fDH..PLGFFS.K..........E....KV....S....Y....D.D.........Y.NLAC...IVTFPP..........F.....Q.RK..S..........FGTL.MIEF..........S................Y.YL....S...A....G...Q.....G..............M..L..........G.TPE...........RPLSDLGLK..G.YLSFWTAVLLRA.LI......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------gcfdgpfqvrtgns.........................................
#=GR Q4PFB3_USTMA/325-482    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E9DD01_COCPS/240-427               ............................................................l-VHPPGN.EIY......R.......D.............D............Y.......V..SFF...E.VDGR..RQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMT..T...R...D..A...Q...G.................................CH..LVGYFS.K..........E....KE....S....A....E.G.........Y.NVAC...ILTLPQ..........Y.....Q.RR..G..........YGRL.LIAF..........S................Y.EL....S...K....R...E.....G..............K..L..........G.SPE...........KPLSDLGLL..G.YRQYWRETLVEL.LL......E..P.G..R.D-.............................AI.S.....E.S....ELASLSGMTEKDVHETLVVLN.LLKYNKGNWIIV-lt.....................................................
#=GR E9DD01_COCPS/240-427    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H2L6F4_ORYLA/262-448               .............................................................WRQPPGK.EIY......R.......R.............S............N.......I..SVY...E.VDGR..DH.......................K..I..YCQNLCLLAKLFLDHKTLY..FD.......V.EP.....FIFYILT..E...V...N..K...Q...G.................................AH..IVGYFS.K..........E....KE....S....P....D.G.........N.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKF.LIAF..........S................Y.EL....S...K....L...E.....N..............S..V..........G.SPE...........KPLSDLGKL..S.YRSYWSWVLLEI.LR......D..F.R..G.--.............................TL.S.....I.K....DLSQMTSITQSDIISTLQSLN.MVKYWKGQHVICVt......................................................
#=GR H2L6F4_ORYLA/262-448    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G7PBR3_MACFA/848-1022              ..........................................................vpa-------.---......-.......-.............-............-.......-..-LL...K.VDGN..VS.......................T..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..Q...N...D..V...K...G.................................CH..LVGYFS.K..........E....KH....C....Q....Q.K.........Y.NVSC...IMILPQ..........Y.....Q.RK..G..........YGRF.LIDF..........S................Y.LL....S...K....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YMAYWKSVILEC.LY......H..Q.N..D.-K.............................QI.S.....I.K....KLSKLTGICPQDITSTLHHLR.MLDFRSDQFVII-rr.....................................................
#=GR G7PBR3_MACFA/848-1022   pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G7IVB8_MEDTR/295-432               ...........................................................qe-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....FIHYLFD..I...M...D..N...L...I.................................DI..DCFFIV.K..........E....KH....S....E....E.S.........Y.NLAC...ILTLPP..........Y.....Q.RK..G..........YGKF.LIAF..........S................Y.EL....S...K....K...E.....G..............K..V..........G.TPE...........RPLSDLGLL..S.YRGYWTRVLLDI.LK......K..H.K..G.--.............................NI.S.....I.K....ELSDMTAIKAEDILTTLQSLE.LIQYRKGQHVICAd......................................................
C1GDR4_PARBD/287-474               ............................................................l-VHPPGN.EIY......R.......D.............D............N.......V..SFF...E.VDGR..RQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMT..T...R...D..E...H...G.................................CH..LVGYFS.K..........E....KE....S....A....E.G.........Y.NVAC...ILTLPQ..........Y.....Q.RR..G..........FGRL.LIAF..........S................Y.EL....S...K....R...E.....S..............K..L..........G.SPE...........KPLSDLGLL..G.YRQYWRETLVDI.LM......E..P.G..R.E-.............................SI.S.....E.S....ELANLSAMTEKDVHETLVVLN.LLRYNKGNWVIV-lt.....................................................
#=GR C1GDR4_PARBD/287-474    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
#=GR C9ZT70_TRYB9/223-412    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G2W8V6_YEASK/325-535               ............................................................t-FKPPGN.EIY......R.......E.............G............K.......L..SVW...E.IDGR..EN.......................V..L..YCQNLCLLAKCFINSKTLY..YD.......V.EP.....FIFYILT..E...R...E..D...T...Enhly........................qnaakFH..FVGYFS.K..........E....KF....N....S....N.D.........Y.NLSC...ILTLPI..........Y.....Q.RK..G..........YGQF.LMEF..........S................Y.LL....S...R....K...E.....S..............K..F..........G.TPE...........KPLSDLGLL..T.YRTFWKIKCAEV.LL......K..L.R..D.SAkrrsnn................knedtfqQV.S.....L.N....DMAKLTGMIPTDVVFGLEQLQ.VLYRHKTR-----slssld.................................................
#=GR G2W8V6_YEASK/325-535    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F1KRC9_ASCSU/112-220               ............................................................l-RHPPGR.EIY......R.......R.............D............N.......L..SVF...E.VDGK..LS.......................V..S..YSQNVCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..V...N...D..N...S...G.................................CH..FVGYFS.R..........E....KY....N....P....L.K.........Y.SLSC...VMTLPC..........Y.....Q.TR..G..........YGRF.LVDF..........N................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------epfv...................................................
#=GR F1KRC9_ASCSU/112-220    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A5JPL6_BOMMO/215-401               ............................................................a-RQPQGN.EIY......R.......K.............G............T.......I..AIF...E.ADGK..EH.......................K..I..YCQNLCLLAKLFLDHKTLY..FD.......I.EQ.....FLFYILC..E...V...D..K...Q...G.................................AH..LVGYFS.K..........E....KD....S....P....E.G.........N.NVAC...ILTLPP..........Y.....Q.RQ..G..........YGKL.LIAF..........S................Y.EL....S...R....L...E.....Q..............V..V..........G.SPE...........KPLSDLGKL..S.YRSYWSYVLLEV.LS......A..S.R..G.--.............................TL.S.....I.K....DLSQMTGISQTDIISTLQSMN.MVKYWKGQHVICVt......................................................
#=GR A5JPL6_BOMMO/215-401    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E9NMR8_9MUSC/87-215                ............................................................k-RKPPGR.EIY......R.......K.............G............T.......I..SIF...E.VNGK..EE.......................P..L..YCQLLCLMAKLFLDHKVLY..FD.......M.DP.....FYFYVLC..E...I...D..M...E...G.................................SH..IVGYFS.K..........E....KK....S....Q....D.N.........N.NVAC...ILVLPP..........H.....Q.RK..G..........YGKL.LIAF..........S................Y.EL....S...R....K...E.....G..............V..I..........G.SPE...........KPLSDLGRL..S.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------.......................................................
#=GR E9NMR8_9MUSC/87-215     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F6YK25_CALJA/386-573               .............................................................WKHPPGD.EIY......R.......K.............G............S.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LIGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LH......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQALQ.MLKYWKGKHLV--lkr....................................................
#=GR F6YK25_CALJA/386-573    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B3NSY4_DROER/593-781               ............................................................r-RRPPGR.EIY......R.......K.............G............N.......I..SIY...E.VNGK..EE.......................S..L..YCQLLCLMAKLFLDHKVLY..FD.......M.DP.....FFFYILC..E...T...D..K...E...G.................................SH..IVGYFS.K..........E....KK....S....L....E.N.........Y.NVAC...ILVLPP..........H.....Q.RK..G..........FGKL.LIAF..........S................Y.EL....S...R....K...E.....G..............V..I..........G.SPE...........KPLSDLGRL..S.YRSYWAYTLLEL.MK......N..R.C..A.PE.............................QI.T.....I.K....ELSEMSGITHDDIIYTLQSMK.MIKYWKGQNVICVt......................................................
#=GR B3NSY4_DROER/593-781    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E9EXD0_METAR/397-603               ......................................................yteeivq-------.---......D.......E.............G............E.......W..SIW...E.VDGE..KH.......................G..L..FCQNLSLFAKLFLDNKSVF..FD.......V.TG.....FNYFLLV..Y...T...P..P...A...Rpvapet....................epiqtrpPQ..VCGFFS.K..........E....KM....S....W....D.S.........N.NLAC...ILVFPP..........W.....Q.RK..G..........LGAL.LMGA..........S................Y.EI....S...R....R...E.....G..............I..L..........G.GPE...........KPISDLGKK..G.YKRFWSGEIARW.LL......S..L.E..N.TV.............................--.-.....-.-....---------------------.-------------sqpqppqvagapvmtqelivdvndcsrgtwiavedclgvlrdmgvled.......
#=GR E9EXD0_METAR/397-603    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G5EGU3_CAEEL/273-465               ............................................................l-RAPPGL.EIY......R.......K.............G............D.......I..SVF...E.VDGR..LQ.......................K..E..YCQTLCLVSRMFLESKTVF..YD.......T.EP.....FFFYIVT..I...N...D..D...I...G.................................CH..FAGYFS.K..........E....KY....E....P....D.V.........N.NLSC...IMTLPC..........Y.....Q.EM..G..........LGRF.LIDI..........S................Y.AL....S...R....K...E.....K..............W..F..........G.GPE...........QPLSELGRK..A.YGGYWRTTIASC.LG......R..L.K..D.ELef.........................gsGI.S.....I.K....MIADDTGVNCHDILEVVCSLG.WAKPVDPDEKNH-yk.....................................................
#=GR G5EGU3_CAEEL/273-465    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A9YI75_DROME/147-235               ............................................................l-RHPPGN.EIY......R.......K.............H............T.......I..SFF...E.IDGR..KN.......................K..V..YAQNLCLLAKLFLDHKTLY..YD.......T.DP.....FLFYVMT..E...F...D..S...R...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTM--..........-.....-.--..-..........----.----..........-................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------.......................................................
#=GR A9YI75_DROME/147-235    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G5BMJ0_HETGA/561-748               .............................................................WFHPPAN.EIY......R.......K.............N............N.......I..SVF...E.VDGN..VS.......................T..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..Q...N...D..V...K...G.................................CH..LVGYFS.K..........E....KH....C....Q....Q.K.........Y.NVSC...IMILPQ..........Y.....Q.RK..G..........YGRF.LIDF..........S................Y.LL....S...K....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YMAYWKSVILEC.LY......H..Q.N..D.-K.............................QL.S.....I.K....KLSKLTGICPQDITSTLHHLR.MLDFRSDQFVII-rr.....................................................
#=GR G5BMJ0_HETGA/561-748    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B1A1M6_DROME/1-83                  .............................................................-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...-...-..-...-...-.................................--..------.-..........-....--....-....-....-.-.........-.----...------..........-.....-.--..-..........----.----..........-................Y.LL....T...R....V...E.....G..............K..I..........G.SPE...........KPLSDLGLI..S.YRSYWKDVLLDY.LC......N..R.S..G.N-.............................TI.A.....I.K....DVSQETAIYSYDIVSTLQALG.MMKYWKGKHIV--lkk....................................................
G0V249_TRYCI/469-559               .........................................................prls-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...-...-..-...-...-.................................--..------.-..........-....--....-....-....-.-.........-.----...------..........-.....-.--..N..........FGQF.MIAA..........S................Y.EL....A...Y....R...R.....K..............N..V..........G.SPE...........KPLTDLGAA..A.YDRYWRRVLIRW.MH......E..V.L..E.GD.............................VV.S.....TgT....EDAQRDSAQQVTVVATV----.-------------egrdgtdfss.............................................
G7XDS3_ASPKW/76-247                ...........................................................rt--TPPGT.KVY......D.......H.............G............G.......Y..SVW...E.LDGE..CH.......................K..L..YAQNLSLFAKLFLDHKSVF..YD.......V.VS.....FLYYLLV..F...T...D..P...N...Dp..............................qnYY..VLGFFS.K..........E....KL....S....W....D.A.........N.NLAC...ILVFPP..........Y.....Q.HK..Q..........LGKL.LMGV..........S................Y.KI....S...S....W...E.....Sd...........sgL..I..........G.GPE...........RPLSEMGHR..S.YTRFWQERIARY.LL......L..-.-..-.--.............................--.-.....-.-....---------------------.-------------qggkpkeaeaasgssvplkqks.................................
#=GR G7XDS3_ASPKW/76-247     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F8PAZ6_SERL9/82-227                ............................................................r-RHPPGR.KVY......Q.......R.............G............A.......H..TIW...E.VDGA..KD.......................K..L..YCQNLSLFGKLFIDVKTLF..FD.......C.DN.....FLFYLLT..D...A...D..S...Q...R.................................DY..VLGFFS.K..........E....KI....S....Y....D.D.........Y.NLAC...IIVLPP..........Y.....Q.RK..G..........YGML.MIEF..........S................Y.EL....S...R....R...S.....G..............R..I..........G.TPE...........RPLSDLGLR..S.YLTYWVSTLIRF.F-......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------ryvp...................................................
#=GR F8PAZ6_SERL9/82-227     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
D6X346_TRICA/562-641               .............................................................WRHPPGE.EVY......R.......K.............D............K.......I..SVW...E.VDGK..RY.......................K..Q..YCQNLCLLAKFFLDHKTLY..YD.......V.EP.....FLFYVMT..I...V...D..T...E...G.................................CH..TVGYFS.K..........V....N-....-....-....-.-.........-.----...------..........-.....-.--..-..........----.----..........-................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------hitvw..................................................
#=GR D6X346_TRICA/562-641    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
C5DI27_LACTC/103-291               ............................................................r-TKPPGR.IQY......M.......S.............P............E.......Y..TIR...K.VRGS..KH.......................P..L..FCQCLCLFTKLFLDNKSMY..FK.......T.DH.....YDFFIIY..Q...S...S..T...K...E.................................--..PMGFFS.K..........D....LI....S....Y....Q.K.........N.NLAC...VLTLPP..........Y.....Q.RK..G..........IGSL.LVDF..........S................Y.KL....S...I....R...D.....G..............L..I..........S.GPE...........RPLSPFGLV..S.YLKYWSSQICWQ.LL......E..G.D..L.SGs...........................gRT.S.....L.D....AISRATGIRIGDILLTLRSLN.CLTKDY-------dvslsvlr...............................................
#=GR C5DI27_LACTC/103-291    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q0Z9W0_WHEAT/217-403               ............................................................l-KHPPGD.EIY......R.......C.............G............T.......L..SMF...E.VDGK..KN.......................K..V..YGQNLCYLAKLFLDHKTLY..YD.......V.DL.....FLFHILC..E...C...N..D...R...G.................................CH..MVGYFS.K..........E....KH....S....E....E.A.........Y.NLAC...ILTLPP..........Y.....Q.RK..G..........YGKF.LIAF..........S................Y.EL....S...K....K...E.....G..............K..V..........G.TPE...........RPLSDLGLL..S.YRGYWTRVLLEI.LK......K..H.K..S.--.............................NI.S.....I.K....ELSDMTAIKADDILSTLQSLD.LIQYRKGQHVICAd......................................................
#=GR Q0Z9W0_WHEAT/217-403    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G8BW31_TETPH/146-334               ............................................................k-EKVPGR.LKY......L.......G.............P............K.......Y..QIR...R.VKGQ..KH.......................T..L..FCQCLCLFTKLFLDDKSMY..FR.......I.AN.....YEFYIIY..E...N...G..S...T...K.................................--..PMGFFS.K..........D....IV....S....Y....N.K.........N.NLAC...ILVFPP..........Y.....Q.KR..K..........LGTI.LIEL..........S................Y.KI....S...K....F...E.....G..............L..K..........S.SPE...........VPLSPFGLI..T.YMNFWSNRICWE.LL......E..G.E..L.ADl...........................gSV.T.....I.E....DISTVTGFKPYDIVQTLQYLD.CIDAAGN------iqlsrmi................................................
#=GR G8BW31_TETPH/146-334    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G0NX68_CAEBE/225-416               ............................................................l-CHPPGN.QIY......C.......Q.............D............K.......L..SFF...E.IDGR..KN.......................K..S..YAQNLCLLAKLFLDHKTLY..YD.......T.DP.....FLFYVLT..E...E...D..E...K...G.................................HH..IVGYFS.K..........E....KE....S....A....D.E.........Y.NVAC...ILVLPP..........F.....Q.KK..G..........YGSL.LIEF..........S................Y.EL....S...K....I...E.....Q..............K..T..........G.SPE...........KPLSDLGLL..S.YRSYWSMAIMKE.LF......A..F.K..R.RHp..........................neDI.T.....V.Q....DISMSTSIKREDVVSTLQQLD.LYKYYKGQYVIVIs......................................................
#=GR G0NX68_CAEBE/225-416    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A8B8C8_DROSI/596-784               ............................................................r-RRPPGR.EIY......R.......K.............G............N.......I..SIY...E.VNGK..EE.......................S..L..YCQLLCLMAKLFLDHKVLY..FD.......M.DP.....FLFYILC..E...T...D..K...E...G.................................SH..IVGYFS.K..........E....KK....S....L....E.N.........Y.NVAC...ILVLPP..........H.....Q.RK..G..........FGKL.LIAF..........S................Y.EL....S...R....K...E.....G..............V..I..........G.SPE...........KPLSDLGRL..S.YRSYWAYTLLEL.MK......T..R.C..A.PE.............................QI.T.....I.K....ELSEMSGITHDDIIYTLQSMK.MIKYWKGQNVICVt......................................................
#=GR A8B8C8_DROSI/596-784    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G2XJ11_VERDV/290-479               ............................................................l-QHPPGN.EIY......R.......D.............D............T.......I..SFF...E.IDGR..RQ.......................R..T..WCRNLCLLSKMFLDHKTLY..YD.......V.DP.....FLFYVMT..I...R...D..D...K...G.................................FH..FVGYFS.K..........E....KE....S....A....D.G.........Y.NVAC...ILTLPQ..........Y.....Q.RR..G..........YGRL.LIQF..........S................Y.EL....S...K....I...E.....G..............R..L..........G.SPE...........KPLSDLGLL..S.YRQYWGENIIDL.LL......G..L.N..E.RE............................dKA.T.....I.E....TISTQLSMTTQDVEHTLGALR.MQIYHRGEHKIV-ip.....................................................
#=GR G2XJ11_VERDV/290-479    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B4MZV4_DROWI/568-759               .............................................................WRHPPGD.EIY......R.......K.............G............K.......L..QVW...Q.VDGK..RY.......................K..Q..YCQHLCLLAKFFLDHKTLY..YD.......V.EP.....FLFYIMT..L...A...D..V...D...G.................................CH..IVGYFS.K..........HipflQE....K....N....S.F.........Y.NVSC...ILTLPP..........Y.....Q.RK..G..........YGRL.LIDF..........S................Y.LL....T...R....V...E.....G..............K..I..........G.SPE...........KPLSDLGLI..S.YRSYWKDVLLDY.LC......N..R.S..G.N-.............................TL.C.....I.K....DVSQEMAIYSYDIVSTLQALG.MMKYWKGKHIV--lkk....................................................
#=GR B4MZV4_DROWI/568-759    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H9GEE3_ANOCA/31-218                .............................................................WFHPPAS.EIY......R.......R.............K............D.......L..SVF...E.VDGN..AS.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..K...N...D..E...K...G.................................CH..LVGYFS.K..........E....KL....C....Q....Q.K.........Y.NVSC...IMIMPQ..........Y.....Q.RQ..G..........FGRF.LIDF..........S................Y.LL....S...R....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRV..S.YLAYWKSVVLEY.LY......C..H.H..E.-K.............................QI.S.....I.K....GMSRATGMCPHDIATTLQQHR.MIDRREEKFVV--ikr....................................................
#=GR H9GEE3_ANOCA/31-218     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q29I48_DROPS/329-522               ............................................................l-RHPPGN.EIY......R.......K.............Q............T.......I..SFF...E.IDGR..KN.......................K..V..YAQNLCLLAKLFLDHKTLY..YD.......T.DP.....FLFYIMT..E...F...D..S...R...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTMPP..........Y.....Q.RK..G..........YGKL.LIEF..........S................Y.EL....S...K....F...E.....G..............K..T..........G.SPE...........KPLSDLGLL..S.YRSYWAQTILEI.FI......S..Q.N..P.STeg........................ekpTI.T.....I.N....DICECTSIKKEDVISTLQNLN.LINYYKGQYIVCIn......................................................
#=GR Q29I48_DROPS/329-522    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F7DYY3_XENTR/277-469               ............................................................l-RHPPGN.EIY......R.......K.............G............T.......I..SFF...E.IDGR..KN.......................K..S..YSQNLCLLAKCFLDHKTLY..YD.......T.DP.....FLFYIMT..E...Y...D..C...K...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKL.LIEF..........S................Y.EL....S...K....V...E.....G..............K..T..........G.TPE...........KPLSDLGLL..S.YRSYWSQTILEI.LM......E..L.K..T.ETge.........................rpQI.T.....I.N....EISEITSIKKEDVISTLQYLN.LINYYKGQYILT-ls.....................................................
#=GR F7DYY3_XENTR/277-469    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F4X1D6_ACREC/224-417               ............................................................l-RHPPGN.EIY......R.......K.............G............S.......I..SFF...E.IDGR..KN.......................K..N..YAQNLCLLAKLFLDHKTLY..YD.......T.DP.....FLFYVMT..D...F...D..S...R...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........H.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKL.LIEF..........S................Y.EL....S...K....F...E.....G..............K..T..........G.SPE...........KPLSDLGLL..S.YRSYWAHTILDI.LL......N..V.K..P.VVen........................ekaQI.T.....I.S....EISELTSIKKEDVISTLQNLN.LINYYKGQYIVTLn......................................................
#=GR F4X1D6_ACREC/224-417    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A2ENW6_TRIVA/165-352               ...........................................................el--CPPGR.EIY......R.......E.............G............N.......L..SVF...E.LKGK..RQ.......................K..L..ACQNLCLLSKLFLDHKTLF..YD.......V.EG.....FIFYVLC..E...C...D..D...S...G.................................AH..IAAYFS.R..........E....LN....S....A....Q.N.........N.ILAC...ITTLPP..........Y.....Q.KR..G..........YGHF.LISL..........A................Y.EI....A...K....R...Q.....H..............R..T..........G.GPE...........RPLSDLGKI..A.FKAYWRDTILNL.LK......N..Q.S..A.E-.............................IT.S.....V.D....SLVNMTAIDRFDIIDTLKEVG.LVTKVKGEY----dlnln..................................................
#=GR A2ENW6_TRIVA/165-352    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
D7MRV8_ARALL/227-413               ............................................................l-KHPPGD.EIY......R.......S.............S............T.......L..SMF...E.VDGK..KN.......................K..V..YAQNLCYLAKLFLDHKTLY..YD.......V.DL.....FLFYILC..E...C...D..D...R...G.................................CH..MVGYFS.K..........E....KH....S....E....E.A.........Y.NLAC...ILTLPP..........Y.....Q.RK..G..........YGKF.LIAF..........S................Y.EL....S...K....K...E.....G..............K..V..........G.TPE...........RPLSDLGLV..S.YRGYWTRILLDI.LK......K..H.K..G.--.............................NI.S.....I.K....ELSDMTAIKAEDILSTLQSLE.LIQYRKGQHVICAd......................................................
#=GR D7MRV8_ARALL/227-413    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E6QZL1_CRYGW/340-526               ............................................................l-LHPPGN.EIY......R.......H.............E............G.......I..SFF...E.IDGR..KQ.......................R..T..WCRNLCLISKCFLDHKTLY..YD.......V.DP.....FLYYCMT..I...K...D..D...Y...G.................................CH..LIGYFS.K..........E....KE....S....A....E.G.........Y.NVAC...ILTLPQ..........H.....Q.RK..G..........YGRL.LIEF..........S................Y.EL....S...K....V...E.....G..............K..L..........G.SPE...........KPLSDLGLL..G.YRAYWQEKIVEL.LL......D..S.D..Y.--.............................EI.S.....L.D....EIAQKTSITHGDIMHTCQALQ.MIKYYKNSHIIHLt......................................................
#=GR E6QZL1_CRYGW/340-526    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F6S4B9_MOUSE/1-148                 ............................................................x-------.-IY......R.......K.............G............S.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LIGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LH......N..F.Q..G.K-.............................EI.S.....I.K....---------------------.-------------gp.....................................................
#=GR F6S4B9_MOUSE/1-148      pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G5B6J4_HETGA/321-513               ............................................................l-RHPPGN.EIY......R.......K.............G............T.......I..SFF...E.IDGR..KN.......................K..S..YSQNLCLLAKCFLDHKTLY..YD.......T.DP.....FLFYVMT..E...Y...D..C...K...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........Y.....Q.RR..G..........YVKL.LIEF..........S................Y.EL....S...K....V...E.....G..............K..T..........G.TPE...........KPLSDLGLL..S.YRSYWSQTILEI.LM......G..L.K..S.ESge.........................rpQI.T.....I.N....EISEITSIKKEDVISTLQYLN.LINYYKGQYILT-ls.....................................................
#=GR G5B6J4_HETGA/321-513    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
C1MNF7_MICPC/279-475               ............................................................a-SHPPGK.RIY......EhprkaegK.............P............T.......V..SFW...E.IDGA..GD......................gK..V..YCQNLCLLAKLFLDHKTLY..YD.......V.SP.....FLFYVMT..E...E...D..E...T...Tg...............................kHS..VVGYFS.K..........E....KW....S....V....E.D.........Y.NLAC...ILTLPP..........Y.....Q.RR..G..........YGSF.LIAM..........S................Y.EL....S...S....R...E.....E..............K..L..........G.TPE...........RPLSDLGQV..S.YRSFWSKRILEV.LQ......R..A.K..G.--.............................NL.S.....V.K....DISAETSFKEMDIVSSLQSLN.LLKYWKGQHIIS-at.....................................................
#=GR C1MNF7_MICPC/279-475    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q753V4_ASHGO/103-290               ...........................................................kl--RLPGR.IKY......M.......S.............P............E.......Y..TIR...K.VKGK..KH.......................E..L..FCQCMCLFTKLFLDNKSVY..FR.......M.TS.....YEFYILY..N...T...E..G...R...E.................................--..PLGFFS.K..........D....LY....S....Y....N.R.........N.NLAC...ILVFPP..........Y.....Q.RR..N..........LGTL.LIDF..........S................Y.RL....S...R....N...E.....G..............I..V..........S.GPE...........FPLSPFGLI..G.YLKYWSFAIVWH.LT......E..G.E..L.SNl...........................hKV.S.....L.N....VISEVTGIRVSDVIITLKHLQ.CLTENNE------illpvi.................................................
#=GR Q753V4_ASHGO/103-290    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B4JRS4_DROGR/537-725               ............................................................k-RHPPGR.EIY......R.......K.............G............T.......I..AIY...E.VIGR..EQ.......................P..L..YCQLLSLTAKLFLDHKVLY..FD.......M.EP.....FLFYILC..E...I...D..N...D...G.................................SH..CVGYFS.K..........E....RN....S....L....D.N.........N.NVAC...ILVMPP..........H.....Q.RK..G..........YGKL.LIAF..........S................Y.VL....S...R....K...E.....G..............V..I..........G.SPE...........KPLSDLGRL..S.YRSYWAYTLLEL.MR......E..R.C..S.AE.............................QT.T.....I.K....ELSEASGITQDDIIYTLQSMK.MIKYWKGQNTICVt......................................................
#=GR B4JRS4_DROGR/537-725    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
ESA1_ASPFU/253-440                 ............................................................l-VHPPGN.EIY......R.......D.............D............Y.......I..SFF...E.VDGR..RQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMC..T...R...D..E...T...G.................................CH..LVGYFS.K..........E....KD....S....A....E.G.........Y.NLAC...ILTLPQ..........Y.....Q.RR..G..........FGRL.LISF..........S................Y.EL....S...K....R...E.....G..............K..L..........G.SPE...........KPLSDLGLL..G.YRQYWRETLVEI.LM......E..P.G..R.E-.............................TV.S.....E.N....ELALLTSMTEKDVHETLVVLN.MLRYYKGNWVIV-lt.....................................................
#=GR ESA1_ASPFU/253-440      pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
#=GR ESA1_ASPFU/253-440      sAS   ..........................................................................................................................................................................................................................................................................................................................................*...........................................................................................................................................................................................................................................................................................................................................
C7YLN1_NECH7/572-765               ............................................................a-KHPPGD.EIY......R.......H.............K............S.......V..SVF...E.VDGR..KN.......................P..V..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYVLC..E...Y...N..D...T...G.................................YH..FVGYFS.K..........E....KR....A....S....S.Q.........N.NVSC...ILTLPI..........H.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...K....V...E.....E..............K..T..........G.SPE...........KPLSDMGLV..S.YRNYWRLILCRY.FL......N..V.M..E.TEdh........................kseGL.S.....I.K....RISDDTGMTPDDVISALEGLR.ALVRDPQT-----klyafr.................................................
#=GR C7YLN1_NECH7/572-765    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A9V986_MONBE/88-274                ............................................................h-RQPPGR.EIY......R.......K.............G............N.......V..SVY...E.VDGA..EH.......................K..L..YCQNLCLLAKVFLDHKTLY..FD.......V.ST.....FLFYILT..E...V...D..A...D...G.................................AH..FVGYFS.K..........E....KV....S....V....D.N.........N.NLAC...ICTLPP..........Y.....Q.KK..G..........YGRF.LIEF..........S................Y.AL....S...Q....A...E.....G..............K..I..........G.SPE...........KPLSDLGKL..G.YRSYWSWLLLNA.LR......G..K.K..G.--.............................TI.S.....M.P....ALSKATGIAPDDVFNTLQALN.LTKYWKGEHVVCIt......................................................
#=GR A9V986_MONBE/88-274     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E7LYQ6_YEASV/106-294               ............................................................q-YRVPGK.IKY......K.......S.............P............E.......Y..TIR...R.VKGS..KY.......................Q..L..FCQCLCLFTKLYLDNKSMY..FK.......V.DH.....YEFYIVY..E...T...G..S...T...K.................................--..PMGFFS.K..........D....LV....S....Y....Q.Q.........N.NLAC...ILIFPP..........Y.....Q.RR..G..........LGLL.LIEF..........S................Y.KL....S...Q....L...E.....G..............V..I..........S.GPE...........VPLSPFGLI..G.YLKYWSQILCWH.LI......E..G.D..L.AHy...........................dKV.T.....L.E....DLSIVTGMRVNDVILTLKHLN.CIGENNQIYLQS-ln.....................................................
#=GR E7LYQ6_YEASV/106-294    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q7QK98_ANOGA/351-537               ............................................................q-RCPPGW.EIY......R.......D.............G............D.......L..SVF...E.VDGN..EQ.......................K..L..YCQSLCLLSKLFLDHKTLY..FD.......V.EP.....FLFYVLT..V...R...D..R...H...G.................................HH..PVGYFS.K..........E....KQ....N....Q....L.R.........Y.NVSC...ILTLPQ..........Y.....Q.RR..G..........YGRF.LIDF..........S................Y.LL....S...R....V...E.....R..............K..P..........G.TPE...........RPLSELGEV..S.YRRYWCSVLLAY.LY......H..N.R..D.E-.............................SL.T.....L.A....TVSQETGLIVGDIVTALRQLG.FVRYRVE------ragcir.................................................
#=GR Q7QK98_ANOGA/351-537    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H2Q441_PANTR/318-510               ............................................................l-RHPPGN.EIY......R.......K.............G............T.......I..SFF...E.IDGR..KN.......................K..S..YSQNLCLLAKCFLDHKTLY..YD.......T.DP.....FLFYVMT..E...Y...D..C...K...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKL.LIEF..........S................Y.EL....S...K....V...E.....G..............K..T..........G.TPE...........KPLSDLGLL..S.YRSYWSQTILEI.LM......G..L.K..S.ESge.........................rpQI.T.....I.N....EISEITSIKKEDVISTLQYLN.LINYYKGQYILT-ls.....................................................
#=GR H2Q441_PANTR/318-510    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B3MKA7_DROAN/585-776               .............................................................WRHPPGD.EIY......R.......K.............G............K.......L..QVW...Q.VDGK..RY.......................K..Q..YCQHLCLLAKFFLDHKTLY..YD.......V.EP.....FLFYIMT..L...A...D..V...D...G.................................CH..IVGYFS.K..........HipflQE....K....N....S.F.........Y.NVSC...ILTLPP..........Y.....Q.RK..G..........YGRL.LIDF..........S................Y.LL....T...R....V...E.....G..............K..I..........G.SPE...........KPLSDLGLI..S.YRSYWKDVLLDY.LC......N..R.S..G.N-.............................SL.C.....I.K....DVSQEMAIYSYDIVSTLQALG.MMKYWKGKHIV--lkk....................................................
#=GR B3MKA7_DROAN/585-776    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A3LNI3_PICST/255-415               ............................................................l-KHPPGN.EIY......R.......D.............S............K.......V..SFW...E.IDGR..RQ.......................R..T..WCRNLCLLCKLFLDHKTLY..YD.......V.DP.....FLFYVMT..I...K...S..E...Q...G.................................HH..VVGFFS.K..........E....KE....S....G....D.G.........Y.NVAC...ILTLPC..........Y.....Q.KR..G..........YGKL.LIQF..........S................Y.ML....S...N....V...E.....H..............K..V..........G.SPE...........KPLSDLGLL..S.YRAYWTDTLVKL.LV......E..R.S..N.P-.............................--.-.....-.-....---------------------.-------------mlykknnpaided..........................................
#=GR A3LNI3_PICST/255-415    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A6ZKP6_YEAS7/325-534               ............................................................t-FKPPGN.EIY......R.......D.............G............K.......L..SVW...E.IDGR..EN.......................V..L..YCQNLCLLAKCFINSKTLY..YD.......V.EP.....FIFYILT..E...R...E..D...T...Enhph........................qnaakFH..FVGYFS.K..........E....KF....N....S....N.D.........Y.NLSC...ILTLPI..........Y.....Q.RK..G..........YGQF.LMEF..........S................Y.LL....S...R....K...E.....S..............K..F..........G.TPE...........KPLSDLGLL..T.YRTFWKIKCAEV.LL......K..L.R..Y.SVkrrsnn................knedtfqQV.S.....L.N....DMAKLTGMIPTDVVFGLEQLQ.-------------vlyrhktrslssl..........................................
#=GR A6ZKP6_YEAS7/325-534    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F8NXK3_SERL9/481-664               ............................................................a-RHPPGD.EIY......R.......D.............G............A.......V..SIF...E.VDGR..KN.......................K..I..YCQNLCLLSRMFLDHKSLF..YD.......V.EP.....FLFYVMT..E...V...D..D...V...G.................................AR..FVGYFS.K..........E....KR....S....P....K.D.........Y.NVSC...IMTLPV..........R.....Q.RQ..G..........WGGL.LIDF..........S................Y.LL....S...K....K...E.....Q..............R..S..........G.SPE...........KPLSGLGAL..G.YKNYWTLAVMRY.LA......T..A.P..D.D-.............................-P.H.....L.E....DISKATSMTIEDIHVTLTQQN.MIFHR--------eatpqp.................................................
#=GR F8NXK3_SERL9/481-664    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G1P372_MYOLU/232-418               .............................................................WRQPPGK.EIY......R.......K.............S............N.......I..SVY...E.VDGK..DH.......................K..I..YCQNLCLLAKLFLDHKTLY..FD.......V.EP.....FVFYILT..E...V...D..R...Q...G.................................AH..IVGYFS.K..........E....KE....S....P....D.G.........N.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKF.LIAF..........S................Y.EL....S...K....L...E.....S..............T..V..........G.SPE...........KPLSDLGKL..S.YRSYWSWVLLEI.LR......D..F.R..G.--.............................TL.S.....I.K....DLSQMTSITQNDIISTLQSLN.MVKYWKGQHVICVt......................................................
#=GR G1P372_MYOLU/232-418    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
D8TQT1_VOLCA/207-410               ..................................irhppgdeiyrspppppgqpnyiggav-------.---......T.......K.............P............P.......I..SVF...E.VDGK..KA.......................K..V..YCQNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYVMC..E...R...D..Q...H...G.................................YH..MVGYFS.K..........E....KS....C....M....E.D.........Y.NLAC...ILTLPA..........Y.....Q.RK..G..........YGKF.LIAF..........A................Y.EL....S...R....R...E.....G..............R..V..........G.TPE...........RPLSDLGTV..S.FRSYWTRVLLEQ.LR......N..V.K..G.--.............................DV.S.....I.K....EMSDATMIRAQDIVETLQSLG.LIKYWKGTHLIH-ad.....................................................
#=GR D8TQT1_VOLCA/207-410    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H6C6F8_EXODN/306-454               ............................................................l-RHPPGN.EIY......R.......D.............D............F.......V..SFF...E.VDGR..RQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMV..T...R...D..E...H...G.................................CH..LVGYFS.K..........E....KE....S....A....E.G.........Y.NVAC...ILTLPQ..........Y.....Q.RQ..G..........LGRL.LIAF..........S................Y.EL....S...K....R...E.....G..............K..L..........G.SPE...........KPLSDLGLL..G.YRQYWKEVLVEL.LS......D..-.-..-.--.............................--.-.....-.-....---------------------.-------------parlp..................................................
#=GR H6C6F8_EXODN/306-454    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F1SE29_PIG/325-512                 .............................................................WFHPPAN.EIY......R.......K.............S............D.......I..SVF...E.VDGN..VS.......................T..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..Q...N...D..V...K...G.................................CH..LVGYFS.K..........E....KH....C....Q....Q.K.........Y.NVSC...IMILPQ..........Y.....Q.RK..G..........YGRF.LIDF..........S................Y.LL....S...K....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YMAYWKSVILEC.LY......H..Q.N..D.-K.............................QI.S.....I.K....KLSKLTGICPQDITSTLHHLR.MLDFRSDQFVII-rr.....................................................
#=GR F1SE29_PIG/325-512      pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A6QUB9_AJECN/286-473               ............................................................l-VHPPGN.EIY......R.......D.............D............N.......V..SFF...E.VDGR..RQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMT..T...R...D..E...H...G.................................CH..LVGYFS.K..........E....KE....S....A....E.G.........Y.NVAC...ILTLPQ..........Y.....Q.RR..G..........FGRL.LIAF..........S................Y.EL....S...K....R...E.....N..............K..L..........G.SPE...........KPLSDLGLL..G.YRQYWRETIVDI.LM......E..P.G..R.E-.............................TI.S.....E.S....ELASLSAMTEKDVHETLVVLN.LLRYNKGNWVIV-lt.....................................................
#=GR A6QUB9_AJECN/286-473    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G0WAL7_NAUDC/400-610               ............................................................i-KTPPGN.QIYf....aQ.......I.............N............G.......L..SIW...E.IDGR..EN.......................I..E..YCRNLCLLSKLFLNSKTLY..YD.......V.EP.....FIFYVLM..K...Qt.kD..S...Y...D.................................YN..FIGYFS.K..........E....KS....N....S....L.N.........Y.NLSC...ILTLPI..........Y.....Q.RM..G..........YGNF.LMEF..........S................Y.LL....S...R....R...E.....F..............K..L..........G.TPE...........KPLSDLGLL..S.YRNFWKIKIAKT.LL......L..I.K..N.AFeqsssssssss.......ssssqaqltlkTI.T.....L.N....DLANLTGMTTTDVIFGLEQLK.LLYY---------htpsvp.................................................
#=GR G0WAL7_NAUDC/400-610    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B4KKB4_DROMO/594-785               .............................................................WRHPPGD.EIY......R.......K.............G............K.......L..QVW...Q.VDGK..RY.......................K..Q..YCQHLCLLAKFFLDHKTLY..YD.......V.EP.....FLFYIMT..L...A...D..V...D...G.................................CH..IVGYFS.K..........HipflQE....K....N....S.F.........Y.NVSC...ILTLPP..........Y.....Q.RK..G..........YGRL.LIDF..........S................Y.LL....T...R....V...E.....G..............K..I..........G.SPE...........KPLSDLGLI..S.YRSYWKDVLLDY.LC......N..R.S..G.N-.............................TI.C.....I.K....DVSQEMAIYSYDIVSTLQALG.MMKYWKGKHIV--lkk....................................................
#=GR B4KKB4_DROMO/594-785    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B5RSS4_DEBHA/262-468               ............................................................n-NHPPGI.EIY......R.......Dl...........dT............N.......I..AVW...E.VDGR..KN.......................I..N..YCQNLCLLAKLFLNSKTLY..YD.......V.EP.....FIFYVLT..E...I...D..K...E...Np..............................tkYH..FVGYFS.K..........E....KL....S....N....S.D.........Y.NVSC...ILTLPI..........Y.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....S...R....H...E.....F..............K..F..........G.TPE...........KPLSDLGLV..S.YRNYWKITIALK.LK......E..L.H..S.KYlnntnn................dknsntlSI.S.....I.E....NLSKLTGIIPSDVVVGLEQLD.SL-----------iknpitnsygiv...........................................
#=GR B5RSS4_DEBHA/262-468    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B1A1V5_DROME/4-35                  .........................................................flqe-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...-...-..-...-...-.................................--..------.-..........-....--....K....N....S.F.........C.NVSC...ILTLPP..........Y.....Q.RK..G..........YGRL.LIDF..........-................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------.......................................................
G7MZ71_MACMU/708-882               ..........................................................vpa-------.---......-.......-.............-............-.......-..-LL...K.VDGN..VS.......................T..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..Q...N...D..V...K...G.................................CH..LVGYFS.K..........E....KH....C....Q....Q.K.........Y.NVSC...IMILPQ..........Y.....Q.RK..G..........YGRF.LIDF..........S................Y.LL....S...K....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YMAYWKSVILEC.LY......H..Q.N..D.-K.............................QI.S.....I.K....KLSKLTGICPQDITSTLHHLR.MLDFRSDQFVII-rr.....................................................
#=GR G7MZ71_MACMU/708-882    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F7FSM6_MACMU/576-758               ................................................ratyiasivqlti-------.---......-.......-.............-............-.......-..---...V.VDGN..VS.......................T..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..Q...N...D..V...K...G.................................CH..LVGYFS.K..........E....KH....C....Q....Q.K.........Y.NVSC...IMILPQ..........Y.....Q.RK..G..........YGRF.LIDF..........S................Y.LL....S...K....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YMAYWKSVILEC.LY......H..Q.N..D.-K.............................QI.S.....I.K....KLSKLTGICPQDITSTLHHLR.MLDFRSDQFVII-rr.....................................................
#=GR F7FSM6_MACMU/576-758    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G3SCG8_GORGO/396-583               .............................................................WKHPPGD.EIY......R.......K.............G............S.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LIGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LH......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQALQ.MLKYWKGKHLV--lkr....................................................
#=GR G3SCG8_GORGO/396-583    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q4Q837_LEIMA/181-289               ...........................................................rl--RPPGE.EVY......R.......D.............Ev..........rG.......L..SLF...K.INGS..QH.......................V..T..YCRHLFLIGKSFLENKLAG..HD.......V.HN.....YYFYVVC..L...H...H..R...Y...Fpdyv........................sdpsaMY..FAGFFT.W..........E....KH....V....-....S.E.........Y.NLAC...IATLPC..........F.....G.RR..-..........----.----..........-................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------ssrq...................................................
#=GR Q4Q837_LEIMA/181-289    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F9G643_FUSOF/599-792               ............................................................a-KHPPGD.EIY......R.......H.............G............S.......V..SVF...E.VDGR..KN.......................P..V..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYVLC..E...Y...N..E...T...G.................................YH..FVGYFS.K..........E....KR....A....S....S.Q.........N.NVSC...ILTLPI..........H.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...K....V...E.....E..............K..T..........G.SPE...........KPLSDMGLV..S.YRNYWRLVLCRY.FL......K..V.M..E.NEkh........................ateGL.S.....I.K....RISADTGMTPDDVISALEGLR.ALVRDPQTK----vyafr..................................................
#=GR F9G643_FUSOF/599-792    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
D7SFM3_CAEEL/266-458               ............................................................l-RAPPGL.EIY......R.......K.............G............D.......I..SVF...E.VDGR..LQ.......................K..E..YCQTLCLVSRMFLESKTVF..YD.......T.EP.....FFFYIVT..I...N...D..D...I...G.................................CH..FAGYFS.K..........E....KY....E....P....D.V.........N.NLSC...IMTLPC..........Y.....Q.EM..G..........LGRF.LIDI..........S................Y.AL....S...R....K...E.....K..............W..F..........G.GPE...........QPLSELGRK..A.YGGYWRTTIASC.LG......R..L.K..D.ELef.........................gsGI.S.....I.K....MIADDTGVNCHDILEVVCSLG.WAKPVDPDEKNH-yk.....................................................
#=GR D7SFM3_CAEEL/266-458    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H2NQS1_PONAB/232-418               .............................................................WRQPPGK.EIY......R.......K.............S............N.......I..SVY...E.VDGK..DH.......................N..I..YCQNLCLLAKLFLDHKTLY..FD.......V.EP.....FVFYILT..E...V...D..R...Q...G.................................AH..IVGYFS.K..........E....KE....S....P....D.G.........N.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKF.LIAF..........S................Y.EL....S...K....L...E.....S..............T..V..........G.SPE...........KPLSDLGKL..S.YRSYWSWVLLEI.LR......D..F.R..G.--.............................TL.S.....I.K....DLSQMTSITQNDIISTLQSLN.MVKYWKGQHVICVt......................................................
#=GR H2NQS1_PONAB/232-418    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G3QAR1_GASAC/312-504               ............................................................l-RHPPGN.EIY......R.......K.............G............T.......I..SFF...E.IDGR..KN.......................K..T..YSQNLCLLAKCFLDHKTLY..YD.......T.DP.....FLFYVMT..E...Y...D..S...K...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKL.LIEF..........S................Y.EL....S...K....V...E.....G..............K..T..........G.TPE...........KPLSDLGLL..S.YRSYWSQTILEI.LM......D..L.K..P.DNge.........................rpQI.T.....I.N....EISEITSVKKEDVISTLQYLN.LINYYKGQYILT-ls.....................................................
#=GR G3QAR1_GASAC/312-504    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A3KN50_BOVIN/232-418               .............................................................WRQPPGK.EIY......R.......K.............S............N.......I..SVY...E.VDGK..DH.......................K..I..YCQNLCLLAKLFLDHKTLY..FD.......V.EP.....FVFYILT..E...V...D..R...Q...G.................................AH..IVGYFS.K..........E....KE....S....P....D.G.........N.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKF.LIAF..........S................Y.EL....S...K....L...E.....S..............T..V..........G.SPE...........KPLSDLGKL..S.YRSYWSWVLLEI.LR......D..F.R..G.--.............................TL.S.....I.K....DLSQMTSITQNDIISTLQSLN.MVKYWKGQHVICVt......................................................
#=GR A3KN50_BOVIN/232-418    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q3TD41_MOUSE/360-547               .............................................................WKHPPGD.EIY......R.......K.............G............S.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LIGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LH......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQALQ.MLKYWKGKHLV--lkr....................................................
#=GR Q3TD41_MOUSE/360-547    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
C5PI16_COCP7/289-476               ............................................................l-VHPPGN.EIY......R.......D.............D............Y.......V..SFF...E.VDGR..RQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMT..T...R...D..A...Q...G.................................CH..LVGYFS.K..........E....KE....S....A....E.G.........Y.NVAC...ILTLPQ..........Y.....Q.RR..G..........YGRL.LIAF..........S................Y.EL....S...K....R...E.....G..............K..L..........G.SPE...........KPLSDLGLL..G.YRQYWRETLVEL.LL......E..P.G..R.D-.............................AI.S.....E.S....ELASLSGMTEKDVHETLVVLN.LLKYNKGNWIIV-lt.....................................................
#=GR C5PI16_COCP7/289-476    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F2QWP3_PICP7/103-292               ...........................................................ny--RFPGK.TMY......K.......-.............D............N.......F..TIK...K.VSGY..RH.......................T..I..LCQNLCLFAKLFLDSKSVY..FS.......I.EN.....FDFYVVL..G...E...S..N...G...R.................................RV..PMGFFS.K..........E....LL....S....W....D.E.........N.NLAC...ILIFPP..........F.....Q.RK..R..........LGHL.LIEF..........S................Y.EL....S...R....F...E.....G..............K..V..........S.GPE...........FPLSAFGKI..G.YLKYWSKVICRE.LL......Y..G.RfsD.CQ.............................SI.T.....L.Q....KLSKFTCIRVKDLISTLDYMG.S------------wfttsdiensksl..........................................
#=GR F2QWP3_PICP7/103-292    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
D8LW66_BLAHO/76-266                ...........................................................fy--SPPGD.EIY......R.......K.............D............N.......L..SVF...E.VDGN..GNy....................yqR..V..YCENLSYIAKLFLDHKTLY..FD.......V.TP.....FYFYVVT..E...Y...D..D...Q...G.................................YH..VVGYFS.K..........E....KC....S....E....M.G.........Y.NLAC...IMTLPP..........H.....Q.RK..G..........YGHF.MIQF..........S................Y.EL....S...K....I...E.....R..............K..V..........G.SPE...........KPLSDLGHI..S.YHSFWKEEIIKL.LA......K..S.H..Q.Q-.............................ML.S.....L.V....DIAKMTSFTTEDIQETLKLLD.LLKYYNGQYILT-vp.....................................................
#=GR D8LW66_BLAHO/76-266     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
#=GR B6QRD0_PENMQ/75-249     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G4UYC1_NEUT9/335-536               .......................................................kmveev-------.-IQ......D.......E.............G............E.......W..SIW...K.VDGA..ED.......................M..L..FCQNLSLFAKLFLDNKSVF..FD.......V.SG.....FHYFLLV..F...T...P..P...D...Pptdpdsd..................vtevvkprGQ..VVGFFS.K..........E....KM....S....W....D.N.........N.NLAC...ILIFPP..........W.....Q.RK..G..........LGAL.LMGV..........S................Y.EI....S...R....R...E.....G..............I..I..........G.GPE...........KPISELGKK..G.YKRFWAGEIARW.LL......S..L.E..P.TGttp......................geetVV.D.....I.E....DCSKATWIAPDDCLAVLREMD.VAE----------dagr...................................................
#=GR G4UYC1_NEUT9/335-536    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G3PQ17_GASAC/269-455               .............................................................WKQPPGK.EIY......R.......R.............S............N.......I..SVF...E.VDGR..DH.......................K..I..YCQNLCLLAKLFLDHKTLY..FD.......V.EP.....FIFYILT..E...V...N..K...Q...G.................................AH..IVGYFS.K..........E....KE....S....P....D.G.........N.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKF.LIAF..........S................Y.EL....S...K....L...E.....S..............A..V..........G.SPE...........KPLSDLGKL..S.YRSYWSWVLLEI.LR......D..F.R..G.--.............................TL.S.....I.K....DLSQMTSITQSDIISTLQSLN.MVKYWKGQHVICVt......................................................
#=GR G3PQ17_GASAC/269-455    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F2ULI6_SALS5/199-360               ............................................................l-RHPPGT.EIY......R.......K.............D............N.......L..QFF...E.LDGR..KH.......................Q..T..YCQNLCLLSKLFLDHKTVE..LD.......T.HP.....FLFYVMC..K...V...D..E...Y...G.................................SH..IVGYFS.K..........E....KD....S....D....E.N.........-.NLAC...ILTLPQ..........Y.....Q.RM..G..........FGKL.LIEF..........S................Y.AL....S...Q....E...E.....G..............K..A..........G.GPE...........KPLSDLGLL..S.YRSYWSQAILEL.LR......D..T.T..E.P-.............................-I.S.....I.A....DIAELTSL-------------.-------------ltl....................................................
#=GR F2ULI6_SALS5/199-360    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G3AIQ7_SPAPN/237-459               ............................................................n-HHPPGL.EIY......R.......Dl...........sT............N.......I..AIW...E.VDGR..KN.......................I..N..YCQNLCLLAKLFLNSKTLY..YD.......V.EP.....FNFYVLT..E...I...D..E...V...Np..............................skYH..FVGYFS.K..........E....KL....N....N....S.D.........Y.NVSC...ILTLPI..........Y.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....S...R....N...E.....F..............K..Y..........G.TPE...........KPLSDLGLL..S.YRNYWRITTAQK.LK......E..L.Y..M.KYlaaqtentqiegea.nsteartknnptdvSI.T.....I.E....TL-------------------.-------------ckltgmtpsdvivgleqlnslyknpttnkyaivl.....................
#=GR G3AIQ7_SPAPN/237-459    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E9NMR2_9MUSC/87-215                ............................................................k-RKPPGR.EIY......R.......K.............G............T.......I..SIF...E.VNGK..EE.......................P..L..YCQLLCLMAKLFLDHKVLY..FD.......M.DP.....FFFYVLC..E...I...D..M...E...G.................................SH..IVGYFS.K..........E....KK....S....Q....D.N.........N.NVAC...ILVLPP..........H.....Q.RK..G..........YGKL.LIAF..........S................Y.EL....S...R....K...E.....G..............V..I..........G.SPE...........KPLSDLGRL..S.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------.......................................................
#=GR E9NMR2_9MUSC/87-215     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G0WB13_NAUDC/222-408               ............................................................l-RHPPGN.EIY......R.......D.............D............Y.......V..SFF...E.IDGR..KQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMT..R...R...D..E...L...G.................................HH..FVGYFS.K..........E....KE....S....A....D.G.........Y.NVAC...ILTLPQ..........Y.....Q.RM..G..........YGRL.LIEF..........S................Y.EL....S...K....K...E.....H..............K..V..........G.SPE...........KPLSDLGLL..S.YRAYWADTLLVL.LV......E..H.G..Q.--.............................EI.T.....I.E....EISSITSMTTTDILHTAKTLN.ILRYYKAQHILY-ls.....................................................
#=GR G0WB13_NAUDC/222-408    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G2YIQ8_BOTF4/614-802               .............................................................WKHPPGD.EIY......R.......D.............G............K.......I..MIF...E.VDGR..KN.......................P..L..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYVMT..E...Y...D..E...L...G.................................CH..FVGYFS.K..........E....KR....P....S....S.L.........N.NVSC...ILVLPI..........H.....Q.RK..G..........YGHL.LIDF..........S................Y.LL....T...R....V...E.....K..............K..T..........G.SPE...........KPLSDMGLV..S.YRNYWRLVLCYY.LQ......R..F.Q..P.SE.............................RVpS.....I.K....AISDEMGLTPDDVISGLDAMG.TL-----------vrdpttgtyam............................................
#=GR G2YIQ8_BOTF4/614-802    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q6PCK3_XENLA/314-501               .............................................................WKHPPGD.EIY......R.......K.............S............S.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...A...G.................................CH..LIGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....D..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LH......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQALQ.MLKYWKGKHLV--lkr....................................................
#=GR Q6PCK3_XENLA/314-501    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A8IKW7_DROSI/565-753               ............................................................r-RRPPGR.EIY......R.......K.............G............N.......I..SIY...E.VNGK..EE.......................S..L..YCQLLCLMAKLFLDHKVLY..FD.......M.DP.....FLFYILC..E...T...D..K...E...G.................................SH..IVGYFS.K..........E....KK....S....L....E.N.........Y.NVAC...ILVLPP..........H.....Q.RK..G..........FGKL.LIAF..........S................Y.EL....S...R....K...E.....G..............V..I..........G.SPE...........KPLSDLGRL..S.YRSYWAYTLLEL.MK......T..R.C..A.PE.............................QI.T.....I.K....ELSEMSGITHDDIIYTLQSMK.MIKYWKGQNVICVt......................................................
#=GR A8IKW7_DROSI/565-753    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
C5JDQ3_AJEDS/79-230                ............................................................r-CTPPGT.KVY......D.......W.............R............G.......Y..SVW...E.IDGE..DH.......................K..L..YAQNLSLFAKLFLDHKSVF..FD.......V.SS.....FLYYILV..F...TnprD..A...N...D.................................YH..VLGYFS.K..........E....KM....S....W....D.A.........N.NLAC...ILIFPP..........Y.....Q.HK..Q..........LGKL.LMGV..........S................Y.KL....S...A....W...Ew..egG..............M..I..........G.GPE...........RPLSEMGRK..S.YVRFWEERISRF.F-......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------llgp...................................................
#=GR C5JDQ3_AJEDS/79-230     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E2B5F9_HARSA/654-737               .............................................................WRHPPGH.EVY......R.......K.............D............K.......I..GVW...E.VDGK..RY.......................K..Q..YCQNLCLLAKFFLDHKTLY..YD.......V.EP.....FLFYVMT..I...G...D..S...E...G.................................CH..TVGYFS.K..........V....ST....-....-....-.-.........-.----...------..........-.....-.--..-..........----.----..........-................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------eflslslt...............................................
#=GR E2B5F9_HARSA/654-737    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F7FUA3_MACMU/318-474               ............................................................l-RHPPGN.EIY......R.......K.............G............T.......I..SFF...E.IDGR..KN.......................K..S..YSQNLCLLAKCFLDHKTLY..YD.......T.DP.....FLFYVMT..E...Y...D..C...K...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKL.LIEF..........S................Y.EL....S...K....V...E.....G..............K..T..........G.TPE...........KPLSDLGLL..S.YRSYWSQTILEI.LM......G..L.K..S.ES.............................--.-.....-.-....---------------------.-------------gerpqiti...............................................
#=GR F7FUA3_MACMU/318-474    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H9GBU7_ANOCA/241-427               .............................................................WRQPPGK.EIY......R.......K.............N............N.......I..SVY...E.VDGK..DH.......................K..I..YCQNLCLLAKLFLDHKTLY..FD.......V.EP.....FIFYILT..E...V...D..R...Q...G.................................AH..IVGYFS.K..........E....KE....S....P....D.G.........N.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKF.LIAF..........S................Y.EL....S...K....L...E.....S..............T..V..........G.SPE...........KPLSDLGKL..S.YRSYWSWVLLEI.LR......D..F.R..G.--.............................TL.S.....I.K....DLSQMTSITQNDIISTLQSLN.MVKYWKGQHVICVt......................................................
#=GR H9GBU7_ANOCA/241-427    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q383C5_TRYB2/391-480               .........................................................klgh-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...-...-..-...-...-.................................--..------.-..........-....--....-....-....-.-.........-.----...------..........-.....-.--..-..........FGQF.MIAA..........S................Y.EL....A...Y....R...R.....K..............N..V..........G.SPE...........KPLTDLGAA..A.YDRYWKRVLIKW.MH......T..L.L..E.GNa...........................aAI.T.....V.D....DDAGDDGQSVTIVVA------.-------------heneakmaapg............................................
C4V792_NOSCE/161-346               ............................................................t-EHPPGR.EIY......R.......H.............N............G.......I..SFF...E.MDGY..TE.......................P..R..FCRNLALLSKLFLDHKSLY..YD.......I.DV.....FLFYVLC..R...I...D..D...N...G.................................YT..IVGYFS.K..........E....KI....S....E....M.G.........Y.NLAC...ILTLPF..........E.....Q.RK..G..........YGRI.LMDF..........S................Y.ML....S...K....K...D.....N..............L..I..........S.GPE...........KPLSDLGLL..S.YRAYWLDVIVDF.LV......E..N.N..N.S-.............................--.S.....V.D....EISKATHITVEDIISTLMYYN.VLKLYKGKFIY--als....................................................
#=GR C4V792_NOSCE/161-346    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B4NPA9_DROWI/285-478               ............................................................l-RHPPGN.EIY......R.......K.............H............T.......I..SFF...E.IDGR..KN.......................K..V..YAQNLCLLAKLFLDHKTLY..YD.......T.DP.....FLFYVMT..E...F...D..S...R...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTMPP..........Y.....Q.RK..G..........YGKL.LIEF..........S................Y.EL....S...K....F...E.....G..............K..T..........G.SPE...........KPLSDLGLL..S.YRSYWAQTILEI.FI......S..Q.N..P.NTdg........................ekpTI.T.....I.N....DICECTSIKKEDVISTLQNLN.LINYYKGQYIVCIn......................................................
#=GR B4NPA9_DROWI/285-478    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E9B048_LEIMU/356-464               ...........................................................rl--RPPGE.EVY......R.......D.............Ev..........rG.......L..SLF...K.INGS..QH.......................I..T..YCRHLFLIGKSFLENKLAG..HD.......V.HN.....YYFYVLC..L...H...H..R...Y...Fpdyv........................sdpsaMY..FAGFFT.W..........E....KH....V....-....S.E.........Y.NLAC...IATLPC..........F.....G.RR..-..........----.----..........-................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------ssrq...................................................
#=GR E9B048_LEIMU/356-464    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E3LPK7_CAERE/226-417               ............................................................m-CHPPGN.QIY......S.......Y.............D............K.......L..SFF...E.IDGR..KN.......................K..S..YAQNLCLLAKLFLDHKTLY..YD.......T.DP.....FLFYVLT..E...E...D..E...K...G.................................HH..IVGYFS.K..........E....KE....S....A....D.E.........Y.NVAC...ILVLPP..........F.....Q.KK..G..........YGSL.LIEF..........S................Y.EL....S...K....I...E.....Q..............K..T..........G.SPE...........KPLSDLGLL..S.YRSYWSMAIMKA.LF......K..F.K..R.SRp..........................neDI.T.....V.Q....DISLSTSIKREDVVSTLQQLD.LYKYYKGQYVIVIs......................................................
#=GR E3LPK7_CAERE/226-417    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G3UBV2_LOXAF/590-777               .............................................................WFHPPAN.EIY......R.......R.............K............D.......L..SVF...E.VDGN..MS.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..K...N...D..E...K...G.................................CH..LVGYFS.K..........E....KL....C....Q....Q.K.........Y.NVSC...IMIMPQ..........H.....Q.RQ..G..........FGRF.LIDF..........S................Y.LL....S...R....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YLAYWKSVILEY.LY......Q..H.H..E.R-.............................HI.S.....I.T....AISRATGMCPHDIATTLQHLH.MIDKRGGRFV---iirr...................................................
#=GR G3UBV2_LOXAF/590-777    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F0XBY5_GROCL/581-773               ............................................................a-KHPPGD.EIY......R.......H.............K............S.......V..SVF...E.VDGR..KN.......................P..V..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYVLC..E...Y...D..E...L...G.................................YH..FVGYFS.K..........E....KR....A....S....S.Q.........N.NVSC...ILTLPI..........H.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...R....A...E.....K..............K..T..........G.SPE...........KPLSDMGLV..S.YRNYWRLVMCRY.LL......G..A.M..T.ESkt........................dklGL.S.....I.K....RISDETGMTADDVISALEGLR.CLVRDP-------qtglyaf................................................
#=GR F0XBY5_GROCL/581-773    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
C4YPI3_CANAW/254-416               ............................................................m-KHPPGN.EIY......R.......D.............S............K.......V..SFW...E.IDGR..KQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYIMT..I...K...S..D...Q...G.................................HH..VVGYFS.K..........E....KE....S....A....D.G.........Y.NVAC...ILTLPC..........Y.....Q.KR..G..........FGKL.LIQF..........S................Y.ML....T...K....V...E.....R..............K..V..........G.SPE...........KPLSDLGLL..S.YRAYWTDTLVKL.LV......E..R.N..S.P-.............................--.-.....-.-....---------------------.-------------alfrknnpqleydea........................................
#=GR C4YPI3_CANAW/254-416    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B5DEC5_XENTR/243-430               .............................................................WKHPPGD.EIY......R.......K.............G............S.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...G...D..N...T...G.................................CH..LIGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....D..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LH......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQALQ.MLKYWKGKHLV--lkr....................................................
#=GR B5DEC5_XENTR/243-430    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
C4JEB2_UNCRE/283-470               ............................................................l-VHPPGN.EIY......R.......D.............D............Y.......V..SFF...E.VDGR..RQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMT..T...R...D..A...H...G.................................CH..LVGYFS.K..........E....KE....S....A....E.G.........Y.NVAC...ILTLPQ..........Y.....Q.RR..G..........YGRL.LIAF..........S................Y.EL....S...K....R...E.....G..............K..L..........G.SPE...........KPLSDLGLL..G.YRQYWRETLVEL.LL......E..P.G..R.E-.............................AI.S.....E.S....ELASLSGMTEKDVHETLVVLN.LLRYNKGNWVIV-lt.....................................................
#=GR C4JEB2_UNCRE/283-470    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q6V9I3_SOLCH/224-410               ............................................................l-KHPPGD.EIY......R.......S.............G............T.......L..SMF...E.VDGK..KN.......................K..V..YGQNLCYLAKLFLDHKTLY..YD.......V.DL.....FLFYVLC..E...C...D..D...R...G.................................CH..MVGYFS.K..........E....KH....S....E....E.S.........Y.NLAC...ILTLPP..........Y.....Q.RK..G..........YGKF.LIAF..........S................Y.EL....S...K....K...E.....G..............K..V..........G.TPE...........RPLSDLGML..S.YRGYWTRVLLDI.LK......K..H.K..G.--.............................NI.S.....I.K....ELSDMTAIKAEDILSTLQGLE.LIQYRKGQHVICAd......................................................
#=GR Q6V9I3_SOLCH/224-410    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E1BS85_CHICK/481-668               .............................................................WFHPPAN.EIY......R.......R.............N............D.......L..SVF...E.VDGN..VS.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..K...N...D..E...K...G.................................CH..LVGYFS.K..........E....KL....C....Q....Q.K.........Y.NVSC...IMIMPQ..........Y.....Q.RQ..G..........FGRF.LIDF..........S................Y.LL....S...R....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YLAYWKSVILEY.LN......C..H.H..E.-K.............................QI.S.....I.K....GMSRATGMCPHDIATTLQQHS.MIDKREDRFVI--irr....................................................
#=GR E1BS85_CHICK/481-668    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
I1CVJ9_RHIO9/111-225               ............................................................e-KKPPGK.VIY......A.......N.............G............K.......I..KVY...E.IDGQ..EH.......................K..F..YCQNLCLLGKLFLDNKTLY..FD.......I.EG.....FKFYVLT..E...Q...N..S...K...Fk..............................syEE..FIGFFS.K..........E....KV....S....Y....D.N.........Y.NLAC...IMTLPS..........H.....Q.RK..G..........YGRL.LIEL..........S................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------kpkeqiv................................................
#=GR I1CVJ9_RHIO9/111-225    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
KAT5_PONAB/233-425                 ............................................................l-RHPPGN.EIY......R.......K.............G............T.......I..SFF...E.IDGR..KN.......................K..S..YSQNLCLLAKCFLDHKTLY..YD.......T.DP.....FLFYVMT..E...Y...D..C...K...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKL.LIEF..........S................Y.EL....S...K....V...E.....G..............K..T..........G.TPE...........KPLSDLGLL..S.YRSYWSQTILEI.LM......G..L.K..S.ESge.........................rpQI.T.....I.N....EISEITSIKKEDVISTLQYLN.LINYYKGQYILT-ls.....................................................
#=GR KAT5_PONAB/233-425      pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
#=GR KAT5_PONAB/233-425      sAS   ..........................................................................................................................................................................................................................................................................................................................................*...........................................................................................................................................................................................................................................................................................................................................
F7GZJ8_CALJA/285-477               ............................................................l-RHPPGN.EIY......R.......K.............G............T.......I..SFF...E.IDGR..KN.......................K..S..YSQNLCLLAKCFLDHKTLY..YD.......T.DP.....FLFYVMT..E...Y...D..C...K...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKL.LIEF..........S................Y.EL....S...K....V...E.....G..............K..T..........G.TPE...........KPLSDLGLL..S.YRSYWSQTILEI.LM......G..L.K..S.ESge.........................rpQI.T.....I.N....EISEITSIKKEDVISTLQYLN.LINYYKGQYILT-ls.....................................................
#=GR F7GZJ8_CALJA/285-477    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B0W2A3_CULQU/229-422               ............................................................l-RHPPGN.EIY......R.......K.............Q............T.......I..SFF...E.IDGR..KN.......................K..S..YAQNLCLLAKLFLDHKTLY..YD.......T.DP.....FLFYVMT..E...F...D..S...R...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTMPP..........Y.....Q.RK..G..........YGKL.LIEF..........S................Y.EL....S...K....F...E.....G..............K..T..........G.SPE...........KPLSDLGLL..S.YRSYWAQTILEI.LI......L..A.K..P.TGdn........................ekpQI.T.....I.N....EICELTSIKKEDVISTLQILN.LINYYKGQYIICIn......................................................
#=GR B0W2A3_CULQU/229-422    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
C7Z8F5_NECH7/271-460               ............................................................l-QHPPGN.EIY......R.......D.............E............A.......I..SFF...E.IDGR..RQ.......................R..T..WCRNLCLLSKMFLDHKTLY..YD.......V.DP.....FLFYVMT..T...R...T..E...K...G.................................CH..LVGYFS.K..........E....KE....S....A....D.G.........Y.NVAC...ILTLPQ..........Y.....Q.RK..G..........YGRL.LIQF..........S................Y.EL....S...K....I...E.....G..............K..L..........G.SPE...........KPLSDLGLL..S.YRQYWSENILEL.LM......G..F.N..E.RE............................eKV.T.....I.E....TISTSLAMTTQDVEHTLQAMR.MQVYHKSDHKIV-ip.....................................................
#=GR C7Z8F5_NECH7/271-460    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q3V1G6_MOUSE/561-748               .............................................................WFHPPAN.EIY......R.......K.............N............N.......I..SVF...E.VDGN..VS.......................T..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..Q...N...D..V...K...G.................................CH..LVGYFS.K..........E....KH....C....Q....Q.K.........Y.NVSC...IMILPQ..........Y.....Q.RK..G..........YGRF.LIDF..........S................Y.LL....S...K....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YMAYWKSVILEC.LY......H..Q.N..D.-K.............................QI.S.....I.K....KLSKLTGVCPQDITSTLHHLR.MLDFRSDQFVII-rr.....................................................
#=GR Q3V1G6_MOUSE/561-748    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
I1RPR8_GIBZE/352-550               ......................................................veelvqd-------.---......-.......E.............G............E.......W..SIW...E.VDGE..KD.......................G..L..FCQNLSLFAKLFLDNKSVF..FD.......V.TG.....FNYFLLV..Y...T...P..P...T...Rpslist.....................epelplPR..IVGFFS.K..........E....KM....S....W....D.S.........N.NLAC...ILIFPP..........W.....Q.RK..G..........LGAL.LMGA..........S................Y.EI....S...R....R...E.....E..............I..L..........G.GPE...........KPISDLGRK..G.YKRYWAGEIARW.LL......S..I.E..L.DTknp......................enevLV.D.....L.N....DCCKATWILPEDCLPVLRDMG.VVEE---------agmgp..................................................
#=GR I1RPR8_GIBZE/352-550    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
C1C0U2_9MAXI/201-258               ............................................................s-RQPPGK.EIY......R.......K.............G............T.......L..SIF...E.TDGK..GF.......................K..L..YCQNLCLLAKLFLDHKTYY..FD.......V.EA....iFVLY---..-...-...-..-...-...-.................................--..------.-..........-....--....-....-....-.-.........-.----...------..........-.....-.--..-..........----.----..........-................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------sm.....................................................
#=GR C1C0U2_9MAXI/201-258    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G1TM69_RABIT/366-553               .............................................................WFHPPAN.EIY......R.......R.............K............D.......L..SVF...E.VDGN..MS.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..K...N...D..E...K...G.................................CH..LVGYFS.K..........E....KL....C....Q....Q.K.........Y.NVSC...IMIMPQ..........H.....Q.RQ..G..........FGRF.LIDF..........S................Y.LL....S...R....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YLAYWKSVILEY.LY......Q..H.H..E.R-.............................HI.S.....I.K....AISRATGMCPHDIATTLQHLH.MIDKRDGRFVI--irr....................................................
#=GR G1TM69_RABIT/366-553    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q7SXF3_DANRE/261-447               .............................................................WRQPPGK.EIY......R.......K.............N............N.......I..SVY...E.VDGK..DH.......................K..I..YCQNLCLLAKLFLDHKTLY..FD.......V.EP.....FIFYILT..E...V...N..K...Q...G.................................AH..IVGYFS.K..........E....KE....S....P....D.G.........N.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKF.LIAF..........S................Y.EL....S...K....L...E.....S..............T..V..........G.SPE...........KPLSDLGKL..S.YRSYWSWVLLEI.LR......D..F.R..G.--.............................TL.S.....I.K....DLSQMTSITQSDIISTLQPLN.MVKYWKGQHVICVt......................................................
#=GR Q7SXF3_DANRE/261-447    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H3APV3_LATCH/290-477               ............................................................l-RHPPGN.EIY......R.......K.............G............T.......I..SFF...E.IDGR..KN.......................K..T..YSQNLCLLAKCFLDHKTLY..YD.......T.DP.....FLFYVMT..E...Y...D..S...K...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKL.LIEF..........N................F.KM....L...H....C...A.....T..............S..P..........A.TGT...........AKTDNHFGI..T.YISHLSPIVLET.LL......L..D.K..K.R-.............................-I.T.....VgN....EISEITSVKKEDVISTLQYLN.LINYYKGQYILT-ls.....................................................
#=GR H3APV3_LATCH/290-477    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E9FTT7_DAPPU/6-194                 .............................................................WRHPPAT.EIY......R.......K.............D............N.......L..SVF...E.VDGN..VN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..V...N...D..R...K...G.................................CH..LIGYFS.K..........E....KL....C....Q....Q.K.........Y.NVSC...IMTMPQ..........Y.....Q.RQ..G..........YGRF.LIHF..........S................Y.LL....S...K....Q...E.....G..............Q..P..........G.TPE...........KPLSDLGKV..S.YHAYWKSICLDY.LH......A..R.R..S.DG.............................SL.C.....L.Q....KMSQDTGLTPLDIAETLQRME.MLRKKPDG-----kvvlci.................................................
#=GR E9FTT7_DAPPU/6-194      pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H2UIK7_TAKRU/396-583               .............................................................WKHPPGD.EIY......R.......K.............G............N.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LVGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LC......N..F.Q..G.K-.............................DI.S.....I.K....EISQETAVNPVDIVSTLQSLQ.MLKYWKGKHLI--lkr....................................................
#=GR H2UIK7_TAKRU/396-583    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B6GYE6_PENCW/73-291                ...........................................................ri--NPPGT.KVY......D.......H.............G............G.......Y..AVW...E.VDGQ..NH.......................K..L..FGQNLSLFAKLFLDHKTVF..FD.......V.AT.....FLYYILT..F...T...D..P...D...Ds..............................dsYY..VLGFFS.K..........E....KL....S....W....D.A.........N.NLAC...ILIFPP..........Y.....Q.HK..Q..........LGKL.LMGV..........S................Y.KL....SgwdS....N...R.....G..............C..I..........G.GPE...........KPLSELGHK..S.YVRFWAERIARF.LL......R..G.K..P.SSsslepdqlkpss.....tpkgsrkrllreTI.T.....V.E....ELGLGTGMLTEDVITALKSMG.LFEPQAT------pkkrkst................................................
#=GR B6GYE6_PENCW/73-291     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B1A1Q6_DROME/1-83                  .............................................................-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...-...-..-...-...-.................................--..------.-..........-....--....-....-....-.-.........-.----...------..........-.....-.--..-..........----.----..........-................Y.LL....T...R....V...E.....G..............K..I..........G.SPE...........KPLSDLGLI..S.YRSYWKDVLLDY.LC......N..R.S..G.N-.............................TI.A.....I.K....DVSQETAIYSYDIVSTLQALG.MMKYWKGKHIV--lkk....................................................
B4DF85_HUMAN/251-438               .............................................................WKHPPGD.EIY......R.......K.............G............S.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LIGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LH......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQALQ.MLKYWKGKHLV--lkr....................................................
#=GR B4DF85_HUMAN/251-438    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H2V026_TAKRU/311-503               ............................................................l-RHPPGN.EIY......R.......K.............G............T.......I..SFF...E.IDGR..KN.......................K..S..YSQNLCLLAKCFLDHKTLY..YD.......T.DP.....FLFYVMT..E...Y...D..S...K...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKL.LIEF..........S................Y.EL....S...K....V...E.....G..............K..T..........G.TPE...........KPLSDLGLL..S.YRSYWSQTILEI.LM......D..L.K..P.DNge.........................rpQI.T.....I.N....EISEITSVKKEDVISTLQYLN.LINYYKGQYILT-ls.....................................................
#=GR H2V026_TAKRU/311-503    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H2NAI1_PONAB/773-960               .............................................................WFHPPAN.EIY......R.......R.............K............D.......L..SVF...E.VDGN..MS.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..K...N...D..E...K...G.................................CH..LVGYFS.N..........E....KL....C....Q....Q.K.........Y.NVSC...IMIMPQ..........H.....Q.RQ..G..........FGRF.LIDF..........S................Y.LL....S...R....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YLAYWKSVILEY.LY......H..H.H..E.R-.............................HI.S.....I.K....AISRATGMCPHDIATTLQHLH.MIDKRDGRFVI--irr....................................................
#=GR H2NAI1_PONAB/773-960    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q9W1A9_DROME/765-953               .............................................................WKQPPGT.EIF......R.......Q.............G............N.......I..SVF...E.VDGN..VN.......................K..I..YCQNLCLLAKFFLDHKTLY..YD.......V.EP.....FLFYILT..K...N...D..Q...S...G.................................CH..LVGYFS.K..........E....KH....C....T....Q.K.........Y.NVSC...ILTMPQ..........Y.....Q.RQ..G..........YGRF.LIDF..........S................Y.LL....S...R....E...E.....G..............Q..L..........G.TPE...........KPLSDLGRL..S.YFSYWKSVVLEY.LY......K..H.R..N.YT.............................KI.T.....F.K....DIAIKTGLAISDIALAFELLN.FIKLRKNDGDIR-yq.....................................................
#=GR Q9W1A9_DROME/765-953    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E7M0L6_YEASV/220-406               ............................................................l-RHPPGN.EIY......R.......D.............D............Y.......V..SFF...E.IDGR..KQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMT..R...R...D..E...L...G.................................HH..LVGYFS.K..........E....KE....S....A....D.G.........Y.NVAC...ILTLPQ..........Y.....Q.RM..G..........YGKL.LIEF..........S................Y.EL....S...K....K...E.....N..............K..V..........G.SPE...........KPLSDLGLL..S.YRAYWSDTLITL.LV......E..H.Q..K.E-.............................-I.T.....I.D....EISSMTSMTTTDILHTAKTLN.ILRYYKGQHIIFLn......................................................
#=GR E7M0L6_YEASV/220-406    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F7CNR1_MONDO/545-723               ......................................................tmscihp-------.---......-.......-.............-............-.......-..-LF...Y.VDGN..VS.......................T..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..Q...N...D..V...K...G.................................CH..LVGYFS.K..........E....KH....C....Q....Q.K.........Y.NVSC...IMILPQ..........Y.....Q.RK..G..........YGRF.LIDF..........S................Y.LL....S...K....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YMAYWKSVILEC.LY......H..Q.N..D.-K.............................QI.S.....I.K....KLSKLTGICPQDITSTLHHLR.MLDFRSDQFVII-rr.....................................................
#=GR F7CNR1_MONDO/545-723    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F0WX68_9STRA/202-389               ............................................................d-RHPPGN.EIY......R.......H.............E............N.......L..SVF...E.VDGA..MS.......................K..F..YCQNLCYFAKLFLDHKTLY..YD.......V.DP.....FLFYIVC..E...V...D..T...R...G.................................FH..PVGYFS.K..........E....KY....S....E....L.G.........Y.NLAC...ILTIPC..........H.....Q.RK..G..........YGNF.IIQF..........S................Y.EL....S...K....K...E.....G..............K..V..........G.SPE...........KPLSDLGLV..S.YRSYWTRKLLFI.LK......E..M.P..E.S-.............................EI.S.....I.M....ELTKMTSIKSDDIISTLQYLN.IIRYIDGQYVF--lit....................................................
#=GR F0WX68_9STRA/202-389    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G0V249_TRYCI/336-444               ...........................................................rl--HPPGQ.EIY......R.......D.............E............Ar.....gF..SMF...E.VNGS..RN.......................V..T..YCRHLFLLGKSFLENKLAG..HD.......V.HN.....YYFYVVC..L...H...H..H...H...Fphyt........................ddtsaMY..FVGYFT.W..........E....KQ....V....V....A.N.........-.NLAC...IVTLPY..........F.....M.GS..G..........----.----..........-................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------esi....................................................
#=GR G0V249_TRYCI/336-444    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E9EE82_METAQ/273-462               ............................................................l-QHPPGN.EIY......R.......D.............D............Y.......V..SFF...E.IDGR..RQ.......................R..T..WCRNLCLLSKMFLDHKTLY..YD.......V.DP.....FLFYVMA..S...R...T..D...K...G.................................CH..IVGYFS.K..........E....KE....S....A....D.G.........Y.NVAC...ILTLPQ..........Y.....Q.RK..G..........YGRL.LIQF..........S................Y.EL....S...K....I...E.....G..............K..L..........G.SPE...........KPLSDLGLL..S.YRQYWSENILDL.LM......G..Y.N..E.RD............................dKV.T.....I.E....AISSALAMTTQDVEHTLQAMK.MQVYHKSDHKIV-ip.....................................................
#=GR E9EE82_METAQ/273-462    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A6SLY5_BOTFB/274-463               ............................................................l-QHPPGN.EIY......R.......D.............D............Y.......V..SFF...E.IDGR..RQ.......................R..T..WCRNLCLISKMFLDHKTLY..YD.......V.DP.....FLFYVMC..S...R...D..E...K...G.................................FH..LVGYFS.K..........E....KE....S....A....D.G.........Y.NVAC...ILTLPQ..........Y.....Q.RK..G..........YGRL.LINF..........S................Y.EL....S...K....I...E.....G..............K..L..........G.SPE...........KPLSDLGLL..S.YRQYWTERIVEE.LL......I..H.N..E.KD............................eRI.S.....I.E....GLSQKLNMTSADVEHTLQALK.MQVYHKGEHKMV-lp.....................................................
#=GR A6SLY5_BOTFB/274-463    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G3W6G6_SARHA/590-777               .............................................................WFHPPAN.EIY......R.......R.............K............D.......L..SVF...E.VDGN..VS.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..K...N...D..E...K...G.................................CH..LVGYFS.K..........E....KL....C....Q....Q.K.........Y.NVSC...IMIMPQ..........Y.....Q.RQ..G..........FGRF.LIDF..........S................Y.LL....S...R....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YLAYWKSVILEY.LY......Y..H.H..E.K-.............................HI.S.....I.K....GISRATGMCPHDIATTLQHLR.MIDKREEKFVII-rr.....................................................
#=GR G3W6G6_SARHA/590-777    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B3NSU7_DROER/313-506               ............................................................l-RHPPGN.EIY......R.......K.............H............T.......I..SFF...E.IDGR..KN.......................K..V..YAQNLCLLAKLFLDHKTLY..YD.......T.DP.....FLFYVMT..E...F...D..S...R...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTMPP..........Y.....Q.RK..G..........YGKL.LIEF..........S................Y.EL....S...K....F...E.....G..............K..T..........G.SPE...........KPLSDLGLL..S.YRSYWAQTILEI.FI......S..Q.N..P.STdg........................ekpTI.T.....I.N....DICECTSIKKEDVISTLQNLN.LINYYKGQYIVCIn......................................................
#=GR B3NSU7_DROER/313-506    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B4N1W0_DROWI/769-956               ............................................................r-RHPPGN.EIY......R.......K.............G............N.......I..SIF...E.VNGK..EE.......................P..L..YCQLLCLMAKLFLDHKVLY..FD.......M.NP.....FLFYVLC..E...I...D..K...E...G.................................SH..IVGYFS.K..........E....KM....Q....E....-.N.........N.NVAC...ILVLPP..........H.....Q.RK..G..........FGKL.LIAF..........S................Y.EL....S...R....K...E.....G..............V..I..........G.SPE...........KPLSDLGRL..S.YRSYWAYSLLEL.MK......V..R.C..S.PE.............................QT.T.....I.K....ELSEMSGITQDDIIYTLQSMK.MIKYWKGQNVICVt......................................................
#=GR B4N1W0_DROWI/769-956    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G3P619_GASAC/332-519               .............................................................WKHPPGD.EVY......R.......K.............G............G.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LVGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........FGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.MC......T..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQSLQ.MLKYWKGKHLV--lkr....................................................
#=GR G3P619_GASAC/332-519    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F7AWA4_MONDO/233-425               ............................................................l-RHPPGN.EIY......R.......K.............G............T.......I..SFF...E.IDGR..KN.......................K..S..YSQNLCLLAKCFLDHKTLY..YD.......T.DP.....FLFYVMT..E...Y...D..C...K...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKL.LIEF..........S................Y.EL....S...K....V...E.....G..............K..T..........G.TPE...........KPLSDLGLL..S.YRSYWSQTILEI.LM......G..L.K..S.ESge.........................rpQI.T.....I.N....EISEITSIKKEDVISTLQYLN.LINYYKGQYILT-ls.....................................................
#=GR F7AWA4_MONDO/233-425    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B4QBJ1_DROSI/764-952               .............................................................WKQPPGT.EIF......R.......Q.............G............N.......I..SVF...E.VDGN..VN.......................K..I..YCQNLCLLAKFFLDHKTLY..YD.......V.EP.....FLFYILT..K...N...D..Q...S...G.................................CH..LVGYFS.K..........E....KH....C....T....Q.K.........Y.NVSC...ILTMPQ..........Y.....Q.RQ..G..........YGRF.LIDF..........S................Y.LL....S...R....E...E.....G..............Q..L..........G.TPE...........KPLSDLGRL..S.YFSYWKSVVLEY.LY......K..H.R..N.YT.............................KI.T.....F.K....DIAIKTGLAISDIALAFELLN.FIKLRKNDGDIR-yq.....................................................
#=GR B4QBJ1_DROSI/764-952    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q2GSV7_CHAGB/571-764               ............................................................a-KHPPGD.EIY......R.......H.............G............S.......V..SVF...E.VDGR..KN.......................P..V..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYVLC..E...Y...D..D...M...G.................................YH..FVGYFS.K..........E....KR....A....S....S.Q.........N.NVSC...ILTLPI..........H.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...R....V...E.....N..............K..T..........G.SPE...........KPLSDMGLV..S.YRNYWRLIMCRY.LL......A..R.F..S.EEks........................gkiGL.G.....I.K....QISDDTGLTPDDVISALEGLR.CLVRDPQTQ----lyafr..................................................
#=GR Q2GSV7_CHAGB/571-764    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G1R1I6_NOMLE/317-509               ............................................................l-RHPPGN.EIY......R.......K.............G............T.......I..SFF...E.IDGR..KN.......................K..S..YSQNLCLLAKCFLDHKTLY..YD.......T.DP.....FLFYVMT..E...Y...D..C...K...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKL.LIEF..........S................Y.EL....S...K....V...E.....G..............K..T..........G.TPE...........KPLSDLGLL..S.YRSYWSQTILEI.LM......G..L.K..S.ESge.........................rpQI.T.....I.N....EISEITSIKKEDVISTLQYLN.LINYYKGQYILT-ls.....................................................
#=GR G1R1I6_NOMLE/317-509    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
#=GR C1H9F2_PARBA/77-228     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F6ZDV1_ORNAN/170-357               .............................................................WFHPPAN.EIY......R.......K.............N............N.......I..SVF...E.VDGN..VS.......................T..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..Q...N...D..V...K...G.................................CH..LVGYFS.K..........E....KH....C....Q....Q.K.........Y.NVSC...IMILPQ..........Y.....Q.RK..G..........YGRF.LIDF..........S................Y.LL....S...K....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YMAYWKSVILEC.LY......H..Q.N..D.-K.............................QI.S.....I.K....KLSKLTGICPQDITSTLHHLR.MLDFRSDQFVII-rr.....................................................
#=GR F6ZDV1_ORNAN/170-357    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H9ENC2_MACMU/390-577               .............................................................WKHPPGD.EIY......R.......K.............G............S.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LIGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LH......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQALQ.MLKYWKGKHLV--lkr....................................................
#=GR H9ENC2_MACMU/390-577    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B9RKC6_RICCO/208-304               ..........................gwelfvlihekndeqgdiqhrllgftavyrfyhyp-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...-...-..-...-...-.................................--..------.-..........-....--....D....K....T.R.........L.RLSQ...ILVLPP..........Y.....Q.HK..G..........YGRQ.LVEV..........V................N.KV....A...I....S...E.....D..............V..Y..........DfTVE...........EPLDHFQ--..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------hvrtcvdiqrl............................................
A8Q168_BRUMA/257-442               ............................................................r-KEPPGI.EIY......K.......E.............K............S.......M..SVY...E.VLGS..ND.......................K..V..YCQCLCLLAKLFLDHKTLY..FD.......V.EP.....FLFYVLC..E...V...D..S...R...G.................................AQ..MVGYFS.K..........E....QG....N....P....D.G.........N.NLAC...ICILPP..........F.....Q.RS..G..........YGKF.LIQL..........S................Y.EI....S...K....R...E.....G..............L..I..........G.SPE...........KPLSDLGKL..S.YRSYWSWAVLEV.LR......T..C.S..K.--.............................-I.S.....I.T....DLSRRTAIHVNDIIETLHSLK.LTRYWKGDHVLY-vt.....................................................
#=GR A8Q168_BRUMA/257-442    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E6ZYY7_SPORE/329-515               ............................................................l-LHPPGL.EVY......R.......S.............C............E.......I..SFF...E.IDGR..KQ.......................R..T..WCRNLCLLSKCFLDHKTLY..YD.......V.DP.....FLFYCMV..K...R...D..D...T...G.................................CH..LLGYFS.K..........E....KD....S....A....E.N.........Y.NVAC...ILTLPQ..........H.....Q.RH..G..........YGKL.LIEF..........S................Y.EL....S...K....I...E.....K..............K..L..........G.SPE...........KPLSDLGLL..S.YRAYWAEIIVEL.LL......K..T.E..E.--.............................DI.S.....I.E....EIAQKTAFTHADVLHTLTALN.MVKSYAGKHMLV-ls.....................................................
#=GR E6ZYY7_SPORE/329-515    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G3TFJ3_LOXAF/317-509               ............................................................l-RHPPGN.EIY......R.......K.............G............T.......I..SFF...E.IDGR..KN.......................K..S..YSQNLCLLAKCFLDHKTLY..YD.......T.DP.....FLFYVMT..E...Y...D..S...K...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKL.LIEF..........S................Y.EL....S...K....V...E.....G..............K..T..........G.TPE...........KPLSDLGLL..S.YRSYWSQTILEI.LM......G..L.K..S.ESge.........................rpQI.T.....I.N....EISEITSIKKEDVISTLQYLN.LINYYKGQYILT-ls.....................................................
#=GR G3TFJ3_LOXAF/317-509    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E2RTZ5_GIAIC/155-258               ............................................................c-RSPPGD.LIY......R.......D.............D............E.......V..CFF...E.INGS..EH.......................T..N..YCRNICLVARLFLQHKTLV..AD.......V.DV.....FLFYVMF..A...K...T..N...N...K.................................KA..NNQQLS.A.........aQ....KA....S....D...eQ.E.........Q.RAHCepeIKRIPD..........W.....Q.QT..G..........----.----..........-................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------pgd....................................................
#=GR E2RTZ5_GIAIC/155-258    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G1X676_ARTOA/149-328               ...................................................erprgtlvhe-------.--F......E.......G.............G............R.......Y..QIY...E.VDGA..DEs.....................eH..L..FLQSMCLFGKFFIQNKFIW..YE.......F.DN.....YMFYVLV..E...K...R..E...G...Sqgk...........................eheFS..VAGFFS.K..........E....KV....S....W....D.Q.........N.NLSC...IILFPQ..........Y.....R.SG..G..........LGGA.LIDF..........S................Y.YI....S...Q....A...T.....G..............R..I..........G.GPE...........KPISKLGQR..G.YDRYWRKSVAAA.IL......G..K.T..A.PR.............................KT.D.....A.R....SSKRAASRTR-----------.-------------kdstkaq................................................
#=GR G1X676_ARTOA/149-328    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F1R4F8_DANRE/757-944               .............................................................WFHPPAN.EIY......R.......K.............D............N.......L..SVF...E.VDGN..IS.......................K..I..FCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..Q...N...D..E...K...G.................................CH..LVGYFS.K..........E....KL....C....Q....Q.K.........Y.NVSC...IMIMPQ..........F.....Q.RQ..G..........FGRF.LIDF..........S................Y.LL....S...R....L...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YLAYWKSVILEY.LH......N..H.P..D.K-.............................SV.S.....I.R....GMSRATGMCPHDIATTLQQLN.MIDFQDGRFVI--iqr....................................................
#=GR F1R4F8_DANRE/757-944    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F1S2G4_PIG/275-462                 .............................................................WFHPPAN.EIY......R.......R.............K............D.......L..SVF...E.VDGN..MS.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..K...N...D..E...K...G.................................CH..LVGYFS.K..........E....KL....C....Q....Q.K.........Y.NVSC...IMIMPQ..........H.....Q.RQ..G..........FGRF.LIDF..........S................Y.LL....S...R....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YLAYWKSVILEY.LY......H..H.H..E.R-.............................HI.S.....I.K....AISRATGMCPHDIATTLQHLH.MIDKRDGRFVI--irr....................................................
#=GR F1S2G4_PIG/275-462      pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E7K9A9_YEASA/153-362               ............................................................t-FKPPGN.EIY......R.......D.............G............K.......L..SVW...E.IDGR..EN.......................V..L..YCQNLCLLAKCFINSKTLY..YD.......V.EP.....FIFYILT..E...R...E..D...T...Enhph........................qnaakFH..FVGYFS.K..........E....KF....N....S....N.D.........Y.NLSC...ILTLPI..........Y.....Q.RK..G..........YGQF.LMEF..........S................Y.LL....S...R....K...E.....S..............K..F..........G.TPE...........KPLSDLGLL..T.YRTFWKIKCAEV.LL......K..L.R..Y.SVkrrsnn................knedtfqQV.S.....L.N....DMAKLTGMIPTDVVFGLEQLQ.-------------vlyrhktrslssl..........................................
#=GR E7K9A9_YEASA/153-362    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F8MJI1_NEUT8/278-467               ............................................................l-HHPPGN.EIY......R.......D.............D............Y.......V..SFF...E.IDGR..RQ.......................R..T..WCRNLCLLSKMFLDHKTLY..YD.......V.DP.....FLFYVMT..T...R...D..D...R...G.................................CH..IIGYFS.K..........E....KE....S....T....D.G.........Y.NVAC...ILTLPQ..........Y.....Q.RK..G..........YGRL.LIQF..........S................Y.EL....S...K....I...E.....G..............K..L..........G.SPE...........KPLSDLGLL..S.YRQYWSENIIDI.LL......G..Y.N..E.RK............................eAC.T.....I.E....NIAVALAMTTQDVEHTLQALK.MQVYHKGEHKIV-vp.....................................................
#=GR F8MJI1_NEUT8/278-467    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H2UZG2_TAKRU/347-534               .............................................................WKHPPGD.EVY......R.......K.............G............S.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LVGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........FGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.MY......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQSLQ.MLKYWKGKHLV--lkr....................................................
#=GR H2UZG2_TAKRU/347-534    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
D0MTA7_PHYIT/233-420               ............................................................n-RHPPGN.EIY......R.......H.............E............H.......L..SVF...E.VDGA..IS.......................K..V..YCQNLCYFAKLFLDHKTLY..YD.......V.DP.....FLFYIIC..E...I...D..S...R...G.................................FH..PVGYFS.K..........E....KY....S....E....L.G.........Y.NLAC...ILTFPC..........H.....Q.RK..G..........YGHF.IIQF..........S................Y.EL....S...K....K...E.....E..............K..V..........G.SPE...........KPLSDLGLV..S.YRSYWTRELLRI.LQ......D..Y.P..E.K-.............................EV.S.....I.M....ELTRMTSIKNEDIIATLQHLN.MIKYLGGQYVY--vvp....................................................
#=GR D0MTA7_PHYIT/233-420    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q4Q053_LEIMA/59-253                ..........................................................afw---IPGD.EIY......R.......D.............E............Er.....rL..CVF...V.LDGR..KPh.....................cA..A..MARRICLLSKLFLVDKVTL..DD.......V.HF.....FSFNALF..E...V...D..D...E...G.................................FH..FVGYFS.K..........E....WT....S....S....W.Sc.......mN.TLSC...VMVLPP..........F.....R.SK..G..........YGSF.LVRL..........S................Y.DI....A...R....L...E.....G..............M..V..........G.TPE...........RPLSKSGNA..L.FRKVWQEEVLFA.VF......A..LgE..Q.GS.............................PV.T.....V.G....ELSKMSSLIVEDVLVALQDLD.VL-----------fsvgkqgpllv............................................
#=GR Q4Q053_LEIMA/59-253     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
KAT6B_HUMAN/773-960                .............................................................WFHPPAN.EIY......R.......R.............K............D.......L..SVF...E.VDGN..MS.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..K...N...D..E...K...G.................................CH..LVGYFS.K..........E....KL....C....Q....Q.K.........Y.NVSC...IMIMPQ..........H.....Q.RQ..G..........FGRF.LIDF..........S................Y.LL....S...R....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YLAYWKSVILEY.LY......H..H.H..E.R-.............................HI.S.....I.K....AISRATGMCPHDIATTLQHLH.MIDKRDGRFVI--irr....................................................
#=GR KAT6B_HUMAN/773-960     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
#=GR KAT6B_HUMAN/773-960     sAS   ..........................................................................................................................................................................................................................................................................................................................................*...........................................................................................................................................................................................................................................................................................................................................
B3N6C7_DROER/581-772               .............................................................WRHPPGD.EIY......R.......K.............G............K.......L..QVW...Q.VDGK..RY.......................K..Q..YCQHLCLLAKFFLDHKTLY..YD.......V.EP.....FLFYIMT..L...A...D..V...D...G.................................CH..IVGYFS.K..........HipflQE....K....N....S.F.........Y.NVSC...ILTLPP..........Y.....Q.RK..G..........YGRL.LIDF..........S................Y.LL....T...R....V...E.....G..............K..I..........G.SPE...........KPLSDLGLI..S.YRSYWKDVLLDY.LC......N..R.S..G.N-.............................TI.A.....I.K....DVSQETAIYSYDIVSTLQALG.MMKYWKGKHIV--lkk....................................................
#=GR B3N6C7_DROER/581-772    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A4I3V8_LEIIN/179-287               ...........................................................rl--RPPGE.EVY......R.......D.............Ev..........rG.......L..SLF...K.INGS..QH.......................V..T..YCRHLFLIGKSFLENKLAG..HD.......V.HN.....YYFYVVC..L...H...H..R...Y...Fpdyv........................sdtsaMY..FAGFFT.W..........E....KH....V....-....S.E.........Y.NLAC...IATLPC..........F.....G.RR..-..........----.----..........-................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------ssrq...................................................
#=GR A4I3V8_LEIIN/179-287    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A4H7H5_LEIBR/272-461               ............................................................l-RHPPGN.EIY......R.......D.............Pv..........rR.......L..VVL...E.LDGS..LE.......................P..T..FCEHLALLSKLFLEHKALD..HD.......M.TP.....FLFYVLC..S...V...E..T...H...G.................................LQ..VLGYFS.K..........E....KQ....T....P....E.P.........Y.NLSC...VLVLPQ..........Y.....Q.SR..G..........IGRF.LIEL..........S................Y.EL....S...R....R...E.....G..............K..V..........G.TPE...........KPLSDLGEK..L.YLGYWADSVTMA.IA......R.aM.E..E.GH.............................CV.S.....M.D....YLVQATAMIQADVLRALQHQK.FLS----------gnqltised..............................................
#=GR A4H7H5_LEIBR/272-461    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B3LNI9_YEAS1/325-534               ............................................................t-FKPPGN.EIY......R.......D.............G............K.......L..SVW...E.IDGR..EN.......................V..L..YCQNLCLLAKCFINSKTLY..YD.......V.EP.....FIFYILT..E...R...E..D...T...Enhph........................qnaakFH..FVGYFS.K..........E....KF....N....S....N.D.........Y.NLSC...ILTLPI..........Y.....Q.RK..G..........YGQF.LMEF..........S................Y.LL....S...R....K...E.....S..............K..F..........G.TPE...........KPLSDLGLL..T.YRTFWKIKCAEV.LL......K..L.R..Y.SVkrrsnn................knedtfqQV.S.....L.N....DMAKLTGMIPTDVVFGLEQLQ.-------------vlyrhktrslssl..........................................
#=GR B3LNI9_YEAS1/325-534    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A2F1D2_TRIVA/160-346               ...........................................................ei--NPPGK.EIY......R.......K.............D............N.......I..SIF...E.ISGF..SN.......................K..F..TCQSLALLCKLFLYQKTII..YD.......I.EG.....FIFYVLC..E...A...D..E...T...G.................................AH..IAAFFS.R..........E....RE....S....Y....A.G.........N.ILSC...IVTLPP..........Y.....Q.KK..G..........YGTQ.LISL..........A................Y.EI....A...R....R...S.....K..............R..C..........G.PPE...........HPLSHLGRL..A.FIRYWSNIMVIT.LY......E..N.K..G.K-.............................IN.D.....I.K....DIVVRTGIDMRDVIEALKSLN.LIVSQDGET----fvvp...................................................
#=GR A2F1D2_TRIVA/160-346    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
C7GNB2_YEAS2/325-534               ............................................................t-FKPPGN.EIY......R.......D.............G............K.......L..SVW...E.IDGR..EN.......................V..L..YCQNLCLLAKCFINSKTLY..YD.......V.EP.....FIFYILT..E...R...E..D...T...Enhph........................qnaakFH..FVGYFS.K..........E....KF....N....S....N.D.........Y.NLSC...ILTLPI..........Y.....Q.RK..G..........YGQF.LMEF..........S................Y.LL....S...R....K...E.....S..............K..F..........G.TPE...........KPLSDLGLL..T.YRTFWKIKCAEV.LL......K..L.R..Y.SVkrrsnn................knedtfqQV.S.....L.N....DMAKLTGMIPTDVVFGLEQLQ.-------------vlyrhktrslssl..........................................
#=GR C7GNB2_YEAS2/325-534    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q55NW0_CRYNB/397-550               ............................................................s-RHPPGD.EIY......R.......E.............G............A.......V..SVF...E.VDGR..KN.......................K..I..YCQNLCLLAKMFLDHKTLY..YD.......V.EP.....FLFYVMT..E...V...D..E...L...G.................................AR..FVGYFS.K..........E....KR....S....M....D.N.........-.NVSC...IMTLPV..........R.....Q.RK..G..........WGQL.LIDF..........S................Y.LL....S...K....K...E.....G..............R..T..........G.SPE...........KPLSGLGAV..S.YKSYWRLTVFKY.LL......N..A.-..-.--.............................--.-.....-.-....---------------------.-------------ispsfnhtle.............................................
#=GR Q55NW0_CRYNB/397-550    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G9P053_HYPAI/526-718               ............................................................a-KHPPGD.EIY......R.......H.............G............S.......V..SVF...E.VDGR..KN.......................P..V..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYVLC..E...Y...D..E...C...G.................................YH..FVGYFS.K..........E....KR....A....S....S.Q.........N.NVSC...ILTLPI..........H.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...K....V...E.....E..............K..T..........G.SPE...........KPLSDMGLV..S.YRNYWRLRLCRY.FI......E..T.L..K.DDgh........................kqnGL.T.....I.K....QISDDTGMTPDDVIAALEGLR.ALVR---------dphtrvyaf..............................................
#=GR G9P053_HYPAI/526-718    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
C5LJ05_PERM5/270-489               ...........................................................ei--NPPGA.LIW......R.......Kvl.........deK............V.......L..GVV...E.VDGQ..AH.......................P..E..YCENLVLFTKLFLEGKSLS..EHqsnrrdlV.KS.....FWFYILV..E...W...D..H...P...Eeippspt..................smpvstrpPH..FVGYFS.K..........E....KV....D....K....QfS.........H.ILSC...IMVLPT..........F.....Q.RH..G..........YGKF.LVNL..........A................F.EL....S...N....R...E.....N..............R..H..........G.SAE...........RPFSPSGHI..L.LHAVWARRIIDF.LQ......R..T.R..E.EEasrs.....................svgcTV.N.....I.A....SIAHGTSVIPSDIWSTLTEAG.LLPS---------qnklrp.................................................
#=GR C5LJ05_PERM5/270-489    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
ESA1_ASPOR/276-463                 ............................................................l-VHPPGN.EIY......R.......D.............D............R.......I..SFF...E.VDGR..RQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMA..T...R...D..E...T...G.................................CH..LVGYFS.K..........E....KD....S....A....E.G.........Y.NLAC...ILTLPQ..........Y.....Q.RL..G..........YGRL.LIAF..........S................Y.EL....S...K....R...E.....G..............K..L..........G.SPE...........KPLSDLGLL..S.YRQYWRETLVEL.LI......E..P.G..R.E-.............................SM.S.....E.N....ELAVLTSMTEKDVHETLVVFN.MLRYHKGNWVIV-lt.....................................................
#=GR ESA1_ASPOR/276-463      pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
#=GR ESA1_ASPOR/276-463      sAS   ..........................................................................................................................................................................................................................................................................................................................................*...........................................................................................................................................................................................................................................................................................................................................
B4GCR9_DROPE/769-957               .............................................................WKQPPGT.EIF......R.......Q.............G............N.......I..SVF...E.VDGN..VN.......................K..I..YCQNLCLLAKFFLDHKTLY..YD.......V.EP.....FLFYILT..K...N...D..Q...S...G.................................CH..LVGYFS.K..........E....KH....C....T....Q.K.........Y.NVSC...ILTMPQ..........Y.....Q.RQ..G..........YGRF.LIDF..........S................Y.LL....S...R....E...E.....G..............Q..L..........G.TPE...........KPLSDLGRL..S.YFSYWKSVVLEY.LY......K..Y.R..N.QP.............................KI.T.....F.K....DIAIKTGLAISDIALAFELLN.FIKLRKNDGDIR-yq.....................................................
#=GR B4GCR9_DROPE/769-957    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E9CW14_COCPS/526-712               ............................................................v-KHPPGD.EIY......R.......D.............G............T.......I..SVF...E.VDGR..KN.......................P..V..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYVMT..E...Y...D..E...L...G.................................FH..FVGYFS.K..........E....KR....P....S....S.S.........N.NVSC...ILTLPI..........H.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...R....I...E.....R..............K..V..........G.SPE...........KPLSDMGLV..S.YRNYWHLVLSYQ.LR......D..Q.R..T.P-.............................-T.S.....I.G....ELSERTGMTPDDVVSGLEGLR.ALVR---------dpvtktyalr.............................................
#=GR E9CW14_COCPS/526-712    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
C5X2L1_SORBI/225-411               ............................................................l-KHPPGD.EIY......R.......S.............G............T.......L..SMF...E.VDGK..KN.......................K..V..YGQNLCYLAKLFLDHKTLY..YD.......V.DL.....FLFYVLC..E...C...D..D...R...G.................................CH..MVGYFS.K..........E....KH....S....E....E.S.........Y.NLAC...ILTLPP..........Y.....Q.RK..G..........YGKF.LIAF..........S................Y.EL....S...K....K...E.....G..............K..V..........G.TPE...........RPLSDLGLL..S.YRGYWTRVLLEI.LK......K..H.K..G.--.............................NI.S.....I.K....ELSDMTAIKADDILSTLQSLD.LIQYRKGQHVICAd......................................................
#=GR C5X2L1_SORBI/225-411    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B4HY61_DROSE/581-772               .............................................................WRHPPGD.EIY......R.......K.............G............K.......L..QVW...Q.VDGK..RY.......................K..Q..YCQHLCLLAKFFLDHKTLY..YD.......V.EP.....FLFYIMT..L...A...D..V...D...G.................................CH..IVGYFS.K..........HipflQE....K....N....S.F.........Y.NVSC...ILTLPP..........Y.....Q.RK..G..........YGRL.LIDF..........S................Y.LL....T...R....V...E.....G..............K..I..........G.SPE...........KPLSDLGLI..S.YRSYWKDVLLDY.LC......N..R.S..G.N-.............................TI.A.....I.K....DVSQETAIYSYDIVSTLQALG.MMKYWKGKHIV--lkk....................................................
#=GR B4HY61_DROSE/581-772    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
MYST2_ARATH/227-413                ............................................................l-KHPPGD.EIY......R.......S.............G............T.......L..SMF...E.VDGK..KN.......................K..V..YAQNLCYLAKLFLDHKTLY..YD.......V.DL.....FLFYVLC..E...C...D..D...R...G.................................CH..MVGYFS.K..........E....KH....S....E....E.A.........Y.NLAC...ILTLPS..........Y.....Q.RK..G..........YGKF.LIAF..........S................Y.EL....S...K....K...E.....G..............K..V..........G.TPE...........RPLSDLGLL..S.YRGYWTRVLLEI.LK......K..H.K..G.--.............................NI.S.....I.K....ELSDVTAIKAEDILSTLQSLE.LIQYRKGQHVICAd......................................................
#=GR MYST2_ARATH/227-413     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
#=GR MYST2_ARATH/227-413     sAS   ..........................................................................................................................................................................................................................................................................................................................................*...........................................................................................................................................................................................................................................................................................................................................
H2NCU4_PONAB/285-477               ............................................................l-RHPPGN.EIY......R.......K.............G............T.......I..SFF...E.IDGR..KN.......................K..S..YSQNLCLLAKCFLDHKTLY..YD.......T.DP.....FLFYVMT..E...Y...D..C...K...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKL.LIEF..........S................Y.EL....S...K....V...E.....G..............K..T..........G.TPE...........KPLSDLGLL..S.YRSYWSQTILEI.LM......G..L.K..S.ESge.........................rpQI.T.....I.N....EISEITSIKKEDVISTLQYLN.LINYYKGQYILT-ls.....................................................
#=GR H2NCU4_PONAB/285-477    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B4I0I1_DROSE/588-776               ............................................................r-RRPPGR.EIY......R.......K.............G............N.......I..SIY...E.VNGK..EE.......................S..L..YCQLLCLMAKLFLDHKVLY..FD.......M.DP.....FLFYILC..E...T...D..K...E...G.................................SH..IVGYFS.K..........E....KK....S....L....E.N.........Y.NVAC...ILVLPP..........H.....Q.RK..G..........FGKL.LIAF..........S................Y.EL....S...R....K...E.....G..............V..I..........G.SPE...........KPLSDLGRL..S.YRSYWAYTLLEL.MK......T..R.C..A.PE.............................QI.T.....I.K....ELSEMSGITHDDIIYTLQSMK.MIKYWKGQNVICVt......................................................
#=GR B4I0I1_DROSE/588-776    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H9HEZ7_ATTCE/4-67                  ................................................llttlshafsnrd-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...-...-..-...-...-.................................--..FNVYVF.Q..........E....KN....S....F....L.N.........Y.NVSC...ILTLPP..........Y.....Q.RQ..G..........YGRL.LIDF..........S................K.YI....R...R....Y...N.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------svslk..................................................
F0YQ63_AURAN/235-426               ............................................................a-RRPPGD.EIY......R.......S.............G............E.......V..AMF...E.VDGA..TPas..................rarL..D..YCQNLCYFAKLFLDHKTLY..YD.......V.DP.....FLFYVLC..E...L...D..D...R...G.................................YH..PVGFYS.K..........E....KY....S....E....V.G.........Y.NLAC...ILAFPP..........Y.....Q.RK..G..........YGRF.LIAF..........S................Y.AL....S...V....K...E.....K..............K..V..........G.APE...........KPLSDLGHI..A.YRSYWAATLLGA.LS......K..L.P..A.DA............................pQI.S.....V.M....ELSKATSIMADDVAATLQYLG.VVRT---------vggvpvv................................................
#=GR F0YQ63_AURAN/235-426    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q4D8L5_TRYCC/241-443               ...........................................................rl--RPPGQ.EIY......R.......D.............E............Sr.....gF..SMF...E.VNGS..QK.......................V..T..YCRHLFLLGKSFLENKLAG..HD.......V.HN.....YFFYVVC..L...H...H..R...H...Fpqyt........................ddpsaMY..FVGYFT.W..........E....KQ....V....A....D.N.........-.NLAC...IVTLPC..........FaggatQ.QKdsGgsngrpqlghFGQF.MIAA..........S................Y.EL....A...Y....R...R.....K..............H..V..........G.SPE...........RPLSDLGAS..A.YDRYWRRVLVAW.MH......T..L.V..T.E-.............................ST.T.....A.V....EVSDGDSTDDQSVIV------.-------------eattpakg...............................................
#=GR Q4D8L5_TRYCC/241-443    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q7Q1Q5_ANOGA/1-83                  .............................................................-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...-...-..-...-...-.................................--..------.-..........-....--....-....-....-.-.........-.----...------..........-.....-.--..-..........----.----..........-................Y.LL....T...R....V...E.....G..............K..I..........G.SPE...........KPLSDLGLI..S.YRSYWKDVLLAY.LC......S..R.P..G.-T.............................TL.S.....I.K....DISQEMAINSYDIVSTLQALG.MMKYWKGKHIIL-kk.....................................................
G5EGP0_CAEEL/557-749               ............................................................l-RAPPGL.EIY......R.......K.............G............D.......I..SVF...E.VDGR..LQ.......................K..E..YCQTLCLVSRMFLESKTVF..YD.......T.EP.....FFFYIVT..I...N...D..D...I...G.................................CH..FAGYFS.K..........E....KY....E....P....D.V.........N.NLSC...IMTLPC..........Y.....Q.EM..G..........LGRF.LIDI..........S................Y.AL....S...R....K...E.....K..............W..F..........G.GPE...........QPLSELGRK..A.YGGYWRTTIASC.LG......R..L.K..D.ELef.........................gsGI.S.....I.K....MIADDTGVNCHDILEVVCSLG.WAKPVDPDEKNH-yk.....................................................
#=GR G5EGP0_CAEEL/557-749    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q3YFI9_MOUSE/285-405               ............................................................l-RHPPGN.EIY......R.......K.............G............T.......I..SFF...E.IDGR..KN.......................K..S..YSQNLCLLAKCFLDHKTLY..YD.......T.DP.....FLFYVMT..E...Y...D..C...K...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKL.LIEF..........S...............eY.VL....P...D....Q...E.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------lagqacvg...............................................
#=GR Q3YFI9_MOUSE/285-405    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A8PFZ7_BRUMA/216-410               ............................................................l-KHPPGN.EIY......R.......S.............D............K.......L..SFF...E.IDGR..KN.......................K..T..YAQNLCLLAKLFLDHKTLY..YD.......T.DP.....FLFYILT..E...Q...D..D...R...G.................................FH..IVGYFS.K..........E....KE....S....A....E.E.........Y.NVAC...ILVLPP..........Y.....Q.KK..G..........YGRL.LIEF..........S................Y.EL....S...K....C...E.....G..............K..A..........G.SPE...........KPLSDLGLL..S.YRSFWSQKIIEK.LV......Q..H.R..E.RCddg.......................dqlYL.S.....V.N....DLSEETSIRKEDIISTLQQLN.LYKYYKGQYVIVLs......................................................
#=GR A8PFZ7_BRUMA/216-410    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A2F781_TRIVA/152-199               ............................................................e-THPPGR.EIY......R.......D.............G............N.......L..SIY...E.LKGK..NQ.......................K..I..PCQNLCLLSKLVSDHKLCF..--.......-.--.....-------..-...-...-..-...-...-.................................--..------.-..........-....--....-....-....-.-.........-.----...------..........-.....-.--..-..........----.----..........-................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------mm.....................................................
#=GR A2F781_TRIVA/152-199    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q4QGD7_LEIMA/253-317               ............................................................l-RTPPGR.LIY......H.......D.............E............Da.....gY..KAF...L.VDGA..KN.......................L..H..YGRCLSLLSKQLIESKVLS..ND.......V.DL.....YEYVVVT..-...-...-..-...-...-.................................--..------.-..........-....--....-....-....-.-.........-.----...------..........-.....-.--..-..........----.----..........-................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------ipras..................................................
#=GR Q4QGD7_LEIMA/253-317    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B0XG73_CULQU/151-337               .............................................................WRHPPGT.EIY......R.......C.............N............D.......I..SIF...E.VDGN..AN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..K...Y...D..R...K...G.................................YH..LVGYFS.K..........E....KH....C....Q....Q.K.........Y.NVSC...IMTMPQ..........Y.....Q.RQ..G..........FGRF.LIDF..........S................Y.LL....S...R....E...E.....G..............Q..P..........G.TPE...........KPLSDLGRV..T.YHAYWRSVVLEY.LH......N..N.R..S.R-.............................FV.S.....L.K....SISRETGIVIADVALAFQLLN.FVKYIKVEQ----gsfk...................................................
#=GR B0XG73_CULQU/151-337    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A4IGQ4_XENTR/337-524               .............................................................WKHPPGD.EIY......R.......K.............G............S.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...G...D..N...T...G.................................CH..LIGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....D..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LH......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQALQ.MLKYWKGKHLV--lkr....................................................
#=GR A4IGQ4_XENTR/337-524    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A4S305_OSTLU/189-376               ............................................................m-RHPPGD.EIY......R.......K.............G............K.......L..SFF...E.IDGK..KH.......................K..L..FCQNLCYLAKLFLDHKTLY..YD.......V.DL.....FLFYVLM..E...C...D..E...R...G.................................YH..IVGYFS.K..........E....KC....S....E....E.G.........Y.NLAC...ILTLPP..........Y.....Q.RK..G..........YGKL.LISF..........S................Y.EL....S...K....I...E.....G..............K..V..........G.TPE...........RPLSDLGLV..S.YRGYWTRELLKI.LG......D..E.S..K.Q-.............................FL.S.....I.K....DLSEMTMIKTEDIISTLQHLG.LLAYTKGAYVICAs......................................................
#=GR A4S305_OSTLU/189-376    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A4S2G8_OSTLU/187-381               ............................................................m-KHPPGK.RVY......R.......H.............P............Qgeg.eplL..SFW...E.IDGA..HF.......................K..M..YCQNLCLMAKLFLDHKTLY..FD.......V.EP.....FMFYVLT..E...S..mD.gD...E...T.................................HD..IVGYFS.K..........E....KV....S....V....D.D.........Y.NLAC...ILTLPA..........Y.....Q.RK..G..........YGSF.LISM..........S................Y.EL....S...R....R...Q.....G..............V..Y..........G.TPE...........RPLSDLGQV..S.YRSYWSRVVLDV.LH......K..H.R..G.--.............................NL.S.....V.K....DLSSMLMFREADIVSALQSLN.LVKYWKGQHIIS-ss.....................................................
#=GR A4S2G8_OSTLU/187-381    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E0VL98_PEDHC/228-415               ............................................................a-RHPPGK.EIY......R.......Q.............G............T.......L..SIF...E.VDGS..NH.......................K..I..YCQNLCLLAKLFLDHKTLY..FD.......V.EP.....FLFYILC..D...S...N..K...H...G.................................AH..LVGYFS.K..........E....KE....S....P....D.G.........N.NVAC...ILTLPP..........Y.....Q.RQ..G..........YGKL.LIAF..........S................Y.EL....S...R....Q...E.....G..............K..V..........G.SPE...........KPLSDLGKL..S.YRSYWSWVLLNE.LR......D..Y.N..R.G-.............................CI.T.....I.K....NLSLKTSISQTDIISTLQSMN.MVKYWKGQHVICVt......................................................
#=GR E0VL98_PEDHC/228-415    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E9BBP9_LEIDB/276-465               ............................................................l-RHPPGN.EIY......R.......D.............Pv..........rR.......L..VVL...E.LDGS..LE.......................P..T..FCEHLALLSKLFLEHKALD..HD.......M.TP.....FLFYVLC..S...M...E..T...H...G.................................LQ..VLGYFS.K..........E....KQ....T....P....E.P.........Y.NLSC...ILVLPQ..........Y.....Q.SR..G..........IGRF.LIEL..........S................Y.EL....S...R....R...E.....G..............K..V..........G.TPE...........KPLSDLGEK..L.YLSYWADSVTMA.IA......R.aM.E..E.GH.............................CV.S.....V.D....YLVQATAMIQADVIRALQHQK.LLN----------ghqltised..............................................
#=GR E9BBP9_LEIDB/276-465    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H3BMX5_HUMAN/33-187                .............................................................WRQPPGK.EIY......R.......K.............S............N.......I..SVY...E.VDGK..DH.......................K..I..YCQNLCLLAKLFLDHKTLY..FD.......V.EP.....FVFYILT..E...V...D..R...Q...G.................................AH..IVGYFS.K..........E....KE....S....P....D.G.........N.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKF.LIAF..........S................Y.EL....S...K....L...E.....S..............T..V..........G.SPE...........KPLSDLGKL..S.YRSYWSWVLLEI.LR......D..F.R..G.T-.............................-L.S.....I.K....---------------------.-------------dlr....................................................
#=GR H3BMX5_HUMAN/33-187     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G9L168_MUSPF/243-430               .............................................................WFHPPAN.EIY......R.......R.............K............D.......L..SVF...E.VDGN..MS.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..K...N...D..E...K...G.................................CH..LVGYFS.K..........E....KL....C....Q....Q.K.........Y.NVSC...IMIMPQ..........H.....Q.RQ..G..........FGRF.LIDF..........S................Y.LL....S...R....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YLAYWKSVILEY.LY......R..H.Q..E.R-.............................HI.S.....I.K....AISRATGMCPHDIATTLQHLH.MIDKRDGRFVI--irr....................................................
#=GR G9L168_MUSPF/243-430    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B8C892_THAPS/127-316               ............................................................r-RHPPGN.EIY......R.......C.............G............N.......L..SMF...E.VDGF..EE.......................R..I..YCQNLCYIAKLFLDHKTLY..FD.......V.DP.....FLFYVLC..E...V...D..E...R...G.................................YH..PVGYYS.K..........E....KY....S....D....V.G.........Y.NLAC...ILTFPS..........H.....Q.RK..G..........YGRF.LIAF..........S................Y.EL....S...K....K...E.....E..............K..V..........G.SPE...........KPMSDLGQQ..A.YIPYWTSTIVDF.ML......N..H.S..G.ND............................tSM.S.....I.M....DIAKKTSIMAEDIVFALNTLG.ILKFVNGVYFI--sae....................................................
#=GR B8C892_THAPS/127-316    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G4NDQ2_MAGO7/390-620               ........................................................adkaa-----AQ.TIQ......D.......E.............G............E.......W..SIW...E.VDGE..DE.......................V..L..FCQNLSLFGKLFLDNKSVF..FD.......V.AA.....FNYYLLV..Y...T...P..P...S...GdvtganqeksgisvstftyshtttannttttttPR..IVGFFS.K..........E....KM....S....W....D.N.........N.TLAC...ILIFPP..........W.....Q.RK..G..........LGAL.LMGV..........S................Y.EI....A...R....R...E.....G..............L..L..........G.GPE...........KPISDLGRK..G.YRRYWAGEIARW.LL......T..V.G..H.DKasqdgqga.............dhddqaevVV.D.....I.D....ECSRAIWVAVEDVLHTLREMD.VAE----------dagm...................................................
#=GR G4NDQ2_MAGO7/390-620    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
I1RW28_GIBZE/592-785               ............................................................a-KHPPGD.EIY......R.......H.............G............S.......V..SVF...E.VDGR..KN.......................P..V..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYVLC..E...Y...N..E...T...G.................................YH..FVGYFS.K..........E....KR....A....S....S.Q.........N.NVSC...ILTLPI..........H.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...K....V...E.....E..............K..T..........G.SPE...........KPLSDMGLV..S.YRNYWRLVMCRY.FL......T..A.M..K.EEky........................ateGL.S.....I.K....RISDNTGMTPDDVISALEGLR.ALVRDPQ------tktyafr................................................
#=GR I1RW28_GIBZE/592-785    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E9DWC5_METAQ/402-611               ........................................................yteei-------.-VH......D.......E.............G............E.......W..SIW...E.VDGE..KH.......................G..L..FCQNLSLFAKLFLDNKSVF..FD.......V.TG.....FNYFLLV..Y...T...P..P...A...Spvapet....................epiqtrpPQ..VCGFFS.K..........E....KM....S....W....D.N.........N.NLAC...ILVFPP..........W.....Q.RK..G..........LGAL.LMGA..........S................Y.EI....S...R....R...E.....G..............I..L..........G.GPE...........KPISDLGKK..G.YKRFWSGEIARW.LL......S..L.E..S.T-.............................--.-.....-.-....---------------------.-------------apqpqpqspqvaggpvitqelivdvndcsrdtwiaaedclgvlrdmgvleda...
#=GR E9DWC5_METAQ/402-611    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B0WUA3_CULQU/14-100                ..........................................................nen-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...-...-..-...-...-.................................--..------.-..........-....--....-....-....-.-.........-.----...------..........-.....-.--..-..........----.----..........G................Y.LL....T...R....V...E.....G..............K..I..........G.SPE...........KPLSDLGLI..S.YRSYWKDVLLAY.LC......S..R.P..G.-T.............................TL.S.....I.K....DISQEMAINSYDIVSTLQALG.MMKYWKGKHIIL-kk.....................................................
B6Q9D1_PENMQ/225-412               ............................................................l-VHPPGN.EIY......R.......D.............D............N.......V..SFF...E.VDGR..RQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMC..T...R...D..E...T...G.................................CH..LTGYFS.K..........E....KD....C....A....E.G.........Y.NLAC...ILTLPQ..........Y.....Q.RR..G..........FGRL.LIQF..........S................Y.EL....S...K....R...E.....G..............K..L..........G.SPE...........KPLSDLGLL..S.YRQYWREVLVEL.LV......E..P.N..R.E-.............................AI.S.....E.F....DLATLTSMTEKDVHETLLVLN.MLRYHKGNWIIV-lp.....................................................
#=GR B6Q9D1_PENMQ/225-412    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E5SFF9_TRISP/279-465               ..........................................................srp---LPGR.TVY......R.......K.............N............N.......L..MVI...E.VDGN..ES.......................K..L..YCQFASLLGKLFIDHKTVC..YL.......I.GE.....FMFYVLY..E...V...V..D...G...E.................................QH..VAGFFS.K..........E....KR....S....T....E.N.........-.NLAC...IVIFPP..........Y.....Q.RK..G..........YGSF.LIQM..........S................Y.AM....S...K....R...E.....G..............I..I..........G.GPE...........RPLSDIGRR..A.YRTYWAWEIVKL.FA......K..N.I..G.V-.............................TM.Q.....I.S....EIVEKTGIERHDVQDTLLEMN.ITYFYNGRRV---vpvt...................................................
#=GR E5SFF9_TRISP/279-465    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H3ISK9_STRPU/393-499               .............................................................WRHPPGD.EIY......R.......K.............G............I.......N..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYIMT..E...N...D..S...S...G.................................CH..ILGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTLPQ..........Y.....M.RQ..G..........YGKM.LIDF..........N................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------is.....................................................
#=GR H3ISK9_STRPU/393-499    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G1LFV0_AILME/561-748               .............................................................WFHPPAN.EIY......R.......K.............N............N.......I..SVF...E.VDGN..VS.......................T..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..Q...N...D..V...K...G.................................CH..LVGYFS.K..........E....KH....C....Q....Q.K.........Y.NVSC...IMILPQ..........Y.....Q.RK..G..........YGRF.LIDF..........S................Y.LL....S...K....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YMAYWKSVILEC.LY......H..Q.N..D.-K.............................QI.S.....I.K....KLSKLTGICPQDITSTLHHLR.MLDFRSDQFVII-rr.....................................................
#=GR G1LFV0_AILME/561-748    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G2XRY3_BOTF4/274-463               ............................................................l-QHPPGN.EIY......R.......D.............D............Y.......V..SFF...E.IDGR..RQ.......................R..T..WCRNLCLISKMFLDHKTLY..YD.......V.DP.....FLFYVMC..S...R...D..E...K...G.................................FH..LVGYFS.K..........E....KE....S....A....D.G.........Y.NVAC...ILTLPQ..........Y.....Q.RK..G..........YGRL.LINF..........S................Y.EL....S...K....I...E.....G..............K..L..........G.SPE...........KPLSDLGLL..S.YRQYWTERIVEE.LL......I..H.N..E.KD............................eRI.S.....I.E....GLSQKLNMTSADVEHTLQALK.MQVYHKGEHKMV-lp.....................................................
#=GR G2XRY3_BOTF4/274-463    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q2UJQ0_ASPOR/582-768               ............................................................a-KHPPGD.EIY......R.......D.............G............S.......I..SIF...E.VDGR..KN.......................P..V..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYIMT..E...F...D..D...L...G.................................CH..FVGYFS.K..........E....KR....P....S....S.A.........N.NVSC...ILTLPI..........H.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...R....I...E.....G..............K..T..........G.SPE...........KPLSDMGLV..S.YRNYWRLILSYQ.LH......K..Q.K..T.P-.............................-L.S.....I.V....ELSERTGMTADDIVSGLEALR.ALVRD--------pvtktyalr..............................................
#=GR Q2UJQ0_ASPOR/582-768    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H3DVT6_PRIPA/168-278               ...........................................................sw--HPPGN.EIY......R.......K.............D............D.......V..SVF...EtVAGR..ITkvatv.............dgnvaG..I..YCQNLCLLAKLYLDHKTLY..YD.......V.EP.....FLFYIVT..K...N...D..E...T...G.................................CH..FVGYFS.K..........E....KY....S....A....Q.K.........F.NLSC...IVTLPC..........Y.....H.KQ..G..........FGR-.----..........-................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------v......................................................
#=GR H3DVT6_PRIPA/168-278    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B4I121_DROSE/313-506               ............................................................l-RHPPGN.EIY......R.......K.............H............T.......I..SFF...E.IDGR..KN.......................K..V..YAQNLCLLAKLFLDHKTLY..YD.......T.DP.....FLFYVMT..E...F...D..S...R...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTMPP..........Y.....Q.RK..G..........YGKL.LIEF..........S................Y.EL....S...K....F...E.....G..............K..T..........G.SPE...........KPLSDLGLL..S.YRSYWAQTILEI.FI......S..Q.N..P.STdg........................ekpTI.T.....I.N....DICECTSIKKEDVISTLQNLN.LINYYKGQYIVCIn......................................................
#=GR B4I121_DROSE/313-506    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G4LXT0_SCHMA/234-427               ............................................................l-RNPPGN.EVY......R.......K.............L............P.......H..SFF...E.IDGR..KN.......................K..T..YAQHLCLLAKLFLDHKTLY..YD.......T.DP.....FLFYVLC..E...V...D..S...R...G.................................YH..LVGYFS.K..........E....KE....S....S....E.D.........Y.NVAC...ILVLPP..........F.....Q.RK..G..........YGKY.LIEF..........S................Y.EL....S...K....I...E.....G..............K..S..........G.SPE...........KPLSDLGLL..S.YRSYWAQTILEL.LL......N..S.K..A.TEtg........................qdpAL.S.....I.N....DIVDRTCIKRDDVIATLSHLN.VLYYVKGQHVIY-ls.....................................................
#=GR G4LXT0_SCHMA/234-427    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E9NP03_9MUSC/77-205                ............................................................k-RKPPGR.EIY......R.......K.............G............T.......I..SIF...E.VNGK..EE.......................P..L..YCQLLCLMAKLFLDHKVLY..FD.......M.DP.....FFFYVLC..E...I...D..M...E...G.................................SH..IVGYFS.K..........E....KK....S....Q....D.N.........N.NVAC...ILVLPP..........H.....Q.RK..G..........YGKL.LIAF..........S................Y.EL....S...R....K...E.....G..............V..I..........G.SPE...........KPLSDLGRL..S.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------.......................................................
#=GR E9NP03_9MUSC/77-205     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H8Z9N8_NEMS1/191-382               ............................................................m-QYPPGR.LLY......L.......D............sE............Y.......I..GVF...E.IEGD..KE.......................S..R..YCQSLCLLAKMFLDHKTLY..YD.......V.ES.....FLFYIIG..E...I...K..D...E...E.................................FI..VQGYFS.K..........E....RG....E....G....R.N.........-.NLSC...IVVFPP..........Y.....R.KL..G..........IGSF.LIDY..........S................Y.YL....T...K....S...T.....As...........lpY..T..........A.GPE...........QPLSAEGER..A.YFSYWVNAILRY.IA......D..K.K..N.FKp...........................eDA.C.....F.E....KVSEHTGVSKENIRWAYKQL-.-------------vkkfgkeltyqdf..........................................
#=GR H8Z9N8_NEMS1/191-382    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G0S295_CHATD/358-534               .........................................................klve------Q.EVH......D.......E.............G............E.......W..SVW...E.VDGE..ED.......................T..L..FCQNLSLFAKLFLDTKSVF..FN.......V.TD.....FKYYLLV..Y...T...P..P...S...Rpanpdtp..................nakliqprGQ..IVGFFS.K..........E....KL....S....W....D.Q.........N.NLAC...ILIFPP..........W.....Q.RK..G..........LGSL.LMGI..........S................Y.EI....S...R....R...E.....G..............L..I..........G.GPE...........KPISDLGKK..G.YKRFWAGEIARW.LL......S..L.P..S.QQ.............................Q-.-.....-.-....---------------------.-------------qqqraatapspdad.........................................
#=GR G0S295_CHATD/358-534    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G2QSB2_THITE/571-764               ............................................................a-KHPPGD.EIY......R.......H.............G............S.......V..SVF...E.VDGR..KN.......................P..V..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYVLC..E...Y...D..D...L...G.................................YH..FVGYFS.K..........E....KR....A....S....S.Q.........N.NVSC...ILTLPI..........H.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...R....V...E.....K..............K..T..........G.SPE...........KPLSDMGLV..S.YRNYWRLVMCRY.LL......E..H.F..S.EEks........................gktGL.S.....I.K....KISDDTGMTPDDVISALEGLR.CLVRDPQTQ----lyafr..................................................
#=GR G2QSB2_THITE/571-764    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A6QW35_AJECN/547-733               ............................................................a-KHPPGD.EIY......R.......D.............G............S.......V..SVF...E.VDGR..KN.......................P..V..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYVMT..E...Y...D..E...L...G.................................CH..FVGYFS.K..........E....KR....P....S....S.S.........N.NVSC...ILTLPI..........H.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...R....V...E.....R..............K..T..........G.SPE...........KPLSDLGLV..S.YRNYWRLVLSYQ.LR......N..Q.K..S.P-.............................-V.S.....I.A....ELSERTGMTADDIVSGLEGLR.ALVRDPQT-----ktyalr.................................................
#=GR A6QW35_AJECN/547-733    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G3AR44_SPAPN/122-285               ............................................................m-KHPPGN.EIY......R.......D.............S............K.......V..SFW...E.IDGR..KQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYIMT..I...K...S..D...Q...G.................................HH..VVGYFS.K..........E....KE....S....A....D.G.........Y.NVAC...ILTLPC..........Y.....Q.KK..G..........YGKL.LIQF..........S................Y.ML....S...N....V...E.....H..............K..V..........G.SPE...........KPLSDLGLL..S.YRAYWTDTLIKL.LV......E..R.N..S.P-.............................--.-.....-.-....---------------------.-------------slyrknnphpvedsds.......................................
#=GR G3AR44_SPAPN/122-285    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H2KNG9_CLOSI/217-412               ............................................................l-RHPPGN.EIY......R.......K.............H............P.......H..SFF...E.IDGR..KN.......................KasT..YAQHLCLLAKLFLDHKTLY..YD.......T.DP.....FLFYVLC..E...I...D..S...R...G.................................FH..LVGYFS.K..........E....KE....S....S....E.D.........Y.NVAC...ILVLPP..........F.....Q.CK..G..........YGKF.LIEF..........S................Y.EL....S...K....L...E.....G..............K..S..........G.SPE...........KPLSDLGLL..S.YRSYWAQTILEL.LL......N..C.K..S.TEpg........................qepAL.S.....I.N....DIVERTSIKRDDVIATLSNLN.VLFYVKGQHVIY-ls.....................................................
#=GR H2KNG9_CLOSI/217-412    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A8B8C1_DROSI/596-784               ............................................................r-RRPPGR.EIY......R.......K.............G............N.......I..SIY...E.VNGK..EE.......................S..L..YCQLLCLMAKLFLDHKVLY..FD.......M.DP.....FLFYILC..E...T...D..K...E...G.................................SH..IVGYFS.K..........E....KK....S....L....E.N.........Y.NVAC...ILVLPP..........H.....Q.RK..G..........FGKL.LIAF..........S................Y.EL....S...R....K...E.....G..............V..I..........G.SPE...........KPLSDLGRL..S.YRSYWAYTLLEL.MK......T..R.C..A.PE.............................QI.T.....I.K....ELSEMSGITHDDIIYTLQSMK.MIKYWKGQNVICVt......................................................
#=GR A8B8C1_DROSI/596-784    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E4V1C5_ARTGP/555-741               ............................................................a-KHPPGD.EIY......R.......E.............G............S.......V..SIF...E.VDGR..KN.......................P..V..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYVMT..E...Y...D..E...W...G.................................CH..FVGYFS.K..........E....KR....P....S....S.S.........N.NVSC...ILTLPI..........H.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...R....L...E.....G..............R..T..........G.SPE...........KPLSDMGLV..S.YRNYWRLVLCYK.FR......D..K.K..S.P-.............................-T.S.....I.T....AISEQTGMTPDDVISALEGLS.ALVR---------dpvtktyalr.............................................
#=GR E4V1C5_ARTGP/555-741    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
D8Q424_SCHCM/120-261               ............................................................m-RHPPGD.EIY......R.......D.............G............A.......V..SIF...E.VDGR..RN.......................K..I..YCQNLCLLSKMFLDHKSLF..YD.......V.EP.....FLFYVMT..E...V...D..E...V...G.................................AR..FVGYFS.K..........E....KR....S....H....K.D.........Y.NLSC...IMTLPV..........R.....Q.RQ..G..........FGNL.LIDF..........S................Y.LL....S...K....R...E.....Q..............R..L..........G.SPE...........KPLSGLGAL..G.YRNYWKLAVHRY.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------l......................................................
#=GR D8Q424_SCHCM/120-261    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F4NT63_BATDJ/194-380               ............................................................l-RHPPGN.EIY......R.......K.............D............D.......L..SFF...E.IDGR..KQ.......................R..R..YCRNLCLLSKLFLDHKTLY..YD.......A.DP.....FLFYLMT..K...T...D..E...R...G.................................MH..LVGYFS.K..........E....KQ....S....A....E.E.........Y.NVAC...ILTLPQ..........F.....Q.RM..G..........YGKL.LIQF..........S................Y.EL....S...K....I...E.....K..............K..T..........G.SPE...........KPLSDLGLL..S.YRSYWADIIIEL.LH......N..M.K..R.--.............................DI.T.....V.Q....EISEITSITPDDIMHTLQTMD.LLKYYHGQFVL--yls....................................................
#=GR F4NT63_BATDJ/194-380    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A9UYF0_MONBE/49-234                ............................................................l-RHPPGT.EIY......R.......K.............D............G.......I..QFF...E.LDGR..KQ.......................R..D..YCQNLCLLSKLFLDHKTLQ..YD.......T.DP.....FLFYVMC..S...L...D..E...R...G.................................SH..IVGYFS.K..........E....KE....S....E....Q.E.........Y.NVAC...ILTLPQ..........Y.....Q.RM..G..........YGTI.LIEF..........S................Y.AL....S...Q....E...E.....H..............K..T..........G.SPE...........KPLSDLGLL..S.YRKYWSQAIVEV.LR......D..V.K..E.--.............................DI.S.....I.N....DIADRTSIKVEDIISTLQHLS.MIKYYKVN-----lqgyl..................................................
#=GR A9UYF0_MONBE/49-234     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B4JKW1_DROGR/637-825               ............................................................k-RRPPGR.EIY......R.......N.............G............T.......I..SIF...E.VNGQ..EQ.......................P..L..YCQLLCLMAKLFLDHKVLY..FD.......M.EP.....FYFYILC..E...I...D..K...E...G.................................YH..IVGYFS.K..........E....KL....S....H....E.N.........N.NVAC...ILVLPP..........H.....Q.RK..G..........YGKL.LIAF..........S................Y.EL....S...R....K...E.....G..............V..I..........G.SPE...........KPLSDLGRL..S.YRSYWAYTLLEL.MK......G..Y.C..S.AE.............................QT.T.....I.K....ELSEASGITQDDIIYTLQSMK.MIKYWKGQNVICVt......................................................
#=GR B4JKW1_DROGR/637-825    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G5C4P8_HETGA/390-577               .............................................................WKHPPGD.EIY......R.......K.............G............S.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LIGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LH......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQALQ.MLKYWKGKHLV--lkr....................................................
#=GR G5C4P8_HETGA/390-577    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B1A1Q9_DROME/1-83                  .............................................................-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...-...-..-...-...-.................................--..------.-..........-....--....-....-....-.-.........-.----...------..........-.....-.--..-..........----.----..........-................Y.LL....T...R....V...E.....G..............K..I..........G.SPE...........KPLSDLGLI..S.YRSYWKDVLLDY.LC......N..R.S..G.N-.............................TI.A.....I.K....DVSQETAIYSYDIVSTLQALG.MMKYWKGKHIV--pkk....................................................
Q1AJD0_MOUSE/390-577               .............................................................WKHPPGD.EIY......R.......K.............G............S.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LIGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LH......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQALQ.MLKYWKGKHLV--lkr....................................................
#=GR Q1AJD0_MOUSE/390-577    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q869X5_DICDI/417-603               ............................................................l-RHPPGN.EIY......R.......S.............G............N.......I..SMF...E.VDGK..RN.......................R..I..YCQNLGLLAKLFLDHKTLY..YD.......V.EP.....FLFYIMT..E...Y...D..E...R...G.................................CH..MVGYFS.K..........E....KE....S....P....D.G.........N.NLAC...ILTLPP..........Y.....Q.RK..G..........FGKL.LISF..........S................Y.EL....S...K....K...E.....G..............K..V..........G.TPE...........KPLSDLGLL..S.YRSYWTQVLLEI.LK......T..H.K..G.--.............................NL.S.....I.T....DISNISAIRTEDVISTLQSLN.LIRYWKGQHVIHIt......................................................
#=GR Q869X5_DICDI/417-603    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
#=GR C4V7W7_NOSCE/124-299    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B8CEC8_THAPS/75-263                ...........................................................hh--SPPGQ.EIY......R.......E.............G............N.......L..SVY...E.LDGK..DH.......................R..V..YCQNLCLLAKLFLDHKTLY..YD.......V.DP.....FHFYVIT..E...V...D..D...E...G.................................AH..IVGYFS.K..........E....KV....S....A....E.E.........Y.NLAC...ILTFPQ..........F.....Q.KC..G..........YGKF.IISL..........S................Y.EL....S...K....R...E.....G..............K..P..........G.SPE...........KPLSDLGKI..S.YRSYWTHVLLTL.FA......G..Q.S..G.EE.............................NV.Q.....I.K....DISLLTGIKTEDIISTLQSLN.MIRFWKGQHVVF-vm.....................................................
#=GR B8CEC8_THAPS/75-263     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A5C1M8_VITVI/201-314               hlysrliplvlllvdgsnpididdprweiyllvqkkavgeedfxyillgftavyrfyhypd-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...-...-..-...-...-.................................--..------.-..........-....--....-....S....S.R.........L.RISQ...ILVLPP..........Y.....Q.HK..G..........YGHY.LLEV..........L................Y.SV....A...I....S...E.....D..............V..H..........DlTVE...........EPLD-----..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------yfqhvr.................................................
C6LNH5_GIAIB/155-227               ............................................................c-RSPPGD.LIY......R.......D.............S............E.......V..CFF...E.INGS..EH.......................S..N..YCRNICLVARLFLQHKTLV..AD.......V.DV.....FLFYVMF..A...K...T..N...S...K.................................--..------.-..........-....--....-....-....-.-.........-.----...------..........-.....-.--..-..........----.----..........-................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------rasqahktp..............................................
#=GR C6LNH5_GIAIB/155-227    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q0UYS2_PHANO/70-273                ...........................................................nt--PPPGV.NVY......T.......K.............D............N.......Y..SLY...E.IDGE..KN.......................K..M..YTQNLCLFAKLFLDTKSVF..YD.......V.TT.....FLYYMLV..A...H...N..P...T...Psipntgl..................gedgvgqeGQ..VVGFFS.K..........E....KM....S....W....D.S.........N.NLAC...ILVFPP..........W.....Q.KQ..G..........LAQI.LMGA..........S................Y.EM....S...R....R...E.....G..............R..L..........G.GPE...........KPLSDLGHL..A.YEHYWSATLARA.IL......S..C.P..S.KK.............................TI.T.....V.L....DLREKTYIVPDDIIATLQAMD.VLEHRKKSG----aeavi..................................................
#=GR Q0UYS2_PHANO/70-273     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F8PUH0_SERL3/11-197                ............................................................l-LHPPGN.EIY......R.......H.............E............D.......I..SFF...E.IDGK..RQ.......................L..T..WCRNLSLLSKCFLDHKTLY..YD.......V.TP.....FMYYVMS..K...R...D..S...A...G.................................CH..IIGYFS.K..........E....KE....S....A....D.N.........Y.NVAC...ILTLPQ..........H.....Q.RH..G..........YGKL.LIEF..........S................Y.EL....S...K....K...E.....G..............K..L..........G.SPE...........KPLSDLGLL..G.YRAYWAEVIVEL.LI......N..T.S..D.E-.............................-L.S.....I.D....DIAQKTSITHADIMNTCTTLQ.LFKHYKGQHIICLs......................................................
#=GR F8PUH0_SERL3/11-197     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B3RTV6_TRIAD/58-245                ............................................................v-YHPPGI.EIY......R.......K.............D............N.......L..SVF...E.VDGN..KQ.......................K..E..YCRNLCLLAKLFLDHKTLF..HD.......V.EP.....FLFYVMA..H...Y...D..T...F...G.................................YH..MIGYFS.K..........E....KR....S....E....C.N.........Y.NLSC...IMILPQ..........Y.....M.KQ..G..........YGKM.LIDF..........S................Y.LL....S...R....L...K.....D..............R..C..........G.SPE...........RPLSDLGLL..S.YRSYWKSIILQH.LQ......R..Y.N..K.E-.............................EI.S.....L.K....EISQDTAVHTSDLISTLQSLD.MLKYWKGMHLIHIk......................................................
#=GR B3RTV6_TRIAD/58-245     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G0NQN3_CAEBE/270-465               .............................................................WRAPPGV.EIY......R.......K.............D............N.......I..SIF...E.VDGH..KQ.......................K..R..YCESLCLLSRCFLESKTNF..WD.......T.DS.....FFFYIIT..E...N...D..E...V...G.................................CH..FAGYFS.K..........V....KY....E....G....E.K.........H.NVNC...IVALPC..........Y.....Q.AK..G..........YGRF.LIDV..........S................Y.AL....S...R....K..qE.....N..............W..I..........A.GPE...........LPFSELGER..A.YASYWKTAVAKA.LA......D..F.K..E.DIegr.......................sgdGI.S.....V.V....DITHATGINVHDVLKTLNDLK.WIKLERGEKK---kekt...................................................
#=GR G0NQN3_CAEBE/270-465    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H9F0R5_MACMU/773-960               .............................................................WFHPPAN.EIY......R.......R.............K............D.......L..SVF...E.VDGN..MS.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..K...N...D..E...K...G.................................CH..LVGYFS.K..........E....KL....C....Q....Q.K.........Y.NVSC...IMIMPQ..........H.....Q.RQ..G..........FGRF.LIDF..........S................Y.LL....S...R....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YLAYWKSVILEY.LY......H..H.H..E.R-.............................HI.S.....I.K....AISRATGMCPHDIATTLQHLH.MIDKRDGRFVI--irr....................................................
#=GR H9F0R5_MACMU/773-960    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q5K7A8_CRYNJ/255-445               ............................................................m-LQPPGR.RVY......Q.......R.............G............S.......Y..TIW...E.VDGA..AA.......................P..L..YCQNISLFGKLFIDHKSVF..FH.......V.EN.....FLFYIIC..D...A...A..T..sQ...R.................................DQ..AMAFFS.K..........E....KV....S....Y....D.D.........Y.NLAC...IVTFPP..........F.....Q.NR..G..........FGKL.LIEF..........S................Y.YL....T...K....H...P.....S..............T..Rpks....lspG.TPE...........RPLSDLGLK..G.YTAYWVSVVLRF.LR......I..L.L..K.D-.............................--.-.....-.-....---------------------.-------------aepvkstesprkerrmsksqsplkpascrtlrtrke...................
#=GR Q5K7A8_CRYNJ/255-445    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
MYST1_ORYSJ/232-418                ............................................................l-KHPPGD.EIY......R.......S.............G............T.......L..SMF...E.VDGK..KN.......................K..V..YGQNLCYLAKLFLDHKTLY..YD.......V.DL.....FLFYVLC..E...C...D..D...R...G.................................CH..MVGYFS.K..........E....KH....S....E....E.S.........Y.NLAC...ILTLPP..........Y.....Q.RK..G..........YGKF.LIAF..........S................Y.EL....S...K....K...E.....G..............K..V..........G.TPE...........RPLSDLGLL..S.YRGYWTRVLLEI.LK......K..H.K..S.--.............................NI.S.....I.K....ELSDMTAIKADDILSTLQSLD.LIQYRKGQHVICAd......................................................
#=GR MYST1_ORYSJ/232-418     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
#=GR MYST1_ORYSJ/232-418     sAS   ..........................................................................................................................................................................................................................................................................................................................................*...........................................................................................................................................................................................................................................................................................................................................
#=GR E9D9V5_COCPS/76-289     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H2UGW4_TAKRU/494-680               .............................................................WFHPPAN.EIY......R.......K.............E............D.......V..SVF...E.VDGN..VS.......................T..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..Q...N...D..S...K...G.................................CH..LVGYFS.K..........E....KH....C....Q....Q.K.........Y.NVSC...IMILPQ..........Y.....Q.RK..G..........YGRF.LIDF..........S................Y.LL....S...K....R...E.....G..............Q..P..........G.SPE...........KPLSDLGRL..S.YMAYWRSVVLEC.LH......E..V.Q..D.R-.............................QI.T.....I.R....QLSKLTGICPQDITTTLHSLN.MLEQRGD------rlvlvr.................................................
#=GR H2UGW4_TAKRU/494-680    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H2WH43_CAEJA/225-416               ...........................................................lp--HPPGN.QIY......S.......Y.............D............K.......L..SFF...E.IDGR..KN.......................K..S..YAQNLCLLAKLFLDHKTLY..YD.......T.DP.....FLFYVLT..E...E...D..E...K...G.................................HH..IVGYFS.K..........E....KE....S....A....E.E.........Y.NVAC...ILVLPS..........F.....Q.KK..G..........YGSL.LIEF..........S................Y.EL....S...K....I...E.....Q..............K..T..........G.SPE...........KPLSDLGLL..S.YRSYWSMAIMKE.LF......A..F.K..Q.RHp..........................geDI.T.....V.Q....DISASTSIKREDVVSTLQQLD.LYKYYRGQYVIVIs......................................................
#=GR H2WH43_CAEJA/225-416    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q5DDR3_SCHJA/234-427               ............................................................l-RNPPGN.EVY......R.......K.............L............P.......H..SFF...E.IDGR..KN.......................K..T..YAQHLCLLAKLFLDHKTLY..YD.......T.DP.....FLFYVLC..E...I...D..S...R...G.................................YH..LVGYFS.K..........E....KE....S....S....E.D.........Y.NVAC...ILVLPP..........F.....Q.RK..G..........YGKY.LIEF..........S................Y.EL....S...K....I...E.....G..............K..S..........G.SPE...........KPLSDLGLL..S.YRSYWAQTILEL.LL......N..S.K..A.AEtg........................qdpAL.S.....I.N....DIVDRTCIKRDDVIATLSHLN.VLYYVKGQHVIY-ls.....................................................
#=GR Q5DDR3_SCHJA/234-427    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
C5JLU8_AJEDS/565-751               ............................................................a-KHPPGD.EIY......R.......D.............G............S.......V..AVF...E.VDGR..KN.......................P..V..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYVMT..E...Y...D..E...L...G.................................CH..FVGYFS.K..........E....KR....P....S....S.S.........N.NVSC...ILTLPI..........H.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...R....V...E.....R..............K..T..........G.SPE...........KPLSDLGLV..S.YRNYWRLVLSYQ.LR......N..Q.K..S.P-.............................-V.S.....I.A....ELSERTGMTADDIVSGLEGLR.ALVRDPQT-----ktyalr.................................................
#=GR C5JLU8_AJEDS/565-751    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
C3XZ16_BRAFL/69-261                ............................................................l-RHPPGN.EIY......R.......K.............S............T.......I..SFF...E.IDGR..KN.......................K..M..YSQNLCLLAKLFLDHKTLY..YD.......T.DP.....FLFYVMT..E...Y...D..I...K...G.................................FH..IVGFFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........Y.....Q.RK..G..........YGKL.LIEF..........S................Y.EL....S...K....F...E.....G..............K..T..........G.SPE...........KPLSDLGLL..S.YRSYWSQTILEI.LV......N..L.K..P.ENge.........................rpQI.T.....I.N....EICELTSIRKEDVISTLQHLN.LINYYKGQYIITLs......................................................
#=GR C3XZ16_BRAFL/69-261     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G2R7S4_THITE/382-592               .....................................................mveevvqd-------.---......-.......E.............G............E.......W..SIW...E.VDGE..KD.......................V..L..FCQNLSLFAKLFLDNKSVF..FD.......V.TG.....FNYFLLV..Y...T...P..P...A...Pptdpnad..................vaetvpprSQ..IVGFFS.K..........E....KI....S....W....D.N.........N.NLAC...ILIFPP..........W.....Q.RK..G..........LGSL.LMGV..........S................Y.EI....S...R....R...E.....G..............L..L..........G.GPE...........KPISDLGKR..G.YKRFWAGEIARW.IL......S..L.E..P.QQ.............................Q-.-.....-.-....---------------------.-------------ppqqdpsslsspsssgsaaevvtdiqacsqatwiapedcllvlremgva......
#=GR G2R7S4_THITE/382-592    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G1M0R5_AILME/390-577               .............................................................WKHPPGD.EIY......R.......K.............G............S.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LIGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LH......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQALQ.MLKYWKGKHLV--lkr....................................................
#=GR G1M0R5_AILME/390-577    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G3B7Z2_CANTC/287-478               ............................................................n-KHPPGV.EIY......R.......Da...........rN............R.......V..AVW...E.VDGR..KN.......................I..N..YCQSLCLLAKLFLNSKTLY..YD.......V.EP.....FIFYVLT..E...I...D..P...L...Dp..............................svYH..FVGYFS.K..........E....KL....N....S....S.D.........Y.NVSC...ILTLPI..........Y.....Q.RK..G..........YGHL.LIDF..........S................Y.LL....S...R....N...E.....F..............K..F..........G.TPE...........KPLSDLGLL..S.YRNYWKISMAYR.LR......T..F.D..V.--.............................MI.S.....I.E....NLSKLSGMTPSDVVVGLEQLDaLVKNSKT------ntfgiv.................................................
#=GR G3B7Z2_CANTC/287-478    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B0DA09_LACBS/86-238                ............................................................a-RHPPGD.EIY......R.......D.............G............A.......I..SIF...E.VDGR..RN.......................K..I..YCQNLCLLSKMFLDHKSLF..YD.......V.EP.....FLFYVIT..E...V...D..D...F...G.................................AR..FVGYFS.K..........E....KR....S....P....K.D.........Y.NVSC...IMTLPV..........R.....Q.RQ..G..........WGNL.LIDF..........S................Y.LL....S...K....K...E.....Q..............R..L..........G.SPE...........KPLSSLGAL..G.YKNYWTLAVYRY.LE......S..A.P..E.--.............................--.-.....-.-....---------------------.-------------kirleg.................................................
#=GR B0DA09_LACBS/86-238     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H3D150_TETNG/266-452               .............................................................WKQPPGK.EIY......R.......R.............S............N.......I..SVY...E.VDGR..DH.......................K..I..YCQNLCLLAKLFLDHKTLY..FD.......V.EP.....FIFYILT..E...V...N..K...H...G.................................AH..IVGYFS.K..........E....KE....S....P....D.G.........N.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKF.LIAF..........S................Y.EL....S...K....L...E.....S..............A..V..........G.SPE...........KPLSDLGKL..S.YRSYWSWVLLEI.LR......D..F.R..G.--.............................TL.S.....I.K....DLSQMTSITQSDIISTLQSLN.MVKYWKGQHVICVt......................................................
#=GR H3D150_TETNG/266-452    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H2KUD1_CLOSI/279-463               ............................................................q-RQPIGK.QIY......R.......K.............G............D.......L..VVF...E.LDGN..EQ.......................R..L..YCQNLCLLAKLFLDHKTLY..YD.......V.AP.....FMFYVLC..E...M...D..R...E...G.................................CH..LVGYFS.K..........E....KV....S....V....D.N.........Y.NLAC...ILTLPP..........F.....Q.KR..G..........IGRF.LITL..........S................Y.EL....A...K....I...E.....G..............V..V..........G.TPE...........KPLSDLGRL..S.YRSYWEDVIFHY.LS......E..H.P..S.--.............................-C.S.....L.G....ELSSFTCIAVDDILWTLRCQR.-------------gvqlwrsgrhaym..........................................
#=GR H2KUD1_CLOSI/279-463    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A7BJV7_RAT/385-572                 .............................................................WKHPPGD.EIY......R.......K.............G............S.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LIGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LH......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQALQ.MLKYWKGKHLV--lkr....................................................
#=GR A7BJV7_RAT/385-572      pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A4S9V4_OSTLU/195-398               ............................................................l-RHPPGN.EIY......R.......H.............PerqateksparaQ.......L..RMW...E.VDGS..NA.......................T..T..YCQNLCLIAKLFLDHKTLY..YD.......V.AA.....FYFYVLT..E...R...D..F...D...Esg............................kplYR..IIGYFS.K..........E....KG....Q....V....E.T.........-.NLAC...ILTLPP..........Y.....Q.RR..G..........YGGF.LIEF..........S................Y.EL....A...K....R...E.....G..............R..I..........G.TPE...........RPLSDLGFA..S.YRTYWSRVIYES.LS......S..T.S..A.-G.............................GV.N.....V.A....ELSKKTNIRVDDIVSTLQPFS.SIRFFKDQGF---lnit...................................................
#=GR A4S9V4_OSTLU/195-398    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B7ZU40_XENTR/224-410               .............................................................WRQPPGK.EIY......R.......K.............G............N.......I..SVY...E.VDGK..DH.......................K..I..YCQNLCLLAKLFLDHKTLY..FD.......V.EP.....FVFYILT..E...V...D..R...Q...G.................................AH..IVGYFS.K..........E....KE....S....P....D.G.........N.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKF.LIAF..........S................Y.EL....S...K....L...E.....N..............T..V..........G.SPE...........KPLSDLGKL..S.YRSYWSWVLLEI.LR......D..F.R..G.--.............................TL.S.....I.K....DLSQMTSITQNDIIGTLQSLN.MVKYWKGQHVICVt......................................................
#=GR B7ZU40_XENTR/224-410    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G0NLL5_CAEBE/610-798               ............................................................a-THPPGN.EIY......R.......D.............D............V.......V..SFF...E.VNGA..VQ.......................K..K..YCQDLCLLAKLFIASKTLY..EE.......V.ET.....FKFYVLC..E...L...T..T...E...G.................................FV..IVGYFS.K..........E....NN....P....S....K.N.........N.NLSC...LLVLPM..........V.....Q.KM..G..........YGRL.LIDM..........S................Y.EL....S...R....R...E.....R..............K..V..........G.HPE...........HPLSDLGIL..A.YRGYWRSSLLCY.IR......K..H.K..N.SE.............................RM.S.....I.K....EIALATRITPVDIVNQLMLDN.IINFKNGIYS---ikis...................................................
#=GR G0NLL5_CAEBE/610-798    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F4KE11_ARATH/122-335               ............ecavdekvedkvtslkmtrhqkrkidethiegheeldaaslreheeftk-------.---......-.......-.............-............-.......-..---...-.---V..KN.......................K..V..YAQNLCYLAKLFLDHKTLY..YD.......V.DL.....FLFYVLC..E...C...D..D...R...G.................................CH..MVGYFS.K..........E....KH....S....E....E.A.........Y.NLAC...ILTLPS..........Y.....Q.RK..G..........YGKF.LIAF..........S................Y.EL....S...K....K...E.....G..............K..V..........G.TPE...........RPLSDLGLL..S.YRGYWTRVLLEI.LK......K..H.K..G.--.............................NI.S.....I.K....ELSDVTAIKAEDILSTLQSLE.LIQYRKGQHVICAd......................................................
#=GR F4KE11_ARATH/122-335    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A8P3F7_BRUMA/88-205                .............................................................-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...-...-..-...-...-.................................--..------.-..........E....QK....C....S....L.E.........N.NLSC...ILTLPS..........Y.....R.NK..G..........YGRF.LIDF..........S................F.LL....S...R....R...E.....G..............T..T..........G.TPE...........RPLSDMGNL..V.YRSYWRSIVLEY.FK......R..P.S..C.ASi...........................aVL.T.....F.A....DIAKTTGVSVEDIIQTMKDLG.MLHFDQNGEI---esfv...................................................
B5VDT2_YEAS6/48-258                ............................................................t-FKPPGN.EIY......R.......D.............G............K.......L..SVW...E.IDGR..EN.......................V..L..YCQNLCLLAKCFINSKTLY..YD.......V.EP.....FIFYILT..E...R...E..D...T...Enhph........................qnaakFH..FVGYFS.K..........E....KF....N....S....N.D.........Y.NLSC...ILTLPI..........Y.....Q.RK..G..........YGQF.LMEF..........S................Y.LL....S...R....K...E.....S..............K..F..........G.TPE...........KPLSDLGLL..T.YRTFWKIKCAEV.LL......K..L.R..Y.SVkrrsnn................knedtfqQV.S.....L.N....DMAKLTGMIPTDVVFGLEQLQ.V------------lyrhktrslssld..........................................
#=GR B5VDT2_YEAS6/48-258     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
C0NP86_AJECG/286-473               ............................................................l-VHPPGN.EIY......R.......D.............D............N.......V..SFF...E.VDGR..RQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMT..T...R...D..E...H...G.................................CH..LVGYFS.K..........E....KE....S....A....E.G.........Y.NVAC...ILTLPQ..........Y.....Q.RR..G..........FGRL.LIAF..........S................Y.EL....S...K....R...E.....N..............K..L..........G.SPE...........KPLSDLGLL..G.YRQYWRETIVDI.LM......E..P.G..R.E-.............................TI.S.....E.S....ELASLSAMTEKDVHETLVVLN.LLRYNKGNWIIV-lt.....................................................
#=GR C0NP86_AJECG/286-473    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G4TAJ0_PIRID/316-506               ............................................................l-RHPPGN.EVY......R.......S.............Kdea......sgeE.......I..SFF...E.IDGK..RQ.......................N..T..WCRNLSLLSKCFLDHKTLY..YD.......V.QP.....FLYYVMT..S...N...D..S...Y...G.................................CH..LVGYFS.K..........E....KE....S....A....E.N.........Y.NVAC...ILTLPQ..........H.....Q.RK..G..........YGKL.LIEF..........S................Y.EL....S...K....R...E.....M..............K..L..........G.SPE...........KPLSDLGLL..S.YKAYWMEIIIEL.LN......D..C.H..E.--.............................DI.S.....I.E....EIANRTSITQNDVIC--QQLG.LFKYYKGQHVLCVt......................................................
#=GR G4TAJ0_PIRID/316-506    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
D3B5D4_POLPA/1-131                 .............................................................-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-----MT..E...C...D..A...R...G.................................CH..MVGYFS.K..........E....KD....S....P....D.G.........Y.NLAC...ILTLPP..........F.....Q.RK..G..........FGKL.LISF..........S................Y.EL....S...K....K...E.....H..............K..I..........G.APE...........KPLSDLGLL..S.FRSYWTQVLLEI.LR......K..H.K..G.--.............................NL.S.....I.L....DISNMTSIRTEDIISTLQSLN.LIRYWKGQHIISVt......................................................
G7Q102_MACFA/173-359               .............................................................WRQPPGK.EIY......R.......K.............S............N.......I..SVY...E.VDGK..DH.......................K..I..YCQNLCLLAKLFLDHKTLY..FD.......V.EP.....FVFYILT..E...V...D..R...Q...G.................................AH..IVGYFS.K..........E....KE....S....P....D.G.........N.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKF.LIAF..........S................Y.EL....S...K....L...E.....S..............T..V..........G.SPE...........KPLSDLGKL..S.YRSYWSWVLLEI.LR......D..F.R..G.--.............................TL.S.....I.K....DLSQMTSITQNDIISTLQSLN.MVKYWKGQHVICVt......................................................
#=GR G7Q102_MACFA/173-359    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B5VSC6_YEAS6/134-320               ............................................................l-RHPPGN.EIY......R.......D.............D............Y.......V..SFF...E.IDGR..KQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMT..R...R...D..E...L...G.................................HH..LVGYFS.K..........E....KE....S....A....D.G.........Y.NVAC...ILTLPQ..........Y.....Q.RM..G..........YGKL.LIEF..........S................Y.EL....S...K....K...E.....N..............K..V..........G.SPE...........KPLSDLGLL..S.YRAYWSDTLITL.LV......E..H.Q..K.E-.............................-I.T.....I.D....EISSMTSMTTTDILHTAKTLN.ILRYYKGQHIIFLn......................................................
#=GR B5VSC6_YEAS6/134-320    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H9HEZ9_ATTCE/688-776               .......................................................lklsct-------.-FY......R.......K.............D............K.......I..GVW...E.VDGK..RY.......................K..Q..YCQNLCLLAKFFLDHKTLY..YD.......V.EP.....FLFYVMT..I...G...D..S...E...G.................................CH..TVGYFS.K..........C....QY....Y....N....C.K.........-.NI--...------..........-.....-.--..-..........----.----..........-................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------iaitnsfsr..............................................
#=GR H9HEZ9_ATTCE/688-776    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G1QSN1_NOMLE/342-529               .............................................................WKHPPGD.EIY......R.......K.............G............S.......I..SVF...E.VDGK..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVMT..E...A...D..N...T...G.................................CH..LIGYFS.K..........E....KN....S....F....L.N.........Y.NVSC...ILTMPQ..........Y.....M.RQ..G..........YGKM.LIDF..........S................Y.LL....S...K....V...E.....E..............K..V..........G.SPE...........RPLSDLGLI..S.YRSYWKEVLLRY.LH......N..F.Q..G.K-.............................EI.S.....I.K....EISQETAVNPVDIVSTLQALQ.MLKYWKGKHLV--lkr....................................................
#=GR G1QSN1_NOMLE/342-529    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A9YI74_DROME/147-235               ............................................................l-RHPPGN.EIY......R.......K.............H............T.......I..SFF...E.IDGR..KN.......................K..V..YAQNLCLLAKLFLDHKTLY..YD.......T.DP.....FLFYVMT..E...F...D..S...R...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...VLTM--..........-.....-.--..-..........----.----..........-................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------.......................................................
#=GR A9YI74_DROME/147-235    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B6HQ72_PENCW/535-721               ............................................................a-KHPPGD.EIY......R.......D.............R............S.......V..SIF...E.VDGR..KN.......................P..V..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYVMT..E...F...D..D...L...G.................................CH..FVGYFS.K..........E....KR....P....S....S.A.........N.NVSC...ILTLPI..........H.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...R....I...E.....G..............K..N..........G.SPE...........KPLSDMGLV..S.YRNYWRLILSYQ.LR......D..L.K..T.P-.............................-I.S.....I.A....DLSDRTGMTADDIVSALEGLR.ALV----------rdpitktyair............................................
#=GR B6HQ72_PENCW/535-721    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H2Y514_CIOSA/16-197                .............................................................WFHPPAN.EIY......R.......S.............D............N.......L..SIF...E.VDGN..VS.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FSFYCLT..I...N...D..A...K...G.................................CH..LVGYFS.K..........E....KH....C....Q....Q.K.........Y.NVSC...IMTMPQ..........Y.....Q.RQ..G..........YGRF.LIDF..........S................Y.LL....S...R....K...E.....G..............Q..A..........G.SPE...........KPLSDLGEV..S.YNAYWRSTLLQY.FS......N..R.L..G.EK.............................NL.S.....L.R....DISKNTGMCPHDIASMLQKLG.MISV---------tpv....................................................
#=GR H2Y514_CIOSA/16-197     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E1G6T8_LOALO/220-414               ............................................................l-KHPPGN.EIY......R.......S.............D............K.......L..SFF...E.IDGR..KN.......................K..T..YAQNLCLLAKLFLDHKTLY..YD.......T.DP.....FLFYILT..E...Q...D..D...R...G.................................FH..IVGYFS.K..........E....KE....S....A....E.E.........Y.NVAC...ILVLPP..........Y.....Q.KK..G..........YGRL.LIEF..........S................Y.EL....S...K....C...E.....G..............K..T..........G.SPE...........KPLSDLGLL..S.YRSFWSQKIIEK.LV......Q..H.R..E.RCddg.......................dqlYL.S.....V.N....DLSEETSIRKEDIISTLQQLN.LYKYYKGQYVIVLs......................................................
#=GR E1G6T8_LOALO/220-414    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B3S7S8_TRIAD/179-372               ............................................................l-YHPPGN.EIY......R.......K.............G............K.......L..SFF...E.VDGR..KN.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......T.EP.....FLFYILT..E...F...D..N...K...G.................................FH..TVGYFS.K..........E....KE....S....S....E.D.........Y.NVAC...ILTLPP..........Y.....Q.RK..G..........YGKV.LIEF..........S................Y.VL....S...K....F...E.....G..............K..L..........G.SPE...........KPLSDLGLL..S.YRSYWSQAILEI.LS......K..Y.L..D.ESng........................stpNI.T.....I.N....EICDATSMRKEDVISTLQHLD.LIRYYKGQYILT-ls.....................................................
#=GR B3S7S8_TRIAD/179-372    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F2TM69_AJEDA/79-232                ............................................................r-CTPPGT.KVY......D.......W.............R............G.......Y..SVW...E.IDGE..DH.......................K..L..YAQNLSLFAKLFLDHKSVF..FD.......V.SS.....FLYYILV..F...TnprD..A...N...D.................................YH..VLGYFS.K..........E....KM....S....W....D.A.........N.NLAC...ILIFPP..........Y.....Q.HK..Q..........LGKL.LMGV..........S................Y.KL....S...A....W...Ew..egG..............M..I..........G.GPE...........RPLSEMGRK..S.YVRFWEERISRF.F-......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------llgppg.................................................
#=GR F2TM69_AJEDA/79-232     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H0Z8D3_TAEGU/773-960               .............................................................WFHPPAN.EIY......R.......R.............N............D.......L..SVF...E.VDGN..VS.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..K...N...D..E...K...G.................................CH..LVGYFS.K..........E....KL....C....Q....Q.K.........Y.NVSC...IMIMPQ..........Y.....Q.RQ..G..........FGRF.LIDF..........S................Y.LL....S...R....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YLAYWKSVILEY.LN......C..H.H..E.-K.............................QI.S.....I.K....GMSRATGMCPHDIATTLQQHS.MIDKREDRFVI--irr....................................................
#=GR H0Z8D3_TAEGU/773-960    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G4V0D3_NEUT9/584-777               ............................................................a-KHPPGD.EIY......R.......H.............G............S.......I..SVF...E.VDGR..KN.......................P..V..YCQNLCLLAKLFLGSKTLY..YD.......V.EP.....FLFYVLC..E...Y...D..Q...Y...G.................................YH..FVGYFS.K..........E....KR....A....S....S.Q.........N.NVSC...ILTLPI..........H.....Q.RK..G..........YGNL.LIDF..........S................Y.LL....T...R....V...E.....Q..............K..T..........G.SPE...........KPLSDMGLV..S.YRNYWRLVMCKY.LL......E..H.C..S.SDpk........................ekkGL.S.....I.K....KISDDTGLTPDDVISSLEGLR.CLVRDPQTQ----lyafr..................................................
#=GR G4V0D3_NEUT9/584-777    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B0D0S6_LACBS/315-502               ............................................................m-LHPPGN.EIY......R.......H.............E............D.......I..SFY...E.IDGK..RQ.......................L..T..WCRNLSLLSKCFLDHKTLY..YD.......V.TP.....FMYYVMA..K...R...D..S...A...G.................................CH..IIGYFS.K..........E....KE....S....A....E.N.........Y.NVAC...ILALPQ..........H.....Q.RH..G..........YGKL.LIEF..........S................Y.EL....S...K....K...E.....G..............K..L..........G.SPE...........KPLSDLGLL..G.YRAYWAETIIEL.LI......N..T.P..D.G-.............................EL.S.....I.D....DIAQKTSITHADVMNTCITLQ.LFKHYKGQHIICLn......................................................
#=GR B0D0S6_LACBS/315-502    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F7E3A7_MACMU/772-959               .............................................................WFHPPAN.EIY......R.......R.............K............D.......L..SVF...E.VDGN..MS.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..K...N...D..E...K...G.................................CH..LVGYFS.K..........E....KL....C....Q....Q.K.........Y.NVSC...IMIMPQ..........H.....Q.RQ..G..........FGRF.LIDF..........S................Y.LL....S...R....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YLAYWKSVILEY.LY......H..H.H..E.R-.............................HI.S.....I.K....AISRATGMCPHDIATTLQHLH.MIDKRDGRFVI--irr....................................................
#=GR F7E3A7_MACMU/772-959    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q4SAS3_TETNG/264-450               .............................................................WKQPPGK.EIY......R.......R.............S............N.......I..SVY...E.VDGR..DH.......................K..I..YCQNLCLLAKLFLDHKTLY..FD.......V.EP.....FIFYILT..E...V...N..K...H...G.................................AH..IVGYFS.K..........E....KE....S....P....D.G.........N.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKF.LIAF..........S................Y.EL....S...K....L...E.....S..............A..V..........G.SPE...........KPLSDLGKL..S.YRSYWSWVLLEI.LR......D..F.R..G.--.............................TL.S.....I.K....DLSQMTSITQSDIISTLQSLN.MVKYWKGQHVICVt......................................................
#=GR Q4SAS3_TETNG/264-450    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B2ASN1_PODAN/285-474               ............................................................l-QHPPGN.EIY......R.......D.............D............F.......V..SFF...E.IDGR..RQ.......................R..T..WCRNLCLLSKMFLDHKTLY..YD.......V.DP.....FLFYVMT..T...R...D..E...R...G.................................CH..LIGYFS.K..........E....KE....S....T....D.G.........Y.NVAC...ILTLPQ..........Y.....Q.RK..G..........YGRL.LIQF..........S................Y.EL....S...K....I...E.....G..............K..L..........G.SPE...........KPLSDLGLL..S.YRQYWSENIIDL.LL......G..F.S..E.RD............................eKC.T.....I.E....TIAQHLAMTATDVEHTLQALK.MQVYHKGEHKIVLs......................................................
#=GR B2ASN1_PODAN/285-474    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
D8R327_SELML/189-375               ............................................................l-KHPPGD.EIY......R.......N.............G............S.......L..SMF...E.VDGR..KN.......................K..V..YSQNLCYLAKLFLDHKTLY..YD.......V.DL.....FLFYILC..E...C...D..D...R...G.................................CH..MVGYFS.K..........E....KH....S....E....E.G.........Y.NLAC...ILTLPP..........Y.....Q.RK..G..........YGKF.LIAF..........S................Y.EL....S...K....K...E.....T..............K..V..........G.TPE...........RPLSDLGLL..S.YRGYWTRVLLDI.LK......K..H.R..G.--.............................NV.S.....I.K....ELTDMTAIRSEDVINTLQQLE.LIQYRKGQYVICAd......................................................
#=GR D8R327_SELML/189-375    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
I1KFP7_SOYBN/216-402               ............................................................l-KHPPGD.EIY......R.......S.............G............T.......L..SMF...E.VDGK..KN.......................K..V..YGQNLCYLAKLFLDHKTLY..YD.......V.DL.....FLFYVLC..E...C...D..D...R...G.................................CH..MVGYFS.K..........E....KH....S....E....E.S.........Y.NLAC...ILTLPP..........Y.....Q.RK..G..........YGKF.LIAF..........S................Y.EL....S...K....K...E.....G..............K..V..........G.TPE...........RPLSDLGLL..S.YRGYWTRVLLDI.LK......K..H.K..G.--.............................NI.S.....I.K....ELSDMTAIKAEDILTTLQSLE.LIQYRKGQHVICAd......................................................
#=GR I1KFP7_SOYBN/216-402    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A4K580_BOMMO/215-401               ............................................................a-RQPQGN.EIY......R.......K.............G............T.......I..AIF...E.ADGK..EH.......................K..I..YCQNLCLLAKLFLDHKTLY..FD.......I.EQ.....FLFYILC..E...V...D..K...Q...G.................................AH..LVGYFS.K..........E....KD....S....P....E.G.........N.NVAC...ILTLPP..........Y.....Q.RQ..G..........YGKL.LIAF..........S................Y.EL....S...R....L...E.....Q..............V..V..........G.SPE...........KPLSDLGKL..S.YRSYWSYVLLEV.LS......A..S.R..G.--.............................TL.S.....I.K....DLSQMTGISQTDIISTLQSMN.MVKYWKGQHVICVt......................................................
#=GR A4K580_BOMMO/215-401    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
C6HMG4_AJECH/49-236                ............................................................l-VHPPGN.EIY......R.......D.............D............N.......V..SFF...E.VDGR..RQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMT..T...R...D..E...H...G.................................CH..LVGYFS.K..........E....KE....S....A....E.G.........Y.NVAC...ILTLPQ..........Y.....Q.RR..G..........FGRL.LIAF..........S................Y.EL....S...K....R...E.....N..............K..L..........G.SPE...........KPLSDLGLL..G.YRQYWRETIVDI.LM......E..P.G..R.E-.............................TI.S.....E.S....ELASLSAMTEKDVHETLVVLN.LLRYNKGNWIIV-lt.....................................................
#=GR C6HMG4_AJECH/49-236     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H0Z4T5_TAEGU/561-748               .............................................................WFHPPAN.EIY......R.......K.............N............N.......I..SVF...E.VDGN..VS.......................T..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..Q...N...D..V...K...G.................................CH..LVGYFS.K..........E....KH....C....Q....Q.K.........Y.NVSC...IMILPQ..........Y.....Q.RK..G..........YGRF.LIDF..........S................Y.LL....S...K....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YMAYWKSVILEC.LY......H..Q.R..D.-K.............................QL.S.....I.K....KLSKLTGICPQDITSTLHHLR.MLDFRSDQFVII-rr.....................................................
#=GR H0Z4T5_TAEGU/561-748    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G9CU79_LEIDO/354-470               .........................................................fdae-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...-...D..W...D...G.................................DA..VMGYFS.R..........L....KH....H....P....D.H.........-.TLSC...IVTLPM..........F.....Q.RT..R..........VATF.LLDV..........A................Y.WM....T...R....Q...R.....Q..............R..LcgcgfcgqsgG.AIS...........RPFSPHGQS..L.LLSYWRRALLRS.LA......E..V.A..-.--.............................--.-.....-.-....---------------------.-------------plhrrasraaqpelrftl.....................................
B4GJS3_DROPE/605-796               .............................................................WRHPPGD.EIY......R.......K.............G............K.......L..QVW...Q.VDGK..RH.......................K..Q..YCQHLCLLAKFFLDHKTLY..YD.......V.EP.....FLFYIMT..L...A...D..I...D...G.................................CH..IVGYFS.K..........HipflQE....K....N....S.F.........Y.NVSC...ILTLPP..........Y.....Q.RK..G..........YGRL.LIDF..........S................Y.LL....T...R....V...E.....G..............K..I..........G.SPE...........KPLSDLGLI..S.YRSYWKDVLLDY.LC......N..R.S..G.N-.............................TL.N.....I.K....DVSQEMAIYSYDIVSTLQALG.MMKYWKGKHIV--lkk....................................................
#=GR B4GJS3_DROPE/605-796    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F7B2S8_HORSE/233-419               .............................................................WRQPPGK.EIY......R.......K.............S............N.......I..SVY...E.VDGK..DH.......................K..I..YCQNLCLLAKLFLDHKTLY..FD.......V.EP.....FVFYILT..E...V...D..R...Q...G.................................AH..IVGYFS.K..........E....KE....S....P....D.G.........N.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKF.LIAF..........S................Y.EL....S...K....L...E.....S..............T..V..........G.SPE...........KPLSDLGKL..S.YRSYWSWVLLEI.LR......D..F.R..G.--.............................TL.S.....I.K....DLSQMTSITQNDIISTLQSLN.MVKYWKGQHVICVt......................................................
#=GR F7B2S8_HORSE/233-419    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E4X6F2_OIKDI/185-381               ............................................................r-RCPPGN.EIY......R.......S.............K............S......gV..CIF...E.VDGR..KN.......................A..T..YCENLCLLAKCFLDHKNCD..YD.......T.TP.....FIFYVMC..E...Y...E..E...L...G.................................AH..LVGFFS.K..........E....KN....S....P....N.D.........F.NVAC...ILTLPC..........Y.....Q.KR..G..........FGRL.LIQF..........S................Y.EL....S...R....I...E.....G..............K..H..........G.TPE...........RPLSDLGLL..S.YRSYWTYTIMEV.LN......K..L.L..E.DCknk......................kaapKI.S.....L.Q....SIANRTCIKVDDVKSTLIQNK.MFSWYHGCYVICId......................................................
#=GR E4X6F2_OIKDI/185-381    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G3JGV3_CORMM/329-529               ......................................................yteqivq-------.---......D.......E.............G............E.......W..SVW...E.VDGE..VD.......................G..L..FCQNLSLFAKLFLDNKSVF..FD.......V.TG.....FNYFLLV..Y...T...P..P...F...Kppvgne.....................apeapvPQ..VTGFFS.K..........E....KM....S....W....D.N.........N.NLAC...ILVFPP..........W.....Q.RK..G..........LGAL.LMGV..........S................Y.EI....S...R....R...E.....G..............I..L..........G.GPE...........KPISDLGKK..G.YKRFWSGEIARW.LL......S..L.D..D.GGpqipp...................pgmelMV.D.....V.G....DCSDATWITPDDCLGVLRDMG.VL-----------ddagv..................................................
#=GR G3JGV3_CORMM/329-529    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G3RR84_GORGO/470-659               .............................................................WFHPPAN.EIY......R.......R.............K............D.......L..SVF...E.VDGN..MS.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..K...N...D..E...K...G.................................CH..LVGYFS.K..........E....KL....C....Q....Q.K.........Y.NVSC...IMIMPQ..........H.....Q.RQ..G..........FGRF.LIDF..........S................K.ML....S...T....Ri.gQ.....G..............A..A..........S.QPQ...........GPVSDLVKL..S.YLAYWKSVILEY.LY......H..H.H..E.R-.............................HI.S.....I.K....AISRATGMCPHDIATTLQHLH.MIDKRDGRFVI--irr....................................................
#=GR G3RR84_GORGO/470-659    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G7KGV7_MEDTR/179-295               .................................qlyshiiplvlllvdgsspidvtdsmwe-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....--LYVVV..Q...Kk.tD..Q...Q...Ge..............................iqCL..LLGFTA.I..........Y....RFyhypD....N....S.R.........L.RLGQ...ILVLPP..........Y.....Q.HK..G..........YGRY.LLEV..........L................N.DV....A...I....A...E.....N..............V..F..........DlTVE...........EPLDNFQ--..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------hvrscv.................................................
G0U7B2_TRYVI/65-260                ..........................................................ryw---IPGD.EIY......Rc.....aK.............R............K.......C..VVF...E.IDGR..RPe.....................cA..A..YTRRIARLAKLFLEEKTTL..DD.......L.HF.....FAFIALF..E...V...D..D...Y...G.................................YH..FTGYFS.K..........Ew..rKS....V....L....C.T.........N.TLSC...VVVLPP..........Y.....R.AK..G..........YGSL.LIEI..........S................Y.EM....G...R....I...E.....R..............V..P..........G.TPE...........RPLSATGRR..V.FQKMWQEEVLRA.IS......S..L.H..E.KN............................lPV.T.....I.N....SLSSENGMTTEDVAVALHRLG.IVFNVQQ------ngplicv................................................
#=GR G0U7B2_TRYVI/65-260     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G0PNX4_CAEBE/256-323               ............................................................i-RAPPGI.EIY......R.......R.............D............N.......V..SVF...E.VDGR..KQ.......................K..G..YCQTLCLVSRMFLESKTVF..YD.......T.EP.....FFFYVVT..M...N...D..E...S...-.................................--..------.-..........-....--....-....-....-.-.........-.----...------..........-.....-.--..-..........----.----..........-................-.--....-...-....-...-.....-..............-..-..........-.---...........---------..-.------------.--......-..-.-..-.--.............................--.-.....-.-....---------------------.-------------vgrnl..................................................
#=GR G0PNX4_CAEBE/256-323    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G5E8Q9_MOUSE/318-510               ............................................................l-RHPPGN.EIY......R.......K.............G............T.......I..SFF...E.IDGR..KN.......................K..S..YSQNLCLLAKCFLDHKTLY..YD.......T.DP.....FLFYVMT..E...Y...D..C...K...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKL.LIEF..........S................Y.EL....S...K....V...E.....G..............K..T..........G.TPE...........KPLSDLGLL..S.YRSYWSQTILEI.LM......G..L.K..S.ESge.........................rpQI.T.....I.N....EISEITSIKKEDVISTLQYLN.LINYYKGQYILT-ls.....................................................
#=GR G5E8Q9_MOUSE/318-510    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G3QL80_GORGO/318-510               ............................................................l-RHPPGN.EIY......R.......K.............G............T.......I..SFF...E.IDGR..KN.......................K..S..YSQNLCLLAKCFLDHKTLY..YD.......T.DP.....FLFYVMT..E...Y...D..C...K...G.................................FH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........Y.....Q.RR..G..........YGKL.LIEF..........S................Y.EL....S...K....V...E.....G..............K..T..........G.TPE...........KPLSDLGLL..S.YRSYWSQTILEI.LM......G..L.K..S.ESge.........................rpQI.T.....I.N....EISEITSIKKEDVISTLQYLN.LINYYKGQYILT-ls.....................................................
#=GR G3QL80_GORGO/318-510    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F1KUK8_ASCSU/319-506               ............................................................r-RQPPGD.EIY......R.......K.............G............N.......L..SVF...E.VDGR..AS.......................K..P..YCQCLCLLSKLFLDHKTLF..FD.......V.ET.....FLFYVLC..E...V...D..D...V...G.................................AH..CVGHFS.K..........E....RL....S....A....-.-.........N.NLAC...IMVLPP..........F.....Q.RR..G..........YGKL.LIQL..........S................Y.EL....S...S....R...E.....G..............V..I..........G.TPE...........KPLSDLGKV..S.YRSYWWWVILEA.LD......E..L.N..I.DD............................vTL.Q.....V.S....DLSVASGIAEDDIISTLQTMQ.LIKYWKGDHVVR-tt.....................................................
#=GR F1KUK8_ASCSU/319-506    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F7B937_HORSE/561-748               .............................................................WFHPPAN.EIY......R.......K.............N............N.......I..SVF...E.VDGN..VS.......................T..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..Q...N...D..V...K...G.................................CH..LVGYFS.K..........E....KH....C....Q....Q.K.........Y.NVSC...IMILPQ..........Y.....Q.RK..G..........YGRF.LIDF..........S................Y.LL....S...K....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YMAYWKSVILEC.LY......H..Q.N..D.-K.............................QI.S.....I.K....KLSKLTGICPQDITSTLHHLR.MLDYRSDQFVII-rr.....................................................
#=GR F7B937_HORSE/561-748    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H2PQ67_PONAB/562-749               .............................................................WFHPPAN.EIY......R.......K.............N............N.......I..SVF...E.VDGN..VS.......................T..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..Q...N...D..V...K...G.................................CH..LVGYFS.K..........E....KH....C....Q....Q.K.........Y.NVSC...IMILPQ..........Y.....Q.RK..G..........YGRF.LIDF..........S................Y.LL....S...K....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YMAYWKSVILEC.LY......H..Q.N..D.-K.............................QI.S.....I.K....KLSKLTGICPQDITSTLHHLR.MLDFRSDQFVII-rr.....................................................
#=GR H2PQ67_PONAB/562-749    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q5B8Q9_EMENI/71-245                ...........................................................rt--TPPGT.KVY......D.......H.............A............G.......Y..SVW...E.VDGA..DH.......................K..L..FGQNLSLFAKLFLDHKSVF..FD.......V.VS.....FLYYILV..F...T...N..P...N...Sagnd.........................pnetYH..ILGFFS.K..........E....KL....S....W....D.A.........N.NLAC...ILVFPP..........Y.....Q.HK..Q..........LGKL.LMGI..........S................Y.KI....SgweR....D...S.....S..............L..I..........G.GPE...........KPLSEMGSR..S.YSRFWEERIARH.LL......L..H.P..S.S-.............................--.-.....-.-....---------------------.-------------dgsqagagataaqlee.......................................
#=GR Q5B8Q9_EMENI/71-245     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q4X6C9_PLACH/122-305               ............................................................i-RHPPGN.EIY......R.......N.............D............K.......I..SIF...E.IDGN..YF.......................R..I..YCENLCFLSKLFLDHKTLK..HR.......V.NL.....FLFYVIT..E...F...D..E...Y...G.................................YH..ITGYFS.K..........E....KY....S....-....-.K.........N.NVSC...ILTLPQ..........H.....Q.KK..G..........YGKF.LINF..........S................Y.FL....S...Q....T...E.....K..............R..T..........G.TPE...........RPLSDLGAA..S.YMAYWYETLLKV.LI......N..Y.E..Q.--.............................-L.S.....I.Q....ELSEITSIETYDIVACLEEKE.IIKSVSN------genvyyi................................................
#=GR Q4X6C9_PLACH/122-305    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H2UGW0_TAKRU/557-743               .............................................................WFHPPAN.EIY......R.......K.............E............D.......V..SVF...E.VDGN..VS.......................T..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..Q...N...D..S...K...G.................................CH..LVGYFS.K..........E....KH....C....Q....Q.K.........Y.NVSC...IMILPQ..........Y.....Q.RK..G..........YGRF.LIDF..........S................Y.LL....S...K....R...E.....G..............Q..P..........G.SPE...........KPLSDLGRL..S.YMAYWRSVVLEC.LH......E..V.Q..D.R-.............................QI.T.....I.R....QLSKLTGICPQDITTTLHSLN.MLEQRGD------rlvlvr.................................................
#=GR H2UGW0_TAKRU/557-743    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B5DJ87_DROPS/136-328               ............................................................l-RHPPGE.EIY......R.......K.............D............T.......I..SFF...E.IDGR..RS.......................M..T..YAQNLCLLSKLFLDEKTLY..HN.......T.DP.....FLFYIMT..V...F...D..S...R...G.................................FH..MVGYFS.K..........E....KV....S....E....D.N.........-.NLAC...VLTLPP..........Y.....Q.RM..G..........YGRL.LIEF..........S................Y.EL....S...K....C...E.....G..............K..T..........G.TPE...........KPLSDLGLL..S.YRSFWAQAILDV.LI......K..Q.K..L.DVae........................dkiTI.S.....I.N....EISEKTSISTDDVVSTLTHLK.LIKYYKSRYIVCVk......................................................
#=GR B5DJ87_DROPS/136-328    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
#=GR C0SHR3_PARBP/77-228     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A2FPH6_TRIVA/149-336               ...........................................................rp--YPPGK.EIY......R.......N.............E............N.......I..SIF...E.LKGN..SQ.......................K..L..SCQCLCLLSKLFLDHKTLY..YD.......V.EG.....FNLYVLC..E...L..gD..D...D...Q.................................VH..IAGYFS.K..........E....LD....S....S....D.N.........N.ILAC...ITILPP..........Y.....Q.KK..G..........YGFL.LISL..........A................Y.EI....A...R....R...E.....G..............K..V..........G.GPE...........RPLSDLGKI..A.FSSYWREVIIST.LK......D..K.L..T.E-.............................IK.Y.....I.S....DIVKLTYIDEDDVVDTLKPLN.LVESYRGE-----yelle..................................................
#=GR A2FPH6_TRIVA/149-336    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A4HGT1_LEIBR/256-355               ...........................................srqrsvapqdgatatals-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...-...-..-...-...-.................................--..------.-..........-....--....-....-....-.-.........-.----...----PP..........Q.....V.LR..H..........LGQF.MIAV..........S................Y.EL....A...Y....R...R.....K..............Q..I..........G.TPE...........KPLSDLGAI..A.YQQFWRRAIVRW.MK......E..T.L..N.T-.............................-I.R.....R.-....---------------------.-------------anavdvdgddmdktvqkraq...................................
A1D7A7_NEOFI/75-287                ...........................................................rt--TPPGA.QVY......E.......H.............G............G.......Y..SVW...E.VDGE..EH.......................K..L..YAQNLSLFAKLFLDHKSVF..FD.......V.AT.....FLYYILT..F...T...D..P...E...Np..............................ekYH..ILGFFS.K..........E....KL....S....W....D.A.........N.NLAC...ILVFPP..........Y.....Q.HK..Q..........LGKL.LMGV..........S................Y.KI....S...G....W...Ee..daG..............F..I..........G.GPE...........KPLSDMGTR..S.YSRFWQERIGRR.LL......L..D.D..T.DAfvqetqpvk...........etrkrhsatFM.T.....V.R....DIGQATGMLTEDVITALRGMD.IVQPET-------pskrrkak...............................................
#=GR A1D7A7_NEOFI/75-287     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
C1GVI6_PARBA/287-474               ............................................................l-VHPPGN.EIY......R.......D.............D............N.......V..SFF...E.VDGR..RQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMT..T...R...D..E...H...G.................................CH..LVGYFS.K..........E....KE....S....A....E.G.........Y.NVAC...ILTLPQ..........Y.....Q.RR..G..........FGRL.LIAF..........S................Y.EL....S...K....R...E.....S..............K..L..........G.SPE...........KPLSDLGLL..G.YRQYWRETLVDI.LM......E..P.G..R.E-.............................SI.S.....E.S....ELANLSAMTEKDVHETLVVLN.LLRYNKGNWVIV-lt.....................................................
#=GR C1GVI6_PARBA/287-474    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G3Y2Q6_ASPNA/275-462               ............................................................l-VHPPGN.EIY......R.......D.............D............Y.......I..SFF...E.VDGR..RQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYCMC..S...R...D..E...T...G.................................CH..LVGYFS.K..........E....KD....S....A....E.G.........Y.NLAC...ILTLPQ..........Y.....Q.RR..G..........YGRL.LISF..........S................Y.EL....G...K....R...E.....G..............K..L..........G.SPE...........KPLSDLGLL..S.YRQYWRETLVEL.LL......E..T.G..R.E-.............................SV.S.....E.H....DLSMLTSMTEKDVHETLVVFN.MLRYHKGNWVIV-lt.....................................................
#=GR G3Y2Q6_ASPNA/275-462    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
F1MFX5_BOVIN/470-657               .............................................................WFHPPAN.EIY......R.......R.............K............D.......L..SVF...E.VDGN..MS.......................K..I..YCQNLCLLAKLFLDHKTLY..YD.......V.EP.....FLFYVLT..K...N...D..E...K...G.................................CH..LVGYFS.K..........E....KL....C....Q....Q.K.........Y.NVSC...IMIMPQ..........H.....Q.RQ..G..........FGRF.LIDF..........S................Y.LL....S...R....R...E.....G..............Q..A..........G.SPE...........KPLSDLGRL..S.YLAYWKSVILEY.LY......H..H.H..E.R-.............................HI.S.....I.K....AISRATGMCPHDIATTLQHLH.MIDKRDGRFVI--irr....................................................
#=GR F1MFX5_BOVIN/470-657    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
E1EX08_GIAIA/148-355               ............................................................m-KRPPGL.KIY......D.......D.............G............L.......L..AVY...E.VDGR..LN.......................K..L..FCQCLCLFTKLFLDSKTLF..YD.......T.DI.....FLFYIMT..V...R...T..D...V...Ldeemnaslqrren......pivepicnfryptgET..IVGYFS.K..........E....KC....E....-....-.N.........N.ILAC...ILTFPC..........F.....H.RM..G..........IGSL.LIDF..........A................Y.LL....G...Q....M...E.....N..............R..Q..........A.GPE...........EPLSKLGLL..G.FTAYWSNKVLEY.LL......Q..Y.T..F.--.............................--.-.....-.-....---------------------.-------------ginleellqtrrsgsmttlssesvpvsldvqsessm...................
#=GR E1EX08_GIAIA/148-355    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A5DJW5_PICGU/240-403               ............................................................m-KHPPGN.EIY......R.......D.............S............K.......V..SFW...E.IDGR..RQ.......................R..T..WCRNLCLLSKLFLDHKTLY..YD.......V.DP.....FLFYVMT..I...K...S..A...Q...G.................................HH..VVGYFS.K..........E....KE....S....A....D.N.........Y.NVAC...ILTLPC..........Y.....Q.KK..G..........YGKL.LIQF..........S................Y.ML....S...R....V...E.....N..............K..I..........G.SPE...........KPLSDLGLL..S.YRAYWTDTLVKL.IV......E..R.N..N.P-.............................--.-.....-.-....---------------------.-------------slykknnpapvadake.......................................
#=GR A5DJW5_PICGU/240-403    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
A8IKT6_DROSI/565-753               ............................................................r-RRPPGR.EIY......R.......K.............G............N.......I..SIY...E.VNGK..EE.......................S..L..YCQLLCLMAKLFLDHKVLY..FD.......M.DP.....FLFYILC..E...T...D..K...E...G.................................SH..IVGYFS.K..........E....KK....S....L....E.N.........Y.NVAC...ILVLPP..........H.....Q.RK..G..........FGKL.LIAF..........S................Y.EL....S...R....K...E.....G..............V..I..........G.SPE...........KPLSDLGRL..S.YRSYWAYTLLEL.MK......T..R.C..A.PE.............................QI.T.....I.K....ELSEMSGITHDDIIYTLQSMK.MIKYWKGQNVICVt......................................................
#=GR A8IKT6_DROSI/565-753    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q2GQX5_CHAGB/360-539               ........................................................qrmiq------E.EVH......D.......E.............G............E.......W..SIR...E.VDGG..DD.......................M..L..FCQNLSLFGKLFLETKSVF..FD.......V.TD.....FKYFLLV..Y...T...S..P...A...Tpptaanatkt.............eappkdensrSQ..IVGFFS.K..........E....KM....S....W....D.N.........N.NLAC...ILVFPP..........W.....Q.RK..G..........LGSL.LMGV..........S................Y.EI....S...R....R...E.....G..............V..I..........G.GPE...........KPISDLGKR..G.YNHFWAGEICRW.LL......S..L.T..P.--.............................--.-.....-.-....---------------------.-------------tatslptstaapan.........................................
#=GR Q2GQX5_CHAGB/360-539    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B1A1R1_DROME/1-83                  .............................................................-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...-...-..-...-...-.................................--..------.-..........-....--....-....-....-.-.........-.----...------..........-.....-.--..-..........----.----..........-................Y.LL....T...R....V...E.....G..............K..I..........G.SPE...........KPLSDLGLI..S.YRSYWKDVLLDY.LC......N..R.S..G.N-.............................TI.A.....I.K....DVSQETAIYSYDIVSTLQALG.MMKYWKGKHIV--lke....................................................
B1A1M5_DROME/1-83                  .............................................................-------.---......-.......-.............-............-.......-..---...-.----..--.......................-..-..-------------------..--.......-.--.....-------..-...-...-..-...-...-.................................--..------.-..........-....--....-....-....-.-.........-.----...------..........-.....-.--..-..........----.----..........-................Y.LL....T...R....V...E.....G..............K..I..........G.SPE...........KPLSDLGLI..S.YRSYWKDVLLDY.LC......N..R.S..G.N-.............................TI.A.....I.K....DVSQETAIYSCDIVSTLQALG.MMKYWKGKHIV--lkk....................................................
A8PXY3_MALGO/10-196                ............................................................l-LHPPGN.EIY......R.......C.............E............D.......I..SFF...E.IDGR..RQ.......................K..T..WCRNLCLLSKCFLDHKTLY..YD.......V.DP.....FLYYVMC..Q...R...D..N...T...G.................................CH..MIGYFS.K..........E....KE....S....A....E.G.........Y.NVAC...ILTLPQ..........H.....Q.RS..G..........FGRL.LIEF..........S................Y.EL....S...K....R...E.....N..............K..L..........G.SPE...........KPLSDLGLL..G.YRAYWSETIVEL.LL......H..T.N..E.--.............................EV.S.....I.D....DIANKTSIVHADVLQTCQALN.MLKQYQGKHYLV-ls.....................................................
#=GR A8PXY3_MALGO/10-196     pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
B4M8C2_DROVI/768-956               ............................................................v-RRPPGK.EIY......R.......K.............S............T.......I..SIF...E.VNGK..DQ.......................P..L..YCQLLCLMAKLFLDHKVLY..FD.......M.DP.....FYFYVLC..E...T...D..K...M...G.................................SH..IVGYFS.K..........E....KR....S....L....E.N.........N.NVAC...ILVLPP..........H.....Q.RK..G..........YGKL.LIAF..........S................Y.EL....S...R....K...E.....G..............V..I..........G.SPE...........KPLSDLGRL..S.YRSYWAYTLLEL.MK......G..R.C..S.AE.............................QT.S.....I.A....ELSEASGITPDDIIYTLQSMK.MIKYWKGQNVICVt......................................................
#=GR B4M8C2_DROVI/768-956    pAS   ........................................................................................................................................................................................*.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
H3JME6_STRPU/244-437               ............................................................l-RHPPGN.EIY......R.......K.............N............P.......I..SFF...E.IDGR..KN.......................K..V..YSQNLCLLAKLFLDHKTLY..YD.......T.DP.....FLFYVMT..E...F...D..S...R...G.................................YH..IVGYFS.K..........E....KE....S....T....E.D.........Y.NVAC...ILTLPP..........F.....Q.RK..G..........FGKL.LIEF..........S................Y.VL....S...Q....F...E.....G..............K..T..........G