GenomeNet

Database: Pfam
Entry: McyA_C
LinkDB: McyA_C
Original site: McyA_C 
#=GF ID   McyA_C
#=GF AC   PF12593.5
#=GF DE   Microcystin synthetase C terminal
#=GF AU   Gavin OL
#=GF SE   Prosite
#=GF GA   25.00 25.00;
#=GF TC   25.30 79.60;
#=GF NC   22.10 22.10;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 11927849 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   18375794
#=GF RT   Natural occurrence of microcystin synthetase deletion mutants
#=GF RT   capable of producing microcystins in strains of the genus
#=GF RT   Anabaena (Cyanobacteria).
#=GF RA   Fewer DP, Tooming-Klunderud A, Jokela J, Wahlsten M, Rouhiainen
#=GF RA   L, Kristensen T, Rohrlack T, Jakobsen KS, Sivonen K;
#=GF RL   Microbiology. 2008;154:1007-1014.
#=GF DR   INTERPRO; IPR022583;
#=GF CC   This domain family is found in bacteria, and is approximately 40
#=GF CC   amino acids in length. The family is found in association with
#=GF CC   Pfam:PF08242, Pfam:PF00501. There is a conserved YAN sequence
#=GF CC   motif. Microcystins form a large family of small cyclic
#=GF CC   heptapeptides harbouring extensive modifications in amino acid
#=GF CC   residue composition and functional group chemistry. These
#=GF CC   peptide hepatotoxins contain a range of non-proteinogenic amino
#=GF CC   acids and unusual peptide bonds, and are typically N-methylated.
#=GF CC   They are synthesized on large enzyme complexes consisting of
#=GF CC   non-ribosomal peptide synthetases and polyketide synthases. This
#=GF CC   family is made up of the C terminal of microcystin synthetase,
#=GF CC   one of the proteins involved in this synthesis pathway.
#=GF SQ   2
#=GS Q7WRX9_9NOST/1078-1120  AC Q7WRX9.1
#=GS B0JPV5_MICAN/1081-1119  AC B0JPV5.1
Q7WRX9_9NOST/1078-1120             DVIFVQHQSQAKVPLRVFTPTNGQAKPLHDWQFYANQPLQPRL
B0JPV5_MICAN/1081-1119             DVIFAPLENSRRNYI-AFTPTH-TAKP--EWQLYANHPLRSKL
#=GC seq_cons                      DVIFs.hpspt+s.l.sFTPTp.pAKP..-WQhYANpPLps+L
//
DBGET integrated database retrieval system