GenomeNet

Database: Pfam
Entry: Med1
LinkDB: Med1
Original site: Med1 
#=GF ID   Med1
#=GF AC   PF10744.7
#=GF DE   Mediator of RNA polymerase II transcription subunit 1
#=GF PI   Med1-Trap220; 
#=GF AU   Wood V, Coggill P
#=GF SE   Pfam-B_51442 (release 22.0)
#=GF GA   21.50 21.50;
#=GF TC   21.70 21.70;
#=GF NC   20.40 21.20;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF WK   MED1
#=GF WK   Mediator_(coactivator)
#=GF RN   [1]
#=GF RM   12150923
#=GF RT   Evidence for a mediator of RNA polymerase II transcriptional
#=GF RT   regulation conserved from yeast to man. 
#=GF RA   Boube M, Joulia L, Cribbs DL, Bourbon HM; 
#=GF RL   Cell. 2002;110:143-151.
#=GF RN   [2]
#=GF RM   15175151
#=GF RT   A unified nomenclature for protein subunits of mediator
#=GF RT   complexes linking transcriptional regulators to RNA polymerase
#=GF RT   II. 
#=GF RA   Bourbon HM, Aguilera A, Ansari AZ, Asturias FJ, Berk AJ,
#=GF RA   Bjorklund S, Blackwell TK, Borggrefe T, Carey M, Carlson M,
#=GF RA   Conaway JW, Conaway RC, Emmons SW, Fondell JD, Freedman LP,
#=GF RA   Fukasawa T, Gustafsson CM, Han M, He X, Herman PK, Hinnebusch
#=GF RA   AG, Holmberg S, 
#=GF RL   Mol Cell. 2004;14:553-557.
#=GF DR   INTERPRO; IPR019680;
#=GF CC   Mediator complexes are basic necessities for linking
#=GF CC   transcriptional regulators to RNA polymerase II.  This domain,
#=GF CC   Med1, is conserved from plants to fungi to humans and forms part
#=GF CC   of the Med9 submodule of the Srb/Med complex. it is one of three
#=GF CC   subunits essential for viability of the whole organism via its
#=GF CC   role in environmentally-directed cell-fate decisions [1]. Med1
#=GF CC   is part of the tail region of the Mediator complex [3].
#=GF SQ   420
#=GS Q7PVB4_ANOGA/123-493      AC Q7PVB4.4
#=GS V5GGF1_BYSSN/134-564      AC V5GGF1.1
#=GS W9X8G4_9EURO/135-553      AC W9X8G4.1
#=GS M7UZ04_BOTF1/111-530      AC M7UZ04.1
#=GS B4LDA3_DROVI/81-456       AC B4LDA3.1
#=GS A0A0B2WZC9_9HYPO/120-550  AC A0A0B2WZC9.1
#=GS I1BGR6_RHIO9/108-451      AC I1BGR6.1
#=GS G7PUL6_MACFA/59-426       AC G7PUL6.1
#=GS H8F4P0_DROME/74-431       AC H8F4P0.1
#=GS K1XWD3_MARBU/107-517      AC K1XWD3.1
#=GS A0A091DUY0_FUKDA/59-426   AC A0A091DUY0.1
#=GS J9JYA5_ACYPI/71-414       AC J9JYA5.2
#=GS W6MH10_9ASCO/13-285       AC W6MH10.1
#=GS MED1_PONAB/59-426         AC Q5RES4.1
#=GS W6QRH7_PENRO/132-554      AC W6QRH7.1
#=GS G1LBE5_AILME/59-426       AC G1LBE5.1
#=GS B4QK78_DROSI/74-427       AC B4QK78.1
#=GS A0A0G2IGT8_9PEZI/268-396  AC A0A0G2IGT8.1
#=GS H0YVF4_TAEGU/51-420       AC H0YVF4.1
#=GS B8M9G3_TALSN/133-547      AC B8M9G3.1
#=GS A0A0G4MJQ8_9PEZI/126-550  AC A0A0G4MJQ8.1
#=GS A0A094FBG9_9PEZI/129-547  AC A0A094FBG9.1
#=GS B4IYT6_DROGR/80-458       AC B4IYT6.1
#=GS H2Y0R6_CIOIN/61-223       AC H2Y0R6.1
#=GS A0A0J7KYK3_LASNI/82-439   AC A0A0J7KYK3.1
#=GS G2QTE5_THITE/118-539      AC G2QTE5.1
#=GS S7ZRP0_PENO1/136-553      AC S7ZRP0.1
#=GS E2A6Z0_CAMFO/862-1219     AC E2A6Z0.1
#=GS G3H5X2_CRIGR/59-426       AC G3H5X2.1
#=GS C4A0W8_BRAFL/52-416       AC C4A0W8.1
#=GS G1P7G3_MYOLU/59-426       AC G1P7G3.1
#=GS C5GGI8_AJEDR/72-499       AC C5GGI8.1
#=GS B6K2C3_SCHJY/38-230       AC B6K2C3.2
#=GS H6C4B3_EXODN/138-548      AC H6C4B3.1
#=GS F9F7M6_FUSOF/118-539      AC F9F7M6.1
#=GS A0A087YNC0_POEFO/82-444   AC A0A087YNC0.2
#=GS A0A0F8X853_9EURO/136-565  AC A0A0F8X853.1
#=GS G1TW10_RABIT/60-427       AC G1TW10.1
#=GS G8Y9P3_PICSO/9-420        AC G8Y9P3.1
#=GS A0A0L7LV46_9NEOP/212-369  AC A0A0L7LV46.1
#=GS F6SJK0_MONDO/59-427       AC F6SJK0.2
#=GS F6YVN1_CALJA/1-259        AC F6YVN1.1
#=GS MED1_DROME/74-431         AC Q9VP05.2
#=GS G0W4C8_NAUDC/11-284       AC G0W4C8.1
#=GS A0A067R849_ZOONE/53-409   AC A0A067R849.1
#=GS C5M6G5_CANTT/10-403       AC C5M6G5.1
#=GS U4KZE1_PYROM/87-477       AC U4KZE1.1
#=GS E7NNY7_YEASO/12-300       AC E7NNY7.1
#=GS W9ZMP3_9EURO/137-546      AC W9ZMP3.1
#=GS H2ZMZ5_CIOSA/58-321       AC H2ZMZ5.1
#=GS A5DBQ9_PICGU/9-401        AC A5DBQ9.2
#=GS B3M6G3_DROAN/72-429       AC B3M6G3.2
#=GS G3ALE6_SPAPN/9-409        AC G3ALE6.1
#=GS G3SN09_LOXAF/59-426       AC G3SN09.1
#=GS L0PE24_PNEJ8/38-373       AC L0PE24.1
#=GS T0JXZ5_COLGC/119-541      AC T0JXZ5.1
#=GS A0A094H2Y2_9PEZI/129-547  AC A0A094H2Y2.1
#=GS A7EYL3_SCLS1/111-530      AC A7EYL3.1
#=GS I3NA69_ICTTR/64-425       AC I3NA69.1
#=GS R4X9B1_TAPDE/40-379       AC R4X9B1.1
#=GS E9E363_METAQ/120-550      AC E9E363.1
#=GS H2LWC7_ORYLA/59-430       AC H2LWC7.1
#=GS C5DUG0_ZYGRC/13-148       AC C5DUG0.1
#=GS E6ZQD4_SPORE/199-409      AC E6ZQD4.1
#=GS E1BUI5_CHICK/60-427       AC E1BUI5.1
#=GS A0A0M0UMK6_9PEZI/115-536  AC A0A0M0UMK6.1
#=GS B2VSA9_PYRTR/88-536       AC B2VSA9.1
#=GS M2TK74_COCH5/92-540       AC M2TK74.1
#=GS W9VWF0_9EURO/135-551      AC W9VWF0.1
#=GS J8Q127_SACAR/12-300       AC J8Q127.1
#=GS MED1_HUMAN/59-426         AC Q15648.4
#=GS C4R1P3_PICPG/171-433      AC C4R1P3.1
#=GS I3KH72_ORENI/57-427       AC I3KH72.1
#=GS A0A094ANP6_9PEZI/125-543  AC A0A094ANP6.1
#=GS B7PD89_IXOSC/76-180       AC B7PD89.1
#=GS A0A074YXT7_9PEZI/145-600  AC A0A074YXT7.1
#=GS A0A074XQG0_9PEZI/152-596  AC A0A074XQG0.1
#=GS H2AYU2_KAZAF/11-289       AC H2AYU2.1
#=GS H2U0Q5_TAKRU/59-429       AC H2U0Q5.1
#=GS A0A084FU74_9PEZI/120-538  AC A0A084FU74.1
#=GS R0KRI9_SETT2/92-540       AC R0KRI9.1
#=GS A0A0D2WX50_CAPO3/213-556  AC A0A0D2WX50.1
#=GS MED1_MOUSE/59-426         AC Q925J9.2
#=GS A0A096LU77_POEFO/59-429   AC A0A096LU77.1
#=GS W5N508_LEPOC/91-460       AC W5N508.1
#=GS T1KY15_TETUR/35-398       AC T1KY15.1
#=GS A7TRW6_VANPO/11-428       AC A7TRW6.1
#=GS I3MZX3_ICTTR/63-424       AC I3MZX3.1
#=GS E9J4L2_SOLIN/1-209        AC E9J4L2.1
#=GS L8GFY0_ACACA/139-458      AC L8GFY0.1
#=GS N4V1B0_COLOR/121-545      AC N4V1B0.1
#=GS Q2UUL5_ASPOR/134-549      AC Q2UUL5.1
#=GS W5L7S1_ASTMX/16-385       AC W5L7S1.1
#=GS F0U606_AJEC8/132-559      AC F0U606.1
#=GS H0YUE5_TAEGU/47-400       AC H0YUE5.1
#=GS G8ZSA3_TORDC/11-270       AC G8ZSA3.1
#=GS X0JKF1_FUSOX/118-539      AC X0JKF1.1
#=GS A0A084WB85_ANOSI/138-509  AC A0A084WB85.1
#=GS G3JR60_CORMM/127-547      AC G3JR60.1
#=GS A0A0A1P8J8_9FUNG/106-250  AC A0A0A1P8J8.1
#=GS H0V005_CAVPO/59-426       AC H0V005.1
#=GS G1XNU3_ARTOA/98-503       AC G1XNU3.1
#=GS A0A063C156_9HYPO/127-570  AC A0A063C156.1
#=GS K0KZ05_WICCF/10-201       AC K0KZ05.1
#=GS M2N0G7_BAUCO/149-532      AC M2N0G7.1
#=GS E3QE57_COLGM/121-547      AC E3QE57.1
#=GS A0A093ZJ14_9PEZI/128-547  AC A0A093ZJ14.1
#=GS A0A0A1N7A4_9FUNG/124-268  AC A0A0A1N7A4.1
#=GS D4ATV5_ARTBC/171-651      AC D4ATV5.1
#=GS S6E396_ZYGB2/11-267       AC S6E396.1
#=GS F2PJJ9_TRIEC/179-465      AC F2PJJ9.1
#=GS A0A086T5X4_ACRCH/130-546  AC A0A086T5X4.1
#=GS A0A0A1MVU8_9FUNG/3-264    AC A0A0A1MVU8.1
#=GS A0A094GKH6_9PEZI/1-419    AC A0A094GKH6.1
#=GS MED1_XENTR/44-412         AC A1L0Z0.1
#=GS F1RWL2_PIG/59-426         AC F1RWL2.1
#=GS M3B1G6_PSEFD/79-497       AC M3B1G6.1
#=GS C5DL71_LACTC/27-152       AC C5DL71.1
#=GS U9U283_RHIID/7-82         AC U9U283.1
#=GS A7S6R2_NEMVE/463-532      AC A7S6R2.1
#=GS B4KV47_DROMO/79-454       AC B4KV47.2
#=GS A0A016PIN7_GIBZA/118-538  AC A0A016PIN7.1
#=GS Q1K715_NEUCR/122-537      AC Q1K715.1
#=GS A0A0G2IGT8_9PEZI/115-281  AC A0A0G2IGT8.1
#=GS F2PJJ9_TRIEC/459-583      AC F2PJJ9.1
#=GS K1W989_TRIAC/149-215      AC K1W989.1
#=GS A0A0H5C146_CYBJA/9-160    AC A0A0H5C146.1
#=GS G4MW62_MAGO7/129-559      AC G4MW62.1
#=GS A0A074VXZ9_9PEZI/153-603  AC A0A074VXZ9.1
#=GS F6TRR2_ORNAN/53-414       AC F6TRR2.1
#=GS E7KV13_YEASL/12-300       AC E7KV13.1
#=GS A0A0A2KIN0_PENIT/133-555  AC A0A0A2KIN0.1
#=GS S0E4B0_GIBF5/118-539      AC S0E4B0.1
#=GS I4YB95_WALMC/90-466       AC I4YB95.1
#=GS G6CLW2_DANPL/60-438       AC G6CLW2.1
#=GS U3IBF2_ANAPL/49-400       AC U3IBF2.1
#=GS A0A0D9S3C2_CHLSB/59-426   AC A0A0D9S3C2.1
#=GS A0A017S9D9_9EURO/137-567  AC A0A017S9D9.1
#=GS F1QR19_DANRE/54-412       AC F1QR19.1
#=GS F4QEV8_DICFS/160-549      AC F4QEV8.1
#=GS R9NWA4_PSEHS/188-404      AC R9NWA4.1
#=GS A0A094G7S1_9PEZI/128-547  AC A0A094G7S1.1
#=GS Q6BS77_DEBHA/9-436        AC Q6BS77.2
#=GS A0A0R4IIM4_DANRE/54-227   AC A0A0R4IIM4.1
#=GS H2KVL0_CLOSI/104-459      AC H2KVL0.1
#=GS A0A0F4XBH0_HANUV/38-237   AC A0A0F4XBH0.1
#=GS G1QJ97_NOMLE/24-391       AC G1QJ97.1
#=GS W5N203_LEPOC/57-414       AC W5N203.1
#=GS I2FTE2_USTH4/203-416      AC I2FTE2.1
#=GS W5N208_LEPOC/57-414       AC W5N208.1
#=GS F6XL29_HORSE/59-426       AC F6XL29.1
#=GS A0A015N9U4_9GLOM/130-539  AC A0A015N9U4.1
#=GS MED1_ASHGO/10-150         AC Q75BA8.1
#=GS A1CW33_NEOFI/136-568      AC A1CW33.1
#=GS L8G3U6_PSED2/125-543      AC L8G3U6.1
#=GS A0A068RT73_9FUNG/117-520  AC A0A068RT73.1
#=GS K1PRJ6_CRAGI/75-412       AC K1PRJ6.1
#=GS W1Q964_OGAPD/13-242       AC W1Q964.1
#=GS A6RBM1_AJECN/1-232        AC A6RBM1.1
#=GS M3CJL5_SPHMS/1-303        AC M3CJL5.1
#=GS B4LDA1_DROVI/78-453       AC B4LDA1.2
#=GS A0A0E9NK52_9ASCO/106-266  AC A0A0E9NK52.1
#=GS G2Q8D8_MYCTT/1-388        AC G2Q8D8.1
#=GS G0SEC7_CHATD/118-567      AC G0SEC7.1
#=GS B4GRY3_DROPE/48-406       AC B4GRY3.1
#=GS A0A094DZY9_9PEZI/128-547  AC A0A094DZY9.1
#=GS E3JQ96_PUCGT/357-642      AC E3JQ96.1
#=GS K3VPF3_FUSPC/118-538      AC K3VPF3.1
#=GS W9YJN5_9EURO/142-550      AC W9YJN5.1
#=GS MED1_KLULA/10-184         AC Q6CVU5.1
#=GS J3NG50_GAGT3/125-561      AC J3NG50.1
#=GS A0A0A1NPB3_9FUNG/8-264    AC A0A0A1NPB3.1
#=GS A0A0A2JIU8_PENEN/133-555  AC A0A0A2JIU8.1
#=GS W7IA65_9PEZI/102-511      AC W7IA65.1
#=GS A0A0N0DF56_9HYPO/118-538  AC A0A0N0DF56.1
#=GS K9FWL6_PEND2/133-555      AC K9FWL6.1
#=GS A0A088AEF8_APIME/74-431   AC A0A088AEF8.1
#=GS A0A093YIM8_9PEZI/127-547  AC A0A093YIM8.1
#=GS F2UHE5_SALR5/300-445      AC F2UHE5.1
#=GS G3NMI4_GASAC/44-403       AC G3NMI4.1
#=GS M3WCB5_FELCA/59-426       AC M3WCB5.1
#=GS J7RP93_KAZNA/11-321       AC J7RP93.1
#=GS H9J7D1_BOMMO/66-140       AC H9J7D1.1
#=GS A0A0L9SRG0_9HYPO/117-537  AC A0A0L9SRG0.1
#=GS L9JWL8_TUPCH/1-218        AC L9JWL8.1
#=GS H9J7D1_BOMMO/135-405      AC H9J7D1.1
#=GS A0A0P7V018_9TELE/53-411   AC A0A0P7V018.1
#=GS D5GDH3_TUBMM/2-94         AC D5GDH3.1
#=GS E5R2V9_ARTGP/171-437      AC E5R2V9.1
#=GS A0A0G2HYM7_9EURO/72-499   AC A0A0G2HYM7.1
#=GS F4NW87_BATDJ/149-503      AC F4NW87.1
#=GS S3CL37_GLAL2/117-528      AC S3CL37.1
#=GS A0A0D9N3H4_ASPFL/134-565  AC A0A0D9N3H4.1
#=GS G3XTB0_ASPNA/135-570      AC G3XTB0.1
#=GS A0A096P5A9_PAPAN/1-207    AC A0A096P5A9.1
#=GS D6RLP0_COPC7/115-264      AC D6RLP0.1
#=GS F7G498_CALJA/1-284        AC F7G498.1
#=GS A0A072PQJ3_9EURO/138-551  AC A0A072PQJ3.1
#=GS A0A094BT81_9PEZI/13-433   AC A0A094BT81.1
#=GS A0A010R431_9PEZI/121-547  AC A0A010R431.1
#=GS E5A9R6_LEPMJ/88-534       AC E5A9R6.1
#=GS D6WVF3_TRICA/68-424       AC D6WVF3.1
#=GS V8P8M2_OPHHA/15-383       AC V8P8M2.1
#=GS J3K1M4_COCIM/136-554      AC J3K1M4.2
#=GS K2SC68_MACPH/159-596      AC K2SC68.1
#=GS H2NUA6_PONAB/59-426       AC H2NUA6.1
#=GS A0A0F8BTG9_CERFI/1-375    AC A0A0F8BTG9.1
#=GS A3LUJ1_PICST/9-423        AC A3LUJ1.2
#=GS B0WMI0_CULQU/153-215      AC B0WMI0.1
#=GS MED1_YEAST/12-300         AC Q12321.1
#=GS H3AUB1_LATCH/1-254        AC H3AUB1.1
#=GS G9NVY3_HYPAI/132-571      AC G9NVY3.1
#=GS W4W4N7_ATTCE/74-432       AC W4W4N7.1
#=GS A0A087X782_POEFO/91-461   AC A0A087X782.2
#=GS E9G2Z9_DAPPU/46-408       AC E9G2Z9.1
#=GS A0A0N0NIG8_9EURO/2-104    AC A0A0N0NIG8.1
#=GS G3R077_GORGO/194-400      AC G3R077.1
#=GS Q4WQK4_ASPFU/136-568      AC Q4WQK4.1
#=GS Q0CSY8_ASPTN/134-565      AC Q0CSY8.1
#=GS M7P725_PNEMU/33-386       AC M7P725.1
#=GS J5JGW1_BEAB2/127-551      AC J5JGW1.1
#=GS E2R4P0_CANLF/59-426       AC E2R4P0.1
#=GS N1JH11_BLUG1/116-521      AC N1JH11.1
#=GS S9W278_SCHCR/301-360      AC S9W278.1
#=GS A7S6R2_NEMVE/284-473      AC A7S6R2.1
#=GS S2JQM3_MUCC1/122-515      AC S2JQM3.1
#=GS C7YRS3_NECH7/118-538      AC C7YRS3.1
#=GS M4A1U0_XIPMA/15-377       AC M4A1U0.1
#=GS W4XA58_STRPU/74-449       AC W4XA58.1
#=GS A1CIN4_ASPCL/136-568      AC A1CIN4.1
#=GS A0A0M8PBE5_9EURO/98-520   AC A0A0M8PBE5.1
#=GS M3YU90_MUSPF/59-426       AC M3YU90.1
#=GS U3JCS2_FICAL/53-420       AC U3JCS2.1
#=GS F7EAR7_XENTR/44-412       AC F7EAR7.1
#=GS MED1_SCHPO/233-359        AC Q09696.1
#=GS M3JEJ4_CANMX/9-414        AC M3JEJ4.1
#=GS G7X5V6_ASPKW/135-570      AC G7X5V6.1
#=GS B7PD89_IXOSC/169-299      AC B7PD89.1
#=GS G3WTX2_SARHA/51-419       AC G3WTX2.1
#=GS Q5AHH0_CANAL/9-429        AC Q5AHH0.1
#=GS E7M1Q8_YEASV/12-300       AC E7M1Q8.1
#=GS A0A0Q9WWK4_DROVI/78-453   AC A0A0Q9WWK4.1
#=GS Q6C9S6_YARLI/14-353       AC Q6C9S6.1
#=GS H2U0Q6_TAKRU/53-423       AC H2U0Q6.1
#=GS A0A0C4EE89_MAGP6/125-568  AC A0A0C4EE89.1
#=GS C6H2U6_AJECH/132-559      AC C6H2U6.1
#=GS A0A068Y4B8_ECHMU/114-422  AC A0A068Y4B8.1
#=GS C1H823_PARBA/132-559      AC C1H823.2
#=GS A0A0L0C5M4_LUCCU/81-448   AC A0A0L0C5M4.1
#=GS C1G3L8_PARBD/132-560      AC C1G3L8.2
#=GS B6QF18_TALMQ/132-549      AC B6QF18.1
#=GS A0A0G2DUR1_9PEZI/139-295  AC A0A0G2DUR1.1
#=GS A0A094E560_9PEZI/121-539  AC A0A094E560.1
#=GS H0X2X5_OTOGA/59-426       AC H0X2X5.1
#=GS H1UXL2_COLHI/121-549      AC H1UXL2.1
#=GS F4WYN8_ACREC/1-341        AC F4WYN8.1
#=GS W5PN52_SHEEP/59-426       AC W5PN52.1
#=GS A0A096M5J1_POEFO/59-429   AC A0A096M5J1.1
#=GS H0EMB1_GLAL7/35-446       AC H0EMB1.1
#=GS S9YIH0_9CETA/4-188        AC S9YIH0.1
#=GS G1KU28_ANOCA/60-427       AC G1KU28.1
#=GS C5FEF1_ARTOC/164-578      AC C5FEF1.1
#=GS F7G3X2_CALJA/1-259        AC F7G3X2.1
#=GS V3ZAN0_LOTGI/67-425       AC V3ZAN0.1
#=GS F1NBE5_CHICK/54-407       AC F1NBE5.1
#=GS A0A0G2DUR1_9PEZI/289-430  AC A0A0G2DUR1.1
#=GS R7Z0D1_CONA1/165-604      AC R7Z0D1.1
#=GS U9UQY8_RHIID/1-288        AC U9UQY8.1
#=GS C0NN58_AJECG/132-559      AC C0NN58.1
#=GS M7BXJ8_CHEMY/71-159       AC M7BXJ8.1
#=GS A0A0D1BZM4_USTMA/195-405  AC A0A0D1BZM4.1
#=GS G4V7K4_SCHMA/112-452      AC G4V7K4.1
#=GS A0A094D5I9_9PEZI/128-547  AC A0A094D5I9.1
#=GS I3JGN0_ORENI/44-400       AC I3JGN0.1
#=GS G3AXY3_CANTC/1-408        AC G3AXY3.1
#=GS R8BHV8_TOGMI/58-485       AC R8BHV8.1
#=GS A0A080WGQ9_TRIRC/171-649  AC A0A080WGQ9.1
#=GS C4XW31_CLAL4/19-336       AC C4XW31.1
#=GS F0XGS2_GROCL/141-570      AC F0XGS2.1
#=GS L1JL53_GUITH/206-512      AC L1JL53.1
#=GS N4TGE5_FUSC1/118-532      AC N4TGE5.1
#=GS E9D245_COCPS/136-554      AC E9D245.1
#=GS A0A0P7UC85_9TELE/109-487  AC A0A0P7UC85.1
#=GS U3JRL1_FICAL/48-400       AC U3JRL1.1
#=GS H2NUA7_PONAB/59-428       AC H2NUA7.2
#=GS H3CFE0_TETNG/59-434       AC H3CFE0.1
#=GS F7CMI2_XENTR/68-421       AC F7CMI2.1
#=GS A0A094E6B0_9PEZI/28-446   AC A0A094E6B0.1
#=GS A0A0G4LXL5_9PEZI/126-550  AC A0A0G4LXL5.1
#=GS A0A099NXK8_PICKU/13-168   AC A0A099NXK8.1
#=GS Q2M094_DROPS/77-435       AC Q2M094.3
#=GS A0A0D9M943_9EURO/133-555  AC A0A0D9M943.1
#=GS R1EP95_BOTPV/155-591      AC R1EP95.1
#=GS A0A084QPS7_9HYPO/118-541  AC A0A084QPS7.1
#=GS A0A0F4Z8C9_9PEZI/116-530  AC A0A0F4Z8C9.1
#=GS S3CAT7_OPHP1/128-566      AC S3CAT7.1
#=GS U3J0Z2_ANAPL/58-425       AC U3J0Z2.1
#=GS A0A0L0NWA6_9ASCO/6-410    AC A0A0L0NWA6.1
#=GS E1B7Q6_BOVIN/59-426       AC E1B7Q6.1
#=GS G8C0M0_TETPH/12-442       AC G8C0M0.1
#=GS A0A0N1NWC9_9EURO/133-369  AC A0A0N1NWC9.1
#=GS F7W429_SORMK/122-537      AC F7W429.1
#=GS G1N176_MELGA/53-420       AC G1N176.2
#=GS G3R077_GORGO/59-193       AC G3R077.1
#=GS T1HHG1_RHOPR/52-405       AC T1HHG1.1
#=GS A0A066WW31_COLSU/121-547  AC A0A066WW31.1
#=GS A6RBM2_AJECN/72-484       AC A6RBM2.1
#=GS A0A0R4IIM4_DANRE/243-412  AC A0A0R4IIM4.1
#=GS H2RD94_PANTR/59-426       AC H2RD94.1
#=GS E7QLV7_YEASZ/12-300       AC E7QLV7.1
#=GS M3ZL94_XIPMA/59-429       AC M3ZL94.1
#=GS W3X4Q4_9PEZI/116-533      AC W3X4Q4.1
#=GS U7PJY3_SPOS1/132-585      AC U7PJY3.1
#=GS Q2GYD1_CHAGB/109-532      AC Q2GYD1.1
#=GS B4IYT4_DROGR/80-458       AC B4IYT4.1
#=GS A0A0B4H5J3_9HYPO/120-550  AC A0A0B4H5J3.1
#=GS M3WTC4_FELCA/59-426       AC M3WTC4.1
#=GS W5LIK0_ASTMX/43-402       AC W5LIK0.1
#=GS A0A0N0RS68_9BASI/395-532  AC A0A0N0RS68.1
#=GS A0A0D2XMT2_FUSO4/2-395    AC A0A0D2XMT2.1
#=GS B4KV49_DROMO/81-456       AC B4KV49.2
#=GS B3RQG3_TRIAD/121-480      AC B3RQG3.1
#=GS W7LM77_GIBM7/118-539      AC W7LM77.1
#=GS D3ZRN2_RAT/44-411         AC D3ZRN2.1
#=GS B6K2C3_SCHJY/313-369      AC B6K2C3.2
#=GS Q5B5M0_EMENI/134-555      AC Q5B5M0.1
#=GS E3RJC8_PYRTT/88-537       AC E3RJC8.1
#=GS W5N216_LEPOC/57-411       AC W5N216.1
#=GS MED1_AEDAE/118-471        AC Q172G3.1
#=GS M2RYT8_COCSN/92-540       AC M2RYT8.1
#=GS G0RLU4_HYPJQ/124-558      AC G0RLU4.1
#=GS A0A0A8L2W1_9SACH/10-190   AC A0A0A8L2W1.1
#=GS B0WMI0_CULQU/53-151       AC B0WMI0.1
#=GS I1GJ15_AMPQE/49-385       AC I1GJ15.1
#=GS S8A0C2_DACHA/101-487      AC S8A0C2.1
#=GS B8JM88_DANRE/4-235        AC B8JM88.2
#=GS N1RGD1_FUSC4/118-532      AC N1RGD1.1
#=GS W9CM24_9HELO/111-530      AC W9CM24.1
#=GS U3JRL3_FICAL/47-400       AC U3JRL3.1
#=GS G9MHW6_HYPVG/121-555      AC G9MHW6.1
#=GS M9PII7_DROME/74-431       AC M9PII7.1
#=GS A0A0F9ZH58_TRIHA/127-560  AC A0A0F9ZH58.1
#=GS MED1_DICDI/190-624        AC Q54SI1.1
#=GS A0A0J9UV63_FUSO4/112-511  AC A0A0J9UV63.1
#=GS M7SR78_EUTLA/120-550      AC M7SR78.1
#=GS C4JRT0_UNCRE/136-554      AC C4JRT0.1
#=GS W2RQQ0_9EURO/138-552      AC W2RQQ0.1
#=GS H2UB71_TAKRU/42-397       AC H2UB71.1
#=GS MED1_CANGA/11-141         AC Q6FWB9.1
#=GS H3AM65_LATCH/4-367        AC H3AM65.1
#=GS A0A0L0N6W3_9HYPO/120-547  AC A0A0L0N6W3.1
#=GS E3JQ96_PUCGT/215-387      AC E3JQ96.1
#=GS Q0U1J3_PHANO/486-928      AC Q0U1J3.2
#=GS T1J8I3_STRMM/62-424       AC T1J8I3.1
#=GS A2Q9R5_ASPNC/135-570      AC A2Q9R5.1
#=GS A0A0F0I5N1_ASPPA/134-565  AC A0A0F0I5N1.1
#=GS G2XES2_VERDV/126-550      AC G2XES2.1
#=GS N1PW81_DOTSN/150-572      AC N1PW81.1
#=GS A0A0A2VX31_BEABA/127-551  AC A0A0A2VX31.1
#=GS G4UE51_NEUT9/122-537      AC G4UE51.1
#=GS A0A0L1JFA6_ASPNO/130-562  AC A0A0L1JFA6.1
#=GS A0A0A1TB50_9HYPO/126-550  AC A0A0A1TB50.1
#=GS T5AMU8_OPHSC/120-545      AC T5AMU8.1
#=GS U4U837_DENPD/58-412       AC U4U837.1
#=GS A0A066VWL0_9BASI/225-421  AC A0A066VWL0.1
#=GS A0A074XKZ9_AURPU/154-603  AC A0A074XKZ9.1
#=GS G3NRM9_GASAC/59-429       AC G3NRM9.1
#=GS G2Y8B3_BOTF4/111-530      AC G2Y8B3.1
#=GS M7BXJ8_CHEMY/176-276      AC M7BXJ8.1
#=GS A0A0F2LZ96_SPOSC/132-585  AC A0A0F2LZ96.1
#=GS L2FW69_COLGN/119-518      AC L2FW69.1
#=GS D3BU93_POLPA/167-536      AC D3BU93.1
#=GS L7N327_XENTR/44-412       AC L7N327.1
#=GS B4MKH6_DROWI/80-463       AC B4MKH6.2
#=GS G5BRW6_HETGA/44-411       AC G5BRW6.1
#=GS G0V879_NAUCC/11-296       AC G0V879.1
#=GS F7E5Q9_MACMU/1-356        AC F7E5Q9.1
#=GS B4IAT3_DROSE/74-431       AC B4IAT3.1
#=GS A0A0F7VDB9_9EURO/133-548  AC A0A0F7VDB9.1
#=GS F6XFN5_HORSE/59-426       AC F6XFN5.1
#=GS A0A093BDD4_CHAPE/51-418   AC A0A093BDD4.1
#=GS H2QCU3_PANTR/59-426       AC H2QCU3.1
#=GS M1W731_CLAP2/124-554      AC M1W731.1
#=GS K7J0T4_NASVI/19-378       AC K7J0T4.1
#=GS E9ES81_METRA/120-550      AC E9ES81.1
#=GS E0W419_PEDHC/45-396       AC E0W419.1
#=GS H2MBH8_ORYLA/1-35         AC H2MBH8.1
#=GS A0A0F4GFL4_9PEZI/165-600  AC A0A0F4GFL4.1
#=GS G3NMI9_GASAC/38-402       AC G3NMI9.1
#=GS MED1_SCHPO/29-217         AC Q09696.1
#=GS E5R2V9_ARTGP/433-539      AC E5R2V9.1
#=GS C4R1P3_PICPG/13-166       AC C4R1P3.1
#=GS C3YW57_BRAFL/52-416       AC C3YW57.1
#=GS G3S6F8_GORGO/59-426       AC G3S6F8.1
#=GS A0A068XRR4_HYMMI/114-440  AC A0A068XRR4.1
#=GS M3Z9F8_NOMLE/16-383       AC M3Z9F8.1
#=GS B2B7Y2_PODAN/107-526      AC B2B7Y2.1
#=GS A0A0K8L5F2_9EURO/136-567  AC A0A0K8L5F2.1
#=GS B6HPQ5_PENRW/133-555      AC B6HPQ5.1
#=GS M7BPB7_CHEMY/132-361      AC M7BPB7.1
#=GS A0A0C4ETX8_PUCT1/180-333  AC A0A0C4ETX8.1
#=GS G7DWX3_MIXOS/166-310      AC G7DWX3.1
#=GS M9LJL3_PSEA3/206-413      AC M9LJL3.1
#=GS M7BPB7_CHEMY/10-134       AC M7BPB7.1
#=GS X0C9I0_FUSOX/118-539      AC X0C9I0.1
#=GS I2H7T8_TETBL/11-521       AC I2H7T8.1
#=GS A0A015K2E6_9GLOM/130-539  AC A0A015K2E6.1
#=GS W5JUJ1_ANODA/116-486      AC W5JUJ1.1
#=GS H2Y2G5_CIOIN/5-153        AC H2Y2G5.1
#=GS F2T2C4_AJEDA/132-559      AC F2T2C4.2
#=GS B1AQH6_MOUSE/59-426       AC B1AQH6.1
#=GS B8NT01_ASPFN/108-539      AC B8NT01.1
#=GS C9S5N0_VERA1/126-525      AC C9S5N0.1
#=GS G8JS27_ERECY/10-185       AC G8JS27.1
#=GS A0A093ZSP2_9PEZI/125-543  AC A0A093ZSP2.1
#=GS S9W278_SCHCR/38-231       AC S9W278.1
#=GS A0A0L7LV46_9NEOP/69-219   AC A0A0L7LV46.1
#=GS L5JRK8_PTEAL/59-426       AC L5JRK8.1
#=GS F0ZLF9_DICPU/172-555      AC F0ZLF9.1
#=GS R9AIN4_WALI9/90-251       AC R9AIN4.1
Q7PVB4_ANOGA/123-493                 ..........................................................................................................QKTLDSMQYc.iKVTTR....QGLVERLDCLTRQLGL..KLS--......................---....---EDTSGLFISS.DM.FYLEIIL.........DPA.gG..TV.....Q......DVKVHHECK......M......KQ.....QS..CSE..................................................-------LVACLQ.......................-RGDFA.DFTTQLEGLASIYQLNAEk.......kIKVNA.FVALQALETDLHTLYTLSLQH...Y.AD----...........................----------------VHAQ..lHKAPLGvvqkr..............rgghpMRLTYFVAPYE..LLDLTTR..----.....---TMNVLSA.....................ELI-A.QERi...gCSVAVVLEASSAN.K...........LQ......IQPLLVVna.................gsgSAASVLQ-----......................................-------------PVYT.......................................PIEK.....HNSTSL...PATFVLRLSKPMPLNSAMMRAIR.AIVG.GSGAGEQQQagegs........sggggL.PGSLLGLIAH.H------...........................................---ASAGSVTD--..........--LAKGL..LVSLPDQYHC.Y.FL...TD.NPS.......................................L.rGMMVSSIPFTEPQHVPKILTYLRQQAVFNQLLSSCIR........................................................................................................................................................................
V5GGF1_BYSSN/134-564                 ..........................................................................................................EEVVQLLRT...RVAGR....GVCREGIERIGQLEGF..ESIWQ......................DNN....--------LSIAG.NS.VDLEIEF.........YPG.qD..SV.....K......DVSLSYATP......-......EA.....QE..GVR..................................................RDEATAVLKRDLMqlee..............erqrgIWKRLD.GFYGNLERLARLDRLS--.........QEVNC.FEATEGLYESLRKI-------...-.WEEEKKh........................prWAPTYEHLCK-GWIGRPSLH...KGRRFG........................LGLEFWVNQHR..ALDAKEK..KRSPd...sMVVDQVGGQE.....................TSEEL.VAE.....DAVWSVTIECEE-.-...........--......GYPSLRV......................SKEWVGSDVLTSmdtgga..........................esmetpDETSIRLVNWTEPAPTLsssaa............................anadsmAMDSg...mLGSQTP...NRRFVAKLEPPVDVPILAASDIY.RHLG.LQLPQEFK-..................-.MVTYDALLLP.SWTAPPEagasd.................................dvhrpGGKRLRKSVVAF-..........--DPEGK..RLNSQHSYAF.Q.AF...ET.VAG.......................................R..--TLRDLPFSHPRQLADIFPILRQYALLATLLRNVF-s.......................................................................................................................................................................
W9X8G4_9EURO/135-553                 ........................................................................................................el--VVDMLKS...RIAGH....GITRGGVERIAQLQGF..TTLWD......................DDN....--------LTIAG.NC.VDLEINF.........EAGgrD..EV.....R......DVSLKLNIS......D......TA.....SE..NEEp...............................................qfQEQGTQVIKDNLRnldv..............vdgvaRWKSLD.SFAANLQYLSQLDRIE--.........SGTPC.FTAVGDLYNAFQKI-------...-.WNAEKEk.........................fRGRTLRQHLRQGAVGRPVMD...RKPRLG........................LALDFWGPKEE..LGQTPEA..----.....IAN-------.....................--DMV.DDA.....TCLYTAQISCEP-.-...........--......GLPSTAT......................TKQWVSDRVLIEdqh...............................emldVGNEKLKPDWRDPAQDSsssdplvk......................aesdeasteKPTD.....MASGVL...DMHFLCTLQPEVYLPLNIAAGLN.V--E.IAMVDINQE..................Q.TSTYQVALHK.HFNIAAVngi.....................................rsaPQERWLRVLPIA-..........--DDKDP..TRLRRHSYAL.Q.SS...RH.APP.......................................L.wCYPVKHLKFNHPKQLAAVLPVIRQYAVVWGILRNL--ae......................................................................................................................................................................
M7UZ04_BOTF1/111-530                 ........................................................................................................mg--CVEILKP...N-KGR....-LSEAGLERLARRVGL..ECLWE......................DMM....GSASNGRTLIIAG.NA.LALDIDF.........-AN..N..IV.....Q......KVSLSFPDA......-......PE.....SV..TKH..................................................EKTASDILLRDLQfea................gespLTKMLD.RFAANLERLTMLDKLSVI.........PGLNC.HEAVAGIFCSLHKL-------...HsWEVGRLkene...................mlgmGDEDVVRAAMCTRSGIPIMH...SRERLG........................LSIDYWQEKRR..ISTKGKK..----.....----------.....................-----.-QN.....RKTWSLLVEVAPL.P...........SMg...vgVYTPLRV......................SDKWISDDVQQAnpavd...........................dlfraaQLQEGPILNWLEPDNTLlpt................................spdiKSNDl..nvGTQKFP...EAMFVAKFDPPVVVPYAIAMQIY.QST-.-QTPFDFS-..................E.ITTFDGLMFP.LSAEEALktn....................................etqaRTINVEKNVSVW-..........--DREGK..KEAKQHFNTL.Y.IE...KI.DYG.......................................R..--KVEEVSFSHPRQLVEMLPCLRQFALLSTVLRKSF-e.......................................................................................................................................................................
B4LDA3_DROVI/81-456                  .........................................................................................................q-SALDKLQHy.iKVTSR....HGLVERLESLSRQLGL..KFMED......................---....-----QQMLFIST.DM.FYVEILL.........DAS..G..KL.....S......DVKVHHECK......I......EQ.....QS..NSS..................................................--ASSRELLNCLK.......................-AGDFA.DFTVQLEGLSSIYQLNAEp.......kVKKKA.YVALQAMETDIFNLYQHQLQQ...Q.------...........................---------ISGSSDSYYIM...NKSSVGlvqqr..............rgghpMKLTYFCPPLH..LIETKTK.gEKVG....aATGSGTASRDf..................siEQVMK.SPN....gLSATLNLEASSAN.K...........LQ......ILPILSF......................TSESGLP-----......................................----------LEQPGYA.......................................PLTQ.....NNSMLM...PATYVLRLSKPMPVCIDSLRALS.-LPG.LSGLSSEG-..................-.TTTVMNLIVQ.-------...........................................---TASRQVIKG-..........--TQKGL..YVNLPRETHC.Y.FF...TD.NRR.......................................L.kGTLISSLPFTEPAQVPKIIAFLKKQALFYTLLSSCVR........................................................................................................................................................................
A0A0B2WZC9_9HYPO/120-550             .........................................................................................................d-TILNLLST...K-KGL....-VSEASLERLAQRIGL..ELLSE......................EQR...tPGGRKTRTLAIAG.SA.IALDIVL.........-DN..N..IV.....Q......TVSLTYHGS......-......AP.....SV..SRH..................................................MDAAGRILLKDLKllp................aqspLTKTLE.NFASNFERLAGLDKLSIV.........PGLDC.HEALAGIYDSLDRL-------...HqWDLSNLreeq..................dmkgkPDQYLLNMVMCSRHGRPVMH...DRDTVG........................LALQYWRELRF..MPPSAKD..G---.....----------.....................MDKYV.YEK.....EKVWSLLLGCAPL.D...........GM......EVPPVRV......................SDSWISKEITKQd....................................vMDPTKTVLDWQEPDNMSlpqsedn........................kdagmdllQADL.....STTRVP...RVMFTVTFDPPVVLPQNDWARLY.MYAN.VSPPNIVNEvgqr..........ghplL.PPTFDSLLFP.FPSGVKVdp......................................sesRAIVRQRPVRVF-..........--KTDGA..KTVKHHHTTL.Y.IY...KP.IYS.......................................Q..--TVSEMPFSHPRQLLDMLPLLRQYAFVSTLLENSF-g.......................................................................................................................................................................
I1BGR6_RHIO9/108-451                 ..................................................................................................lkekeesk---------...---SK....-IEIQKLEKLAQSMGL..ITFVD......................SSKm..fESDSPTSTITLGG.TL.IVIDIDI.........DDK..G..KV.....Q......KTKVTYVSE......S......M-.....-Q..SDQ..................................................DDRVDKILTENLQ.......................-LRKFD.LFKRNLWSLALLDQLNIK........yKPLDF.FSITKNLLQDLKAVCLIESEI...E.FD----...........................-----FSSILTEGHGIPCLH...LSYP-G........................ISIAYWLDKPT..IASTDWN..----.....----QVKQLL....................qQNENH.DVL.....LRASKILISFEDS.T...........QL.....mHYLPLSRpnyl.............lafdeTEDSIKEGVDGEh...................................fkVVYENSYPKFMSPMRYV......................................kPLPT....iPDSVPV...PVRFVATVEPPIAMADELCQTLM.NVIG.LLNTEAMEQyai...........kntsQ.CPSLEEILVP.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------nimltkqyvkkllya.........................................................................................................................................................
G7PUL6_MACFA/59-426                  .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAIMYWKA...-.TN----...........................--AGPLDKILHGSVGYLTPR...SGGHL-........................MNLKYYVSPSD..LLDDKT-..--AS....pIILHENNVS-.....................----R.SLG.....MNASVTIEGTSAMyKl........piAPl...imGSHPV--......................DNKWT-------......................................-------------PSFS.......................................SITS.....ANSVDL...PACFFLKFPQPIPVSRAFVQKLQ.SCTG.IPLFETQP-..................T.YAPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PIPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GALVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
H8F4P0_DROME/74-431                  .........................................................................................................q-SALDKLQHy.iKVTSR....HGLVERLESLSRQLGL..KFM--......................---....---EDQQLLFIST.DM.FYVEILL.........DAA..G..SL.....S......DVKVHHECK......I......E-.....QQ..SSE..................................................-------LVACLK.......................-SGDFA.DFTVQLEGLSSIYQLNAEp.......kVKKKA.FVALQAMETDIQSLYQLHLQG...HsGD----...........................---------------SYSLM...TSSSVGlvlpr..............rgghpMRLTYFCPPLH..LPEGDPK.lASGD.....FTIDQVMRS-.....................-----.SYG.....LSATINLEGSSAN.K...........LQ......TLPTVTL......................VRDAQTG-----......................................----------LEVPTYA.......................................QLNQ.....NNSLLM...PATFVLRLNKPMPVCLESLKALG.-LPG.LDSVATPPG..................P.PTTVLNLIVQ.-------...........................................---TASKQAIKN-..........--TQRGL..YVNLPKETHC.Y.FF...TD.NRK.......................................L.qGTLVSSLPFTEPAQVPRIVAFLKKQALFYTLLASCVR........................................................................................................................................................................
K1XWD3_MARBU/107-517                 .........................................................................................................q--LIDMLQT...S-KGR....-LSENGVERLARRMGL..DPIFD......................IED....--TTVPRTLIIAG.KA.LSLDIEF.........-DR..D..VV.....K......KVILAFPEA......-......LD.....MV..TRH..................................................TSKAEAILLKDLQfqa................hespLTKRLD.RFAANLEILAASDKLSVI.........PGLNC.HEAIAGIYESVERL-------...HlWEVERLketq..................emagrSDAYVVKTAMCTKSGKPVIH...TRDRLG........................LSLEYWQERRR..LASDK--..----.....----------.....................-----.--A.....EKTWSLVIQCAPI.S...........DL......VYTPLRV......................SQHWISDNIQKAdata.............................edralEPDNGPVLDWQEPESTLlpptdp..........................pkadgmeGLEG....lTGQKYP...EVMFVAKFDPPLVVPYTLASQIY.ASTA.YPMVYY---..................G.SPHFDALLFP.LDAHDIEhd.......................................gmRIIPRERTVTAY-..........--SKEGV..KLESKQTHEL.W.IE...KA.DFG.......................................Y..--TLTELPFSHPKQLVEMLPALRQYAFLSTVLNNSF-g.......................................................................................................................................................................
A0A091DUY0_FUKDA/59-426              .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAIMYWKA...-.TN----...........................--AGPLDKILHGSVGYLTAR...SGGHL-........................MNLKYYASPSD..LLDDKT-..--AS....pIILHEN--NV.....................PRS--.-LG.....MNALVTIEGTSAMyKl........piAPl...imGSHPA--......................DNKWT-------......................................-------------PSFS.......................................SVTS.....ANSVDL...PACFFLKFPQPIPVSRAFVQKLQ.NCTG.IPLFENQP-..................T.YIPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PMPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLVSKITFQHPGRVPLILNMIRHQVAYNTLIGSCVK........................................................................................................................................................................
J9JYA5_ACYPI/71-414                  ..........................................................................................................QKSLDLLQQn.iKVTTL....QTMIERLDSVSRHLGL..K-F--......................---....TVGPSGKDIFVSS.DM.FYLEIIL.........EDN..G..GV.....K......DVKIHHDGK......S......EP.....QS..CAD..................................................-------LIKSLA.......................-NCDFA.DFTSQLEGLASIYQLNADk.......mVKCRA.FNALQTLEADLETFAQVHYTY...H.------...........................--KD-----------LISMV...HKTPLGvvkpr..............rgghpMKIIFFVSPYD..LLDVENN..---T....mMNLDKE----.....................---TL.DVG.....CYATVCIEAATTT.N..........vQS.....tSLLSASR......................SSTGINTPIFVP......................................-----------------.......................................--FT....vQNSITL...PAVFVLRLNEPMPICLQLAENIK.SVIE.MDLEMS---..................A.PRSLLGMIIE.P------...........................................-----SSQPLSV-..........-------..TLPDQQHCYF.L.TD...SN.LK-.......................................-..GVFIQNIKFTHPSQVTRIIAYLRQQALFNCLIRSCVR........................................................................................................................................................................
W6MH10_9ASCO/13-285                  ........................................................................................................se--ISEILQK...R-PGL....-VSIDGIKRLSNLYGF..ETFAD......................AIS....GTVPPVERLSLSG.KI.VLIDIDF.........-QA..G..VV.....S......SVSISSAVA......I......AP.....LG..SAQldfl..........................................npatSPNIEHILLENLR.......................-CERLD.SFNRNLRTLAQLDRLSEP.........SPLDL.FNFLHKLAYNLDCVAQYQLKV...A.CEVSADkl......................kdlK------DG-YAGIGKIEIN...RDGKVG........................VFLKYWENTRR..IRRWIE-..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------ardrsrynpgqfhihfkfmekmeletraepnaesasevavasedaplvdekfpdvwfengkwlltpghvsrmat..............................................................................................
MED1_PONAB/59-426                    .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....VS..CLE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAIMYWKA...-.TN----...........................--AGPLDKILHGSVGYLTPR...SGGHL-........................MNLKYYVSPSD..LLDDKT-..--AS....pIILHENNVS-.....................----R.SLG.....MNASVTIEGTSAMyKl........piAPl...imGSHPV--......................DNKWT-------......................................-------------PSFS.......................................SITS.....ANSVDL...PACFFLKFPQPIPVSRAFVQKLQ.NCTG.IPLFETQP-..................T.YAPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PIPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLISKITFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
W6QRH7_PENRO/132-554                 .........................................................................................................e-QVVQLLRA...RVSGR....GVSRESVERLSRLEDF..ESIWQ......................DDN....--------LNIAG.NF.VDLEIDF........yAGQ..D..VV.....K......DVSLRYATP......-......EY.....TE..GVR..................................................REEATAVLKRTLAqsae..............daecgKWRSLH.EFHENLQWLAKLDKLS--.........QEVNC.FEALENLEENFRRI-------...-.WVEESKn........................gkHGGEYQHLCA-GVLGRPTMH...KGTRIG........................LGLEYWVEQAK..VLDAKQS.lPSSD....aMEIDPQHDQG.....................SKGEL.DDQ.....GRSWAVMIECEE-.-...........--......GYPSLRI......................SKEWVGSEVFTAgest..............................ellpSNGAAGSVNWLDPPQTTrlthg.............................nhdpmALDSs...mLESSSP...NRRFVGKLEPALDVPILAASEIY.RQLG.MQLPQEFK-..................-.MITYDALLVS.ESSHLTSpvs....................................spqiGRRKRRMSVHAV-..........--DSKGK..PYTKQHNYTF.Q.SF...ES.ITG.......................................C..--TIHDLPFSHPRQLADILPILRQYALLANLIRKTF-h.......................................................................................................................................................................
G1LBE5_AILME/59-426                  .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAVMYWKA...-.TN----...........................--AGPLDKILHGSVGYLTPR...SGGHL-........................MNLKYYASPSD..LLDDKTT..--SP.....-----VILHE.....................NNVPR.SLG.....MNASVTIEGTSAMyKl........piAPl...imGSHPV--......................DNKWT-------......................................-------------PSFS.......................................SITS.....ANSVDL...PACFFLKFPQPIPVSRAFVQKLQ.NCTG.IPLFETQP-..................T.YVPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PIPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
B4QK78_DROSI/74-427                  .........................................................................................................q-SALDKLQHy.iKVTSR....HGLVERLESLSRQLGL..KFM--......................---....---EDQQLLFIST.--.---DIDP........aGRR..R..SL.....S......DVKVHHECK......I......E-.....QQ..SSE..................................................-------LVACLK.......................-SGDFA.DFTVQLEGLSSIYQLNAEp.......kVKKKA.FVALQAMETDIQSLYQLHLQS...HsGD----...........................---------------SYSLM...TSSSVGlvlpr..............rgghpMKLTYFCPPLH..LPEGDPK.lASGD.....FTIDQVMRS-.....................-----.SYG.....LSATINLEGSSAN.K...........LQ......TLPTVTL......................VRDSQTG-----......................................----------LEVPTYA.......................................QLNQ.....NNSLLM...PATYVLRLNKPMPVCLESLKALG.-LPG.LDSVATPPS..................P.PTTVLNLIVQ.-------...........................................---TASKQAIKN-..........--TQRGL..YVNLPKETHC.Y.FF...TD.NRK.......................................L.qGTLVSSLPFTEPAQVPRIVAFLKKQALFYTLLASCVR........................................................................................................................................................................
A0A0G2IGT8_9PEZI/268-396             ........................................................................................................he---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------------.........-----.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...NAELSTRGDEHIRVVAIVWIEMR.HVTG.APVGDPPP-..................Y.MPTFDSLIFT.PGPEYNAa........................................epRVITATKLVKAF-..........--TKDKK..PAPKTYENRL.F.IH...KP.VYG.......................................Q..--ALTELPFSHPSQLVAMLPTLRQYAFLQILLDRAF-s.......................................................................................................................................................................
H0YVF4_TAEGU/51-420                  .........................................................................................................v-SCLETLQKa.lKVSSL....PAMTDRLESIARQSGG..PGA--......................-A-....AAAPGAAPALINS.LG.YFITLNL.........TSS..G..KF.....C......IVKVVYAAE......-......GP.....EN..CPE..................................................-------LVQHLR.......................-EKNFD.DFSKHLRGLVNLYKLPGDn.......kLKTKM.YLALQSLELDLQKMAGMYWQA...-.TN----...........................---------------ANPLDk.iLHGSVGyltpr..............sggllMNLKYYVSPYD..LFEDGT-..-GAP.....-----VVLHE.....................NSVPR.SLG.....MNVSVTVEGTMAM.H...........KL......PIAPLIM......................GSHPVDS-----......................................----------KGTPSFS.......................................SITS.....ANSVDL...PACFFLKFPRPIPVSRAFIQKLQ.SCTG.IPLFDTAP-..................T.FVPLYELITQ.-------...........................................-------FELS--..........---KEAD..PLPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLISKIAFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
B8M9G3_TALSN/133-547                 ..........................................................................................................EEVVQLLRG...RVAGR....GVSREAVERLGRLEGF..ESIWQ......................EDS....--------LSIAG.NS.VDLEIEF.........YPG.eD..NV.....K......DVSLSYASL......E......GE.....SE..SER..................................................REEATIVLKGDLIqtae..............erenrAWKSLK.GFQSNLERLAKLDHLS--.........QEINC.FEAVESLFESLQKV-------...-.WDAESRr........................gsYHSVYEHLCR-GSIGRPSLH...RRGRVG........................MGLEYWVEGHR..ILHAKQT.kKSAD....pMAIDTEEDD-.....................---DG.YLQ.....DQLRSVTIECEE-.-...........--......GFPSLRI......................SKEWVGAEILSTv....................................eTNDASTAVNWMDPPPTLqs..................................svsELDTd...mVGSGTA...NRRFVAKLEPHIHVPLLIANDIY.RHLG.LTIPHDYR-..................-.TTTYDGLLVP.GWTSSGMnsndsm..............................aseslemPEKRRMKAVLSF-..........--DEKDE..PVQKNHSYSF.Q.AF...EA.APG.......................................M..--TIREFPFSHPRQLADIFPIFRQYSLLATLMQKVF-p.......................................................................................................................................................................
A0A0G4MJQ8_9PEZI/126-550             ........................................................................................................da--IIDIIGN...A-KGR....-VSEAGLERLSQRTGL..NKIWE......................DHR...tPDGKVKKTLVIAG.HG.LQLDIIL.........-DN..N..IV.....E......GVTLAFPES......E......SP.....IV..AKH..................................................VDRAGQILLRDLQllp................dqspLTKKMD.EFAANLERLATLDKLSIF.........PGLDC.QEAVAGIFESLERL-------...YnWELARVkedp..................amagkPDVLLERTVQCSRSGRPAMH...ARDQVG........................LSLDYWAERRL..VPPKTPA..----.....----------.....................TETYC.ANA.....EQIWSIIVGCRPL.D...........GE......LYPPIRI......................SEDWISQKVEKSdpvp..............................tdllEPSNGPLLDWLEPAPTVlppasdn........................kavvvevvQPDG.....TTQRYP...NVKFVATLNPPVIVPQAVCNALY.NLSG.AQPPPMML-..................P.SYTFDGISFP.IVDGQNHda......................................selRTISCERDVFVL-..........-----GA..PQRRRHENTL.F.VY...KP.VYG.......................................Q..--TISELPFSHPRQLVAMLPTLRQYAFISRLLARSF-g.......................................................................................................................................................................
A0A094FBG9_9PEZI/129-547             ........................................................................................................mq--IVDTLKA...V-KGR....-VSEDGIERLARSVGL..ECLWE......................TGM....GRGGKSKTLIIAG.TG.LSIDIEF.........-TD..N..VV.....E......TVTLGFPES......-......PE.....SV..TRH..................................................ADEAGKILLDDLKlgk................getvLTKRVD.RFAGNLDRMARLDKLSVM.........PQLNC.HEAVTGIYDSLEKL-------...HkWEVARLteee..................amsgkTQEQIVRAALLKKSGRPAMN...AHGSVG........................LCLEYWQERHA..TSQGE--..----.....----------.....................-----.--G.....CKTWSLLLECDQS.S...........SM......VYPPVRV......................SSAWISPSVVKSnpta..............................ddvlLSASDVVLDWQDPPNILlpsdpdqk......................ddsgmegieQSGQ....lPNQKFP...DVRFVAKFSPPLTLPYSAAMQIY.DSTG.AHLEPDAL-..................-.-AAFDALAFP.PQTTEPSepd.....................................gahRRIRKEQLVSVY-..........--KRTGE..HEKQCHTNTL.T.IP...KM.EYA.......................................L..--KLTEVPFSHPRELVQMLPILRQYTRLSTLLERSF-g.......................................................................................................................................................................
B4IYT6_DROGR/80-458                  .........................................................................................................q-SALDKLQHy.iKVSSR....HGLVERLESLSRQLGL..KFM--......................---....---EDQQLLFIST.DM.FYVEILL.........DAS..G..NL.....N......DVKVHHECK......I......EQ.....QS..NSS..................................................--ASSRELLNCLK.......................-AGDFA.DFTVQLEGLSSIYQLNAEp.......kVKKKA.FVALQAMETDISNLYQQQLQK...Q.QQ----...........................---------LRGNSDSYYIM...NNSPLGlvmer..............rgghpMKLTYFCPPLQ..LIEKKVK..-GEK.....LATATASGTAsrd...............fsiEQVMK.SPN....gLSATLNLEGSSAN.K...........LQ......ILPIVSF......................TSESGLP-----......................................----------LEQPSYA.......................................PLTQ.....NNSMLM...PATYVLRLNKPMPVCIESLRALA.L-PG.LGSLGVSG-..................E.GTTVMNLIVQ.-------...........................................---TASRQLIKS-..........--TQKGL..YVNLPKETHC.Y.FF...TD.NRR.......................................L.qGTLISTLPFTEPAQVPRIIAFLKKQALFCTLLSSCVR........................................................................................................................................................................
H2Y0R6_CIOIN/61-223                  .........................................................................................rscmdkvlmnmggsynl---------...-----....RDVIDRLRSVASVNGLrfNVVLD......................QDT....--SSPGTTCQILA.DM.FTMEVTL.........DESqfGglSV.....L......DVKIVYSDH......-......-V.....KS..CPN..................................................-------MVQIIR.......................-EGKFL.ELSKQLKGLTDIYPPSMDq.......tTRTRM.YMALQSLDMDLAKMSQVYRDS...H.GD----...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------sdtlhiimngyvgl..........................................................................................................................................................
A0A0J7KYK3_LASNI/82-439              ..........................................................................................................QKCLDTLQHs.iKVTSF....QSMVERLESLARQLGL..KFM--......................---....MSGPPGTEIFISS.DM.FFLEVLL.........EPS..G..LV.....R......DVKIHHEGK......S......EQ.....QS..CEA..................................................-------LASALS.......................-RGDFV.DFTTQLEGLASIYQLNADk.......kVKCKA.FSALQSLEADLGVLAQLQTFM...-.------...........................---------------KEPFNl.vHKSPVGilerr..............rgghpMKLTYFVSPYD..LIDEENR..----.....----TYDVLN.....................PDVIV.KRKi...gHSVTVCMEGSIGH.K...........LP......TSSIITV......................NRSPTGK-----......................................-----------STPSYA.......................................PLTS.....TNSSML...PACFVLKLGKKMPICMELVRRIQ.KVTE.LECGDISA-..................-.LHPMLSLIIQ.-------...........................................-------HASDGLl........dCRNNRGL..YVTLPDQQHC.Y.FM...TE.NKN.......................................M.eGVLVCSIPFTHPAHVPQILVYLRQQALFNCLIASCVR........................................................................................................................................................................
G2QTE5_THITE/118-539                 .........................................................................................................d-AVISILSR...N-KGL....-VSEAGLERLVQKLEL..ESVWE......................NSM....-DSSDKRTLYIAG.SA.LELVVEF.........-SN..N..VV.....Q......SAVLSFPES......-......AE.....IV..NKH..................................................AKAAGEILWNALRlrd................gqspLTKSLA.PFAANFERLAALDRLSIN.........PGLNL.YEAVAGIYESLSRL-------...HtWELQKLrqep..................slegkSDAALENLVLCTKSGTPAMN...ARGRVG........................MTLDYWREKRL..QPVPPDL..----.....----------.....................-AAWV.DEH.....ETIWSILIGCAPL.R...........EI......GVSPVRI......................SDRWIGPNVEKTpl.................................pdeLHTGGPVIDWLEPDSTLlpasdp...........................trpdpmQPDAs...lLGPRLP...EVVFHATFEPPVHIPLNLWQHLQ.ELG-.CAMDEPAGA..................D.VQSFDSLIVP.SPPGQAS...........................................DITETRIVTFDKKts......faPPNDPTK..VSSRTHANTL.V.VH...KA.VLS.......................................R..--TLSGLAFSHPQQLVAVLPFLRQYIFLAVLLEHSFK........................................................................................................................................................................
S7ZRP0_PENO1/136-553                 ..........................................................................................................QDVVQCLRA...RVAGR....GVSREGIERLSQLEGF..DSMWG......................DNN....--------LNIAG.NF.VDLEIDF.........YPG.qE..VV.....K......DVSLRYATP......D......Y-.....EE..GER..................................................RDEASEVLKRNLVqslk..............dvehgRWRSLQ.AFLDNLHWLRKLDKLS--.........QQVNC.FEALEGLEENLKRV-------...-.WSAEEKn........................ekYGGEHEHLCA-GVVGRPSMH...KGTRIG........................LGLEYWVEQAK..ALDAKKN..SSPE....aMAIDQVPTSN.....................ENG-T.GEQ.....QKTWTVMIECEE-.-...........--......GYPSLRI......................SKEWVASDVFTSges...............................nepgAGADSKVVNWLEPPQTMrlshg............................dhpdpmALDSs...mLESTPP...NRRFVARLDPPLHVPILAASEIY.RHLG.MQLPQEFK-..................-.MFTYDSLVTS.GGSQPDAtp.......................................qpGRRRCRKSVQTF-..........--DSTDS..PCTNYHEYTF.Q.AF...ES.VAG.......................................R..--TIRDLPFSHPRQIAEVIPVFRRYALLANLIRQV--ts......................................................................................................................................................................
E2A6Z0_CAMFO/862-1219                ..........................................................................................................QKCLDTLQHs.iKVTSF....QSMVERLESLARQLGL..KFM--......................---....MSGPPGTEIFISS.DM.FFLEVLL.........EPS..G..LV.....R......DVKIHHEGK......S......EQ.....QS..CEA..................................................-------LASALS.......................-RGDFV.DFTTQLEGLASIYQLNADk.......kVKCKA.FSALQSLEADLGVLAQLQTFM...-.------...........................---------------KEPFNl.vHKSPVGilerr..............rgghpMKLTYFVSPYD..LIDEENR..----.....----TYDALN.....................PDVII.KRKi...gHSVTVCMEGSVGH.K...........LP......TSSIITV......................NRSSTGK-----......................................-----------STPSYA.......................................PLTS.....TNSSML...PACFVLKLGKKMPICMELVRRIQ.KVTE.LECGDISA-..................-.PHPMLSLIIQ.-------...........................................-------HASDGQl........dCRNNRGL..YVTLPDQQHC.Y.FM...TE.NKN.......................................M.eGVLVCSVPFTHPAHVPQILVYLRQQALFNCLIASCVR........................................................................................................................................................................
G3H5X2_CRIGR/59-426                  .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPT..G..QL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAIMYWKA...-.TN----...........................--ATPLDKILHGSVGYLTPR...SGGHL-........................MNIKYYASPSD..LLDDKT-..--AS....pIILHEK--NV.....................PRS--.-LG.....MNASVTIEGTSAMyKl........piAPl...imGSHPV--......................DNKWT-------......................................-------------PSFS.......................................SITS.....ANSVDL...PACFFLKFPQPIPVSKAFVQKLQ.NCTG.IPLFETPP-..................T.YVPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PLPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgqslQ..GTLVSKITFQHPGRVPLILNMIRHQVAYNTLIGSCVK........................................................................................................................................................................
C4A0W8_BRAFL/52-416                  .........................................................................................................r-KCINALQKa.lKVTTL....PSMVERLDSVARQVGL..N-F--......................---....KVSSSGHECCISS.EL.FYVEIRL.........DTS..G..GV.....Q......DVRVAHHGS......-......ES.....QG..CLE..................................................-------MLRVLR.......................-NGDFK.EFVGHLKGLLNIYRIPGDs.......kIKMRT.YQTLLCMESDLTKMADAYK--...-.------...........................---------MSGGRGDPMTQ..iQKGIVGyvipr..............qgghpMQLKCFISPYD..MLNVERE..KSET.....-----IHDNV.....................PRD--.-VG.....QSVNVVLEGSTSH.Kl........qtQPl...faGINPPQH......................--DSKGS-----......................................-------------PAFA.......................................GINN.....NNMMLL...PACFSLVPPSPIPLSISTIKRIH.SATG.ILCGDEGK-..................-.AVPMNRLVTQ.NVMEAKGia.......................................dmDNNNGRNKLFHV-..........-------..TLPDQHH-SY.Y.IN...-D.APD.......................................L.kGVLVSKIPFTHPACVPRVLEALRQQTVYNTLITSCVR........................................................................................................................................................................
G1P7G3_MYOLU/59-426                  .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....MS..CPE..................................................-------LVQQLR.......................-EKNFE.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAVMYWKA...-.TN----...........................--AGPLDKILHGSVGYLTPR...SGGHL-........................MNLKYYASPSD..LLDDKTT..--SP.....IILHEN--NV.....................PRS--.-LG.....MNASVTIEGTSAMyKl........piAPl...imGSHPV--......................DNKWT-------......................................-------------PSFS.......................................SITS.....ANSVDL...PACFFLKFPQPIPVSRAFVQKLQ.NCTG.IPLFETPP-..................T.YIPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PIPLKHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
C5GGI8_AJEDR/72-499                  ..........................................................................................................EEVIRLLRT...RVSGR....GVCREGMERLGRFEGF..ECLWQ......................END....--------LSIAG.NF.VDLEIQF.........EDG.aE..NV.....K......DVSLKYTTP......-......ST.....VE..GER..................................................RVEATAVLKQDLMqstg..............ehdemPWKSLD.AFHSNLHRLAKLDQLS--.........RDVNC.FEAVTGVYESLKRV-------...-.WEGELSr........................hpEKSHWEHVCT-SQVGQPGLH...QNKRIG........................LSLQYWVEQRR..NLDSNHK.vIPNA.....MSIDQPTPDD.....................QNSTP.VNK.....HKIWSAAIECEE-.-...........--......GYPSLRV......................SNEWVAAEPFTTmntggs..........................ssaangNDSEILLINWLDPPATLvts................................pndvTLDSt...aLGTTTP...NRRFVARLEPPIHIPIIAAAEVY.RVLG.LNMPPEPK-..................-.TVTYDGLVVP.LPNVVSTgdgqde...............................nssspsNGRVQERVVYSF-..........--DDDNQ..PKQHRHIYTF.H.PF...EH.IVG.......................................R..--TIRDLPFSHPRQLADILPILRQYALLSSLLDRVF-a.......................................................................................................................................................................
B6K2C3_SCHJY/38-230                  .................................................................................................sllqipwtn---------...-----....-TTVQGLEDLAKRYRL..DVFVD......................TSQ....---EGKTVLSLAG.KI.ILVDVTIl.......kEDP..T..KV.....N......QVALIFADA......S......GE.....QH..TDE..................................................------DLERCLRd....................aiLHENTS.AFERNIAFLAAGDHSSPS.........VQQSA.FLYLQQIYKAVFAV-------...H.-E--DE...........................CRRMKMNDALLYGHGVPVLN...KNDILG........................LQLTYWESLHE..TFEAH--..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------lilddmpprgvrhveya.......................................................................................................................................................
H6C4B3_EXODN/138-548                 ........................................................................................................lv---ADILKT...KVAGH....GTTREGVERIAKLQGF..TTLWD......................DEN....--------LTIAG.NA.VDLEVIFd.......aRER..D..RV.....T......DVSLKLNTS......-......ET.....EE..PEL..................................................QESGSEILKDNLRplht..............vngspQWTDLN.TFEANLQYLSQLDRIE--.........GGAPC.FEAVNGLYDAFQKI-------...-.WNAEKEr.........................fSGRTARQGPSRSAVGRPFID...RKPVLG........................LGLDYWCTRQD..LQEEALN.gNGEH.....----------.....................---HD.DPS.....SHLYTARISCEP-.-...........--......GPPSTVL......................TSRWVSGDVLVPvsq...............................tvgdMEAEKLMPDWQDPAQDAhglntsdk......................tdsgeangdKPAG.....LPPTLL...DMHFVSCLEPEVYLPLNIAAHLN.ADLP.MVELKQEL-..................-.TVTYQTALQK.HFNANHTgs......................................asaSQERWPRSLPTL-..........-----GE..KPPRQHSYAL.H.SA...QH.AAV.......................................L.wCYPVKQLKFNHPRQLAAVIPVLRQYALLWSVLRSLV-d.......................................................................................................................................................................
F9F7M6_FUSOF/118-539                 .........................................................................................................e-TIIATLDQ...K-KGL....-VSEAGLERLAQRIGL..DCLSE......................DHT...aSDGRKQRTLVIAG.SA.IQLEITL.........-HN..N..IV.....E......NISLAFPES......-......AR.....SV..TDH..................................................VTRASEILLRDLQllp................nqspLTKTLD.KFAVNLERLAVLDKLSII.........PGLDC.HEALAGIYVSLERL-------...HkWDVARLrdep..................gmggkPDSELSTMAMCTRHGYPVMH...SKDRVG........................LALQYWKALRL..VQPTNTK..-MAS.....----------.....................---FT.SSH.....EPVWSLLIGCAST.G...........GM......GHMPVRV......................SEDWISKDVVKAe...................................psMDPKRPNLDWQEPDNVVlphseen........................kdasmemlQPDL.....STARVP...QVMFVATFDPPVILPQNDWLRLH.SYAN.VNANPLFG-..................Y.SPTFDSLFFP.IPPGSAQdp......................................selRAISRSRDVRIY-..........--DKDQT..AIIKPHQNTL.Y.IY...KQ.IYS.......................................Q..--VVTEIPFSHPQQLIEMLPLLRQYAFVATLLENSF-g.......................................................................................................................................................................
A0A087YNC0_POEFO/82-444              ........................................................................................................ar--ALDRLQEv.lQAPTM....DNTKSRLEMIAKRQGM..DFYCT......................DV-....-------TCYLTA.DI.FYLEVLL.........LPS..G..EV.....Q......EVKMALHRE......-......RP.....AP..SRS..................................................-------LLRLLR.......................-SNNFS.EFSLRLGELFAQYNIPGDs.......eTKSKM.LKSIKSLWKDLQQISDMPKEP...KcFE----...........................----------------AQIDl.iNNGRVGflmae..............kqdypPSLYFYISPND..CLKNSE-..----.....LSLEELL---.....................---EF.KPA.....VQVNQATIGVGD-.-...........--......LIHKLQM......................-TSLISE-----......................................----APQLDTHSCPAVA.......................................ALGE.....VSNETL...PACFLLRLKTPIPVLSHIVERVG.QITG.VTIPDCDL-..................Q.WAPLPKLLIN.ASASAKS..........................................pSEPLDGQEIFTVV.........fPEGGMHT..YV--LSD---.-.SS...WD.APA.......................................Q.rAALLASVPFTQLAHVSAVLELLRHQCVFNTLLRSCL-t.......................................................................................................................................................................
A0A0F8X853_9EURO/136-565             ..........................................................................................................EEVVQLLRT...RVAGR....GVCRDGVERLGQLEGF..ESIWQ......................EDN....--------LSIAG.NF.VDLEIEF........hRGQ..N..VV.....K......DVSLKYATP......-......EV.....TD..GE-..................................................RRDGTAVLKRDLIqtpe..............egergTWKTLA.GFHENLQWLARHDRLS--.........QEVNC.FEAIEGLYESLKKI-------...-.WDNEGSh........................rnFSWEFGHLCS-GWVGRPRLH...KDGQIG........................LGLDYWVPRAQ..VLDAKQR..KSAD....dMVIDQPSARN.....................SDDES.GHL.....DCKWSIAVECEE-.-...........--......GYPSLRV......................SKDWVGTEVFTAvnnttn.........................asssseaMGLDAMVVNWADPPATVtqn................................sdsmALDSg...mLDSSSP...NRRFVARMDPPLDLPLLAASDIY.RHLG.TQMPQDFK-..................-.MLTYDGLLAP.EWTPLSAagsmglg.............................pqeaslvNRRRSRISVQS--..........-MDDQGK..PCTKQHSYTF.Q.PF...ES.AAG.......................................R..--TIRDIPFSHPRQLADILPILRQYAFLANMIRSIF-p.......................................................................................................................................................................
G1TW10_RABIT/60-427                  .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAIMYWKA...-.TN----...........................--AGPLDKILHGSVGYLTPR...SGGHL-........................MNMKYYASPSD..LLDDKT-..--AS....pIILHEN--NV.....................PRS--.-LG.....MNASVTIEGTSAMyKl........piAPl...imGSHPV--......................DNKWT-------......................................-------------PSFS.......................................SVTS.....ANSVDL...PACFFLKFPQPIPVSRAFVQKLQ.NCTG.IPLFETQP-..................T.YAPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PVPLSHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLVSKITFQHPGRVPLILNIIRHQVAYNTLIGSCVK........................................................................................................................................................................
G8Y9P3_PICSO/9-420                   ..........................................................................................................EECLDKIFE...YSAKF....SVDVDIIQKLASVLKL..DTFIDndaysh.........aldpefnA-S...yRNKVKFKRLSIAG.SS.ILIDIDF.........-ID..N..TI.....L......GVWISSAQH......S......EN.....EQ..D-Qkeieqnlgnieqeadgkvk............ltvdlkaknsfirkpkgdgQAAAEKILLSNFE.......................-KGTLS.SFSTNLKYLGTLDKFSS-.........SGVDM.FEYMDSIASILSAFQSAEEKH...-.------...........................NDSWLVKKGLGSSFGKIKINd.eKDGLIG........................IYSEFWRDNRY..INHELEV..NNSS....lSLGSTYSVRFgvds............tdektKDYLR.QVR.....EHPWKILDSSSGL.K...........DCv....vEYTSSVP......................------------......................................---------------DL.......................................QSND.....----LT...KWILRVEFLHSFYIPVSVLEYLG.-LTK.YKLSPSELE..................S.TQLFNALNNN.-------...........................................------QKVAYL-..........------T..KC-FGTETKL.S.LQ...QK.LIQ.......................................E..YVPLKFVLLDDIRALPKLITSARNYLVLSNFLRK---ig......................................................................................................................................................................
A0A0L7LV46_9NEOP/212-369             ...........................................................................ssglaslvapshtqighsatvllegsaankl---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------------.........-----.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....--HAML...PACFTLKLSQPTPLCAGLAKLIH.ATTE.VEVAADWS-..................N.AKPLLGLVAQ.-----QA...........................................YNKLTPGKVIEL-..........-NLSKGL..FVNLPDQMQC.Y.FV...CE.TRG.......................................L.nACCVTSVPFTHPSQVPPLLACLRQQALFNTLLASCVR........................................................................................................................................................................
F6SJK0_MONDO/59-427                  .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNAL..G-S--......................---....HLSANGTECYITS.DM.FYVEVQL.........DPT..G..HL.....S......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYKLPGDn.......kLKTKM.YLALQSLEQDLSKMALMYWKA...-.TN----...........................--ASPLDKILHGSVGYLTPR...SGGHL-........................MNLKYYASPYD..LLEDKTA..--TPi...lLHENNV----.....................PRT--.--L....gMNASVTIEGTPSA.M..........yKL......PIAPLIMgs.................hpiDNKWT-------......................................-------------PSFS.......................................SITS.....ANSVDL...PACFFLKFPRPIPVSRAFVQKLQ.SCTG.IPLFDTQP-..................H.YVPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PVPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLIDKVTFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
F6YVN1_CALJA/1-259                   ........................................................................................................kl---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------------.........-KTKM.YLALQSLEQDLSKMAIMYWKA...-.TN----...........................--AGPLDKILHGSVGYLTPR...SGGHL-........................MNLKYYVSPSD..LLDDKT-..--AS....pIILHENNVS-.....................----R.SLG.....MNASVTIEGTSAMyKl........piAPl...imGSHPV--......................DNKWT-------......................................-------------PSFS.......................................SITS.....ANSVDL...PACFFLKFPQPIPVSRAFVQKLQ.NCTG.IPLFETQP-..................T.YVPLYELITQ.-------...........................................-------FEL---..........--SKDAD..PIPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
MED1_DROME/74-431                    .........................................................................................................q-SALDKLQHy.iKVTSR....HGLVERLESLSRQLGL..KFM--......................---....---EDQQLLFIST.DM.FYVEILL.........DAA..G..SL.....S......DVKVHHECK......I......E-.....QQ..SSE..................................................-------LVACLK.......................-SGDFA.DFTVQLEGLSSIYQLNAEp.......kVKKKA.FVALQAMETDIQSLYQLHLQG...HsGD----...........................---------------SYSLM...TSSSVGlvlpr..............rgghpMRLTYFCPPLH..LPEGDPK.lASGD.....FTIDQVMRS-.....................-----.SYG.....LSATINLEGSSAN.K...........LQ......TLPTVTL......................VRDAQTG-----......................................----------LEVPTYA.......................................QLNQ.....NNSLLM...PATFVLRLNKPMPVCLESLKALG.-LPG.LDSVATPPG..................P.PTTVLNLIVQ.-------...........................................---TASKQAIKN-..........--TQRGL..YVNLPKETHC.Y.FF...TD.NRK.......................................L.qGTLVSSLPFTEPAQVPRIVAFLKKQALFYTLLASCVR........................................................................................................................................................................
G0W4C8_NAUDC/11-284                  .........................................................................................................g-QMIELFKE...YKPGV....-ITIDNITKLCHTLGL..ESFID......................DVD....---ATTLRLSTAS.KI.IVIDIDF........nKSD..G..KV.....K......DVKLVLASN......F......DN.....F-..--Nyfndd........................................kdrssTSTTKNILLNSLT.......................LYQDLQ.VFHHNLQYLYLLDTFSQ-.........IDVDT.---GASASNDVGTG-------...Y.------...........................-----SETSLSNNNGSINAA..iTTGKLD........................L-FKYFTELSH..YLKQYFN.dNSID.....SEIKTNLNDKfgiy............iiskdD----.-AE.....VPIAKLYFEKSN-.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------dpqhrlyeyiystetkswinessesftcginlimelitknptdeynsniwfpqdf.................................................................................................................
A0A067R849_ZOONE/53-409              ..........................................................................................................QKCLDILQHs.iKVTSL....QGMVERLESVTRQLGL..K-F--......................---....SPGGSPLDWFISS.DM.FYLEVML.........EST..G..GV.....K......DVRIHHEGK......V......EQ.....QS..CEE..................................................-------LVSCLS.......................-RGDFA.DFTAQLEGLASIYQLNAEk.......kVKCKA.FSALQSLEADLGTLATLQSFI...-.------...........................---------------KEPFNl.vHKSPVGilekr..............rgghaMKLTYLVPPYD..LLDQQTN..SSLS.....LSVEE-----.....................--VTS.RNL....gYSVMVCLEGSAAH.K...........LQ......TTALISV......................NRSPSGK-----......................................-----------STPLYA.......................................SLSA.....ANSATL...PACFVLRLNNPMPMCLNLVRRIQ.QVTE.ME--CGDLS..................T.PHPLLSLVTQ.HASAG--...........................................------------Ql........dCANNRGL..FVTLPDQQHC.F.FM...TE.SKN.......................................L.eGILVSNIPFLHPAHVPQILMLLRQQALFNVLVSSCIR........................................................................................................................................................................
C5M6G5_CANTT/10-403                  ..........................................................................................................DKSLQLLYA...YSSNF....QISVELIQRLAQQLKL..ETFIDnlg................fqlQNS....TNNTNVQKLTIAA.SS.ILLDLDF.........ESD..T..KI.....V......NLSLSINGS......E......NL.....QT..GEPytihkdelglthvkln..................cnnnrvtflnkssnsnKTQVEEILLSNLQ.......................-GPKLG.NFPANLQYLAIIDKFAN-.........HNPEL.FIYIETISFLLNTINQIDKEL...EdWQ----...........................-----PEFGI---LGNVKLN...QDKKLG........................VVLDFWKDYRF..INREYRS.iKGTDe...lLVGQNYELKLnvvd.............stnqVDYLI.DNQ.....IQEWEIAHGKYKF.E..........fEN......TLKPLVVdg..................dnFSAWA-------......................................-----------------.......................................----.....------...---LQLELNHSVYLPVFVLEYLG.F---.LDYTTSEA-..................E.-QSLK-----.-------...........................................-------DVFEKVn.......ngEEFEQVL..NI-DSNNVSF.Q.FS...NN.IPS.......................................K..FVNLKSVNINQLLDIPKIIPVLRNFIVLSNLIRTVI-n.......................................................................................................................................................................
U4KZE1_PYROM/87-477                  ..........................................................................................................EEMLKLLAQ...R-PGR....-ISIPAIERLAKGMGL..DFYKE......................DGD....--APGVIRLSLAA.KI.FLLDIEY.........-LG..N..TI.....I......KAQLALSGN......-......DP.....QT..FQS..................................................IDEATKILQSNLVpvaks............pghyplFSSSIG.DFSENLTRLYRTDKLST-.........DNLNC.FTAISGIYQSLEKIYHYEREN...-.------...........................---MGEMAALCFGNGRPQMH...IRGKVG........................LSIDYWKERRL..LNAHGGG..KNTE.....----------.....................-----.EEE.....ERLWRVLIEVEET.P...........NFggipmnHVTPVRS......................TNHWVSDEIKKHked................................nlfGDLEELTTDWLEPPLEEl.....................................mEIPGd...pTQSKPP...SARFVARLDPPLVLPWPEEQALN.PSI-.--IPTD---..................-.IDSFERLLFP.SLS----...........................................PKESTYREIYGS-..........--SEDAE..ATIHNYHLET.L.AL...KT.VSS.......................................R..--RVTEIPFSHPRDLLRFFHTLRQYALLSTLLESCF-s.......................................................................................................................................................................
E7NNY7_YEASO/12-300                  ..........................................................................................................DSMIELFKD...YKPGS....-ITLENITRLCQTLGL..ESFTE......................ELS....---NELSRLSTAS.KI.IVIDVDY........nKKQ..D..RI.....Q......DVKLVLASN......F......DN.....FD..--Yfnq............................................rdgEYEKSNILLNSLT.......................KYPDLK.AFHNNLKFLYLLDAYSHI.........-----.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------esdstshnngssdksldssnasfnnqgkldlfkyftelshyirqcfqdnccdfkvrtnlndkfgiyiltqgingkevplakiyleenksdsqyrfyeyiysqetkswinesaenfsngislvmeivanakesnytdliwfpedfispeliidkvtcssnssssppii.
W9ZMP3_9EURO/137-546                 ........................................................................................................ql--VVEMLKK...RVAGR....GITREGVERIAQIQGF..TTLWD......................DEN....--------LTIAG.NA.VDLEVIFd.......aIDR..D..RV.....T......EVSLKLNTP......Q......N-.....DE..PQP..................................................QDRASEILKDNLTpsni..............lqgfpQWTSLD.TFESNLQYLSQLDHIE--.........EGAPC.FEAVNGLYDAFQKI-------...-.WNAEREr.........................fGGRTTRQHLRRSAVGRPSLD...RKPMLG........................LALDYWRARED..SRQASAE..DETE.....----------.....................---TG.DDL....pSHLYTARISCEP-.-...........--......GSPSTVL......................AKQWVSDHGLAPtgp...............................avddNEAELVTPDWQDAVHDMndsngi...........................tkadsdKPPD.....LSSTVL...DMHFVGHLLPEVYLPLNVAARLN.LDLT.MVELKQEL-..................-.TVTYQAALQK.HFNASQTds......................................asaSQERWPRTLPVL-..........--DEKES..SHFRQHSYAL.H.SA...QH.AAA.......................................L.wCYPVKQLKFTHPRQLAAVIPVLRQYVLLWSMMRSLV-d.......................................................................................................................................................................
H2ZMZ5_CIOSA/58-321                  ..............................................................................................tcmdkvlmnmag---------...-SSNL....RDVIDRLRSVARINGLrfNVVLD......................QET....--SGPGTTCQILA.DM.FTMEITLdg....esqFCG..P..SV.....L......DVKILYSDH......-......-V.....KK..CPK..................................................-------IVEVIR.......................-DGNFL.ELSKQLKGLTEIYPSSMDr.......tTRTRM.YMALQSLDMDLLKMSQVYRES...H.------...........................KDCELLEIVLSGYVGLLTPR...---DAGt......................sSQLKYFLSPYD..LMDMKTK..QIKS.....----------.....................TQNIP.EKI.....GMVAEIGIEVNDG.Q..........cRL......PITPLIA......................NNHPTDE-----......................................----------TSKPRFS.......................................EINQ.....HNSVLL...PACYTLKLHPPVPV---------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------........................................................................................................................................................................
A5DBQ9_PICGU/9-401                   ..........................................................................................................EKCLWMLYK...EADSF....GASASLISRLAEMLNF..DTFLDedayth.........ivgeplvDNN....KERMKFKRLSIAG.SL.ILLDIDI.........LTD..T..KI.....L......RISLSSANH......Q......GD.....AK..VGNyykiinsgdtsri.......................evnfsqnnesflgkSANPEKILLSSFA.......................-DDKLG.KFPRNLAYMADLDKSSG-.........AGPDL.FLYIDKLALVLKAIHEYEKER..dAtWE----...........................-----SQNGYVGSVGRVALNn.eTDLLLG........................VFLHFWQDWRY..INHHKAP..ESAT.....----------.....................-----.-PA....fGKNYYALLRVKP-.S...........TS......SNEYLND......................SLKWPLP-----......................................-DGSKLDLEFANNDTKV.......................................DED-.....----SS...PWILCLEFNESIHLPLQIVELLE.AVV-.--ADEGST-..................S.SAAFTALNNH.-------...........................................-------DSFHG-..........-----NI..SLENGTFVDT.R.VV...SD.LPY.......................................R..FIPAKVVEIKSLKVIPKLLSLARTFLFVQNLLVS---fn......................................................................................................................................................................
B3M6G3_DROAN/72-429                  .........................................................................................................q-SALDKLQHy.iKVTSR....HGLVERLESLSRQLGL..KFMED......................---....-----QQMLFIST.DM.FYVEILL.........DAA..G..SL.....L......DVKVHHECK......I......E-.....QQ..SSE..................................................-------LVDCLK.......................-AGDFA.DFTVQLEGLSSIYQLNAEp.......kVKKKA.FVALQAMETDIHSLYQMHLQS...Q.------...........................------------SGNSYDLM...ASSPVGlvlpr..............rgghpMKLTYFCPPLH..LPEHDPK.lPSGD.....FTIEQVMRS-.....................-----.SYG.....LNATVNLEGSSAN.Kl........qvAP......ILSFVRD......................QQTGM-------......................................-----------EVPTYA.......................................PLNQ.....TNSLLM...PATYVLRLNKPMPVCVESLKALG.-LPG.LDAQANPPT..................P.ATTVLNLIVQ.-------...........................................---TASKQAIRN-..........--TQRGL..YVNLPKETHC.Y.FF...TD.NRR.......................................L.qGTLVSSLPFTEPAQVPRIVAFLKKQALFYTLLASCVR........................................................................................................................................................................
G3ALE6_SPAPN/9-409                   .........................................................................................................d-TSLQLLYD...YSSNF....QISVELVQKLAQHLKL..ETFID......................TSFqfgnVEGNNQQRLTIAA.SS.ILLDIDF.........END..R..KV.....S......NISLSIGNE......S......TH.....TT..ENSkeyiesvqnnhgitvik................lnpnknpltflkkssdeKSIAEKILLANLS.......................-QPKLN.KFPENLQYLAIIDKYAN-.........SNQDL.FTYIERTALLLHTISQLEIERn.pNnWQ----...........................-----IEQGLNNAIGNVKIHd.iTQGKIG........................LFLEFWKDFRY..INHESNT..----.....AIGNTYNVQFnivs.............ssynHEYLL.ENN.....KKEWEIANQGNKE.R..........vK-......----FEF......................EDAVI-------......................................--------------PTV.......................................NNDG.....TNTTML...PWMFDLVLNHPIYVPKYILEYLG.L---.-DYTVEEN-..................T.TDPLFKIFDK.-------...........................................--INNSQEVVDS-..........-------..INILGRNVSC.L.IN...HD.LIS.......................................N..FIPLKSVKINHLYDLSSLIPILRNFIVLSNLYRTL--sq......................................................................................................................................................................
G3SN09_LOXAF/59-426                  .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAIMYWKA...-.TN----...........................--ASPLDKILHGSVGYLTPR...SGGHL-........................MNLKYYASPSD..LLDDKTT..--SP.....IILH-----En..................ivPRS--.-LG.....MNASVTIEGTSAMyKl........piAPl...imGSHPV--......................DNKWT-------......................................-------------PSFS.......................................SITS.....ANSVDL...PACFFLKFPQPIPVSRAFVQKLQ.NCTG.IPLFEAQP-..................T.YVPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PIPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
L0PE24_PNEJ8/38-373                  .......................................................................................................dil---IDTFKK...TQKNE....FVSPEALEALGKKEGF..ECFHD......................KY-....---ENGVTLSLGG.KI.IVIDIDLe......kfSIY..W..KV.....I......RVATTWADS......S......G-.....-G..QYF..................................................SPSTDAILLANFS.......................DSYRLN.LFETNFQRLTCLDRLSSP.........PIWDL.FSIIKSLYLSLKKIYDYELDI...Y.SD----...........................-----SEEVLCEKSGKPEFD...VANIVG........................LSLWYWKQRHH..HFVE---..----.....----------.....................-----.---.....QKSWRVIIEAQEY.D..........pTF.....sSIFSL--......................NIDWMNQKVNLS......................................NNEHEWII---------.......................................----.....TSSDLP..fSCQFVMILDPPIVMCLEDIKKIS.EIIG.LNDTSVLFK..................D.FQDSNDLIYE.TVLTSQS...........................................LPIHTKRTIYLP-..........-------..--SSLTQDQF.Y.TI...EK.STL.......................................F.pVHIVKCIPFYHPEHIHF--------------------vl......................................................................................................................................................................
T0JXZ5_COLGC/119-541                 ..........................................................................................................DSVIDILGK...A-KGR....-VSEAGLERLTLRTGL..TSIWD......................EHR...sPDGRKTKMLVIAG.QA.LTVDIVL.........-NN..N..VV.....E......NVSLTFPES......-......AP.....IV..TRH..................................................KDQAAKILLEDLQlrp................dqspLTKTLD.KFSENLERLANLDKLSVI.........PGLDC.QEALAGIFESLERL-------...FrWELSKLqedt..................amggkPARFLQTTVMCMKSGRPMMH...ARDMVG........................LSVEYWTERRH..VIPKTET..----.....----------.....................-VRYC.EKQ.....EKVWSILIGCKAL.D..........dGE......LFPPVRV......................SENWISQKVVAEpg.................................pddILAGASGIDWQEPEATSlpqtddn........................kdkgmdmvGPDG.....STQRLP...KVKFIATLAPPVIVPQSVWNNLH.SLTG.AASQPMLV-..................P.IHTFDSISFP.IPDGTNHda......................................selRVISCRRAIQV--..........--PGDGN..TISRRHKNTL.L.IY...KP.VYG.......................................Q..--TVTELSFSHPRQLVAMLPILRQYALISTLLERSF-g.......................................................................................................................................................................
A0A094H2Y2_9PEZI/129-547             ........................................................................................................mq--IVDTLKA...V-KGR....-VSEDGIERLARSVGL..ECLWE......................TGM....GRGGKSKTLIIAG.TG.LSIDIEF.........-TD..N..VV.....E......TVTLGFPES......-......PE.....SV..TRH..................................................ADEAGKILLDDLKlgk................getvLTKRVD.RFAGNLDRMARLDKLSVM.........PQLNC.HEAVTGIYDSLERL-------...HkWEVARLteee..................amsgkTQEQIVRAALLKKSGRPAMN...AHGSVG........................LCLEYWQERHA..TSQGE--..----.....----------.....................-----.--G.....CKTWSLLLECDQS.S...........SM......VYPPVRV......................SSAWISPSVVKSnpta..............................ddvlLSASDVVLDWQDPPNILlpsdpdqk......................ddsgmegieQSGQ....lPNQKFP...DVRFVAKFSPPLTLPYSAAMQIY.DSTG.AHLEPDAL-..................-.-AAFDALAFP.PQTTEPSepd.....................................gahRRIRKEQLVSVY-..........--KRTGE..HEKQCHTNTL.T.IP...KM.EYA.......................................L..--TLTEVPFSHPRELVQMLPILRQYTRLSTLLERSF-g.......................................................................................................................................................................
A7EYL3_SCLS1/111-530                 .........................................................................................................m-ACIEILKP...N-KGR....-LSEAGLERLARRVGL..ECLWE......................DSM....GGASNGRTLIIAG.NA.LALDIDF.........-AN..N..IV.....Q......KVSLSFPDA......-......PE.....SV..TKH..................................................EKTASDILLKDLQfea................gespLTKILD.RFAANLERLTMLDKLSVI.........PGLNC.HEAVAGIYCSLHKL-------...YnWELSRLrend...................mlgmGDEEIVRAAMCIRSGIPVMH...SRKRLG........................LSLDYWQEKRR..IPTKGR-..----.....----------.....................-----.EKN.....RKTWSLLVEVAPL.P...........SLv...vgVYTPLRV......................SDKWISDDIQKSdpavd...........................elfqaaQLRQGPILDWLEPDNTLlpt................................nsdnKADGl..dvGAQKFP...EAIFVAKFDPPIIVPYAIAMQIY.QST-.-QTPFDFS-..................E.ITTFDGLMFP.LSAEEALkts....................................etqaRTINIQRNVPVW-..........--DREGK..KRIEKHSNTL.F.IE...KI.DYG.......................................R..--QVEEVSFSHPRQLVEMLPCLRQFAFLSTILRKSF-a.......................................................................................................................................................................
I3NA69_ICTTR/64-425                  ....................................................................................................scfslq---------...-ITSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAIMYWKA...-.TN----...........................--AGPLDKILHGSVGYLTPR...SGGHL-........................MNMKYYASPSD..LLDDKT-..--AS....pIILHEN--NV.....................PRS--.-LG.....MNASVTIEGTSTMyKl........piAPl...imGSHPV--......................DNKWT-------......................................-------------PSFS.......................................SITS.....ANSVDL...PACFFLKFPQPIPVSRTFVQKLQ.NCTG.IPLFETQP-..................T.YVPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PIPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLVNKITFQHPGRVPLILNIIRHQVAYNTLIGSCVK........................................................................................................................................................................
R4X9B1_TAPDE/40-379                  .................................................................................................rksshgvrl---------...----R....ELTEESLRKLATSLGL..DSWAD......................EPS....---NGIRTLSITG.KI.IVVDIGI.........DTA.tS..EV.....G......TCTLVLATD......D......GL.....QE..EV-..................................................TADGRDTLQRELQ.......................-ANELD.SFARNLAVLAFLDRNSDP........aSGLNL.FYAQDLLRDALNRK-------...-.L-----...........................----ANRLGL----GERPIA...SASYLN........................FAIPYYRAAPR..GKAQSES..----.....----------.....................KVAFR.EKQ.....GHVYHARIEIETQ.Pm........saAQ......TNTDGTKpdestd..........dpilyyPKC---------......................................---------WVDSSNAW......................................lPTKQf...hSSRHRS...DLRYVVVFEPAICMPSRLALKLV.GDS-.-SSRFDAE-..................-.PVHLH----P.-------...........................................--SVRKRQVHTP-..........-------..--VGPQMINT.T.VT...--.CSE.......................................E..LLLIRRMAFSHPKELEVILADARQYAICQHVLST---lg......................................................................................................................................................................
E9E363_METAQ/120-550                 .........................................................................................................d-TILTLLSA...K-KGL....-VSEASLERLAQRIGL..ELLSE......................EQR...tPDGRKTRTLAIAG.SA.IALDIVL.........-DN..N..IV.....Q......SVSLAYHGS......-......AS.....SV..SKH..................................................MDAAGRILLKDLKllp................gqspLTKTLE.NFASNFERLASLDKLSIV.........PGLDC.HEALAGIYVSLERLYQWDLSNl.rEeQDMKAK...........................SDKYLSNMVMCSMHGRPVMH...DRDTVG........................LAIQYWRELRF..MPPVADG..---V.....----Y-----.....................--TYD.YES.....DKVWSLLLGCAPL.D...........GM......GVPPVRV......................SENWISKEITKQd...................................amIDPTKTILDWQEPDNVSlpqsedn........................kdagmdllQADL.....STTRVP...RVMFTVTFDPPVVLPQNDWARLY.MYAN.VNPPNIVNElgqr..........ghppS.PPTFDSLLFP.FPSGVKVdp......................................sesRAIVRQRLVRVL-..........--KTNRT..ESVANHNNTL.Y.IY...KP.IYS.......................................Q..--TVSEMPFSHPRQLLDMLPLLRQYAFLSTLLENSF-g.......................................................................................................................................................................
H2LWC7_ORYLA/59-430                  .........................................................................................................l-NCLETLQRalkAVSSL....SSMTDRLESIARQNML..G-S--......................---....HLSPTGTECYITS.DM.FYVEVQL.........DSN..G..QL.....V......DVKVAHQGE......-......NP.....TS..CPE..................................................-------LIQHLR.......................-EKKFE.EFSKHLKGLVDLYKLPGDn.......kLKTKM.YIALQSLELDLAKMMHMFRLA...T.-N----...........................--ANTVETILHGSVGLLTPR...SGGNL-........................VTLQCYVSPYD..IFQEG--..----.....-SGTQLNLTD.....................SNVPR.SLG.....VSVSVTIEGTSAVyKl........piAPl...itGSHPVDNkgtpa............fstvtNSNCVDL-----......................................-----------------.......................................----.....------...PACFFLKMNRPMPFSTAFIKRMS.NATL.IPVFETAP-..................S.LSPLYQLIVQ.-------...........................................-------SQLQLL..........EE--GSS..LPAPSHNMHF.Y.SI...--.LPDqqhcyflng....................napiqdshslQ..GAMVSKIPFRHPAHVPLLLDIIRHQAAYNTLIGSCVR........................................................................................................................................................................
C5DUG0_ZYGRC/13-148                  ..........................................................................................................DEMIQLFQE...YKSGS....-VTLDNITKLCQTLGL..ESFID......................DID....---AETSRLSTAS.KI.IVIDIDF.........SKS.iG..RV.....K......DVKLVLASN......F......DN.....F-..--Nyfnepvv....................................qanndsnSNEGSNILLNSLT.......................QYPDLH.QFHHNLKFLYLLDTFSSI.........-N---.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------idannn..................................................................................................................................................................
E6ZQD4_SPORE/199-409                 .....................................................................................................saldt---------...----L....GALCETLESTAKALGL..ETFAEpsada............tqapsTSA....SSSTLTHTLTLGA.KI.LVIDVELhivk.daspQDF..R..PK.....T......KLKLSYATD......S......AD.....SH..QAR..................................................DPRLGAVLERDVQliadklfgk....ssslqqdraiVAQALA.NWTSNLHELLVLDDLEAKageagagaaRPTDL.FAAMQELSAAAVRIADAEASS...S.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------aseaalldrghglhklhdtrpflqs...............................................................................................................................................
E1BUI5_CHICK/60-427                  .........................................................................................................v-SCLETLQKa.lKVSSL....PAMTDRLESIARQNGL..G-S--......................---....HLSANGTECYITS.DM.FYVEVQL.........DPT..G..LL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQHLR.......................-EKNFD.EFSKHLRGLVNLYKLPGDn.......kLKTKM.YLALQSLELDLSKMAGMYWQA...-.TN----...........................---------------ANPLDk.iLHGSVGyltpr..............sggllMNLKYYVSPYD..LFEDGT-..----.....--GAPVILHE.....................SNVPR.SLG.....MNVSVTIEGTMAMyKl........piAPl...imGSHPVDS......................------------......................................----------KGTPSFS.......................................SITS.....ANSVDL...PACFFLKFPRPIPVSRAFIQKLQ.GCTG.IPLFDTAP-..................T.FVPLYELITQ.-------...........................................---------FEL-..........--SKEAD..PIPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLISKIAFQHPGRVPIILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
A0A0M0UMK6_9PEZI/115-536             .........................................................................................................d-DVISVLSR...S-RGL....-VSEAGLERLAKKLEL..EFIWE......................TSM....-GSNEKRTLIVAG.SA.LELIIEF.........-SN..N..IV.....Q......SVSLSFPES......-......AE.....IV..NKH..................................................AKSAGEILFKDLQlge................nqspLTKSLE.SFAANFARLATLDKLSTN.........PGLNL.YEAVAGIYESLNRL-------...HlWELQKVreda..................slsgkSDAYLENLVICTKSGKPAMN...ARRRVG........................MSFEYWRESRL..WPSPSP-..EVAA.....----------.....................---WA.AEH.....KRIWGMLIDCTVP.L..........vDV......GVSPVRI......................SDKWVGADVEKQph.................................pdeMHTGGSIIDWLEPESTFipppdql.........................kvetmqnE--Pp...lLGPRLP...EVVFRATLDPPVHLPLTLWQQIQ.QLGC.GVGDAAFS-..................-.GTSFDGLVIP.FPPGKTFdp......................................aepRIVTCNKKTLFV-..........-TPGESK..VSLRNHANTL.H.VD...KV.VWS.......................................R..--TLAELTFSHPQQLVSMLPYLRQYVFLATLLENSFK........................................................................................................................................................................
B2VSA9_PYRTR/88-536                  .........................................................................................................r-EIIDIIGK...K-PGR....-VSEEGLLALCKRLGI..P--YE......................KHM....-DEAGTWSLLIG-.DE.ALCDITF.........-KD..D..EI.....A......SVNLQTGLD......D......SR.....PD..LNF..................................................GASGSEILVRSLRplp................gqskLNITLE.RFSESLEKLLTLDKLGSPq.......nGGVSC.YNAIAGVYTSLRKLFEHEKSV...ElAN---Rapd.....................erfRTYKAEREVLCKKSGRPRLN...GGSCLG........................LSLEYWMDRRK..VISKSTQ..ELSDkgkekMGT------Dska..............sssyPEDVV.GSD.....NHLYSLTIECESS.P...........ST......LYTPIRI......................SNDWISDQIEKAtdhnd...........................attldsMLLNTSSINWLDPKPTYleape............................qsddamNLDS.....AAGRLP...NIRFVAKFNPPLVVPLAIYMQLH.QLVG.IEPRTDEF-..................R.PTTFVGLALR.PGTV--Dpgm....................................ssttGESTHVITSSRLV.........gVVDSAGK..YAEKWHKTSL.Y.VP...KL.EYS.......................................R..--TLESLPFSHPKQLVEILPILRQYAHATTLLRDSF-y.......................................................................................................................................................................
M2TK74_COCH5/92-540                  .........................................................................................................r-EIIDIVGK...K-PGR....-VSEEGLLALCDRIGI..S--YE......................KHM....-DDAGTWSLLIGD.E-.ALCDVTF.........-KN..D..EI.....V......SVNLQTGLD......D......SR.....PD..LNF..................................................GAAGSEILVRSLKplp................gqskFNVTLE.RFSENLEKLLALDKLGSSq.......nGGISC.YNAIAGIYTSLRKLFDHEKKL...E.--LAKRapd.....................eryRIYKAEREVLCKKSGRPRFN...GGSCLG........................LSLEYWMDSRW..VIPKTAP..EVQDk..gkEKMDANS--Qes................psyPEDDY.WSN.....NKMYSLTIECEAS.P...........SA......LYTPIRI......................SNEWISDQVEKSmdnnd...........................ashlenMLMNTSSIDWLEPKPTYleape............................qtddamNLDS.....AAGRLP...NVRFVAKFNPPLVVPYAVHMQLY.QTVG.IEPRNDDL-..................R.PTTFVGLALR.PGEV--Dpgmsg................................atgestHEIRSSHLALS--..........-KDINGN..YEQHRHNMSL.Y.VP...KL.EYS.......................................R..--TLESLPFSHPKQLVEILPVLRQYAHVTTLLRKSF-y.......................................................................................................................................................................
W9VWF0_9EURO/135-551                 ........................................................................................................ql--VVETLKR...GVGGH....GVTREGVERIAQLQGF..TTLWD......................DDN....--------LTIAG.NC.VDLEVNF.........EAGgrD..TV.....R......DVSLKLNIS......E......TA.....TE..SEEp...............................................qfQEQGTQVIKDNLRsvav..............vggvsQWRRLD.AFASNLQYLSQLDRIE--.........TGSPC.FNAVGNLYHTFRQI-------...-.WDAEKAr.........................fQGRSPRQHLRQSAVGRPVMD...RKPKLG........................LALDYWASSQR..PGQLPDA..AG--.....----------.....................-RDEV.DEG.....AHLYTAYISCEA-.-...........--......GLPSTAI......................MEKWLSDGVLVEdtn...............................smlkSDGVKPRPDWRMPAHDPeellakp........................dndgtameKPTD.....IPPNIL...DLHFYCDLGPEVYLPLNVAASLNvEITM.VNIDQE---..................S.TLTYQAALHK.QAHAKDVhgn.....................................gsaSAERWSRCLPLP-..........--DATNP..DCQRKHSYAL.H.SA...QS.ATA.......................................L.wCFPVRHLNFTHPKQIAAALPVLRQYVALWRMLQSLV-e.......................................................................................................................................................................
J8Q127_SACAR/12-300                  ........................................................................................................dc--MIELFKD...YKPGS....-ITLENITRLCQTLGL..ESFTE......................ELS....---DELSRLSTAS.KI.IVIDVDY........nKKQ..D..RI.....Q......DVKLVLASN......F......DN.....F-..--Dyfn...........................................qqdgKQEKSNILLNSLT.......................KYPDLK.AFHNNLKFLYLLDAYSHI.........ESDSG.SHNNTSSDKSLDSS-------...-.------...........................---------------NASLN...NQGKLD........................L-FKYFTELSH..YIRQYFQ.dNSLD....fKVRTNLNDKFgiyiltqdangqeiplakvylDENKK.DSQ.....CRLYEYIYSQET-.K...........SW......INESAEN......................FSNGISLV----......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------meitpnteiddstgliwfpedfilpeliiekasnlsdspssppii...........................................................................................................................
MED1_HUMAN/59-426                    .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAIMYWKA...-.TN----...........................--AGPLDKILHGSVGYLTPR...SGGHL-........................MNLKYYVSPSD..LLDDKT-..--AS....pIILHENNVS-.....................----R.SLG.....MNASVTIEGTSAVyKl........piAPl...imGSHPV--......................DNKWT-------......................................-------------PSFS.......................................SITS.....ANSVDL...PACFFLKFPQPIPVSRAFVQKLQ.NCTG.IPLFETQP-..................T.YAPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PIPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
C4R1P3_PICPG/171-433                 .......................................................................................................sgn---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------DELSHE.........RKYDL.FNYMHILSFNLHRVYEYQVSH..lDeLD--YKspfl...................sdrnDISCFVREGL-GGIGKVELN...VGGRCG........................VFLKFWEDHRF..VTQQLKQ..-RV-.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------pndeihndnfllhfkikevdneyciknidtrivykekwfeegrwlvdsgkndndivkfsvtlvaellptvwvpydllykwniddideaepdvknnrldalfdhfnkfhhkrkyrlnekgdqkleismmspcrfvklhklshrveqiqsivddlrtwcvissfirnvls
I3KH72_ORENI/57-427                  .........................................................................................................l-NCLETLQRa.lKVSSL....PSMTDRLESIARQNML..G-S--......................---....HLSPSGTECYITM.DM.FYVEVQL.........DTS..G..QL.....V......DVKVAHQGE......-......SP.....TS..CPE..................................................-------LFQHLR.......................-EKNFE.EFSKHLKGLVDLYKLPGDn.......kLKTKM.YIALQSLELDLTKMMHMFRLA...T.-N----...........................--ANTVETILHGSVGLLTAR...SGGHL-........................VSLQCYVSPYD..IFEEGT-..----.....--GTQLNLMD.....................NNVPR.SLG.....VSVSVTIEGTSSVyKl........piAPl...itGSHPVDNkgtps............fstvtNSNCVDL-----......................................-----------------.......................................----.....------...PACFFLKMNQPMPFSLSFIQRMG.NATS.IPVFETPP-..................T.LSPLYQLIVQ.-------...........................................-------SQLQRL..........--EEGSS..PPPPPHNMHF.Y.SV...--.LPDqqhcyflng....................dapvqdgrslQ..GALVSKIPFRHPAQVPFLLDIIRHQAAYNTLIGSCVK........................................................................................................................................................................
A0A094ANP6_9PEZI/125-543             ........................................................................................................vq--IVDTLKA...V-KGR....-VSEDGIERLARSVGL..ECLWE......................TGM....GRGGKSKTLIIAG.TG.LSIDIEF.........-TD..N..VV.....E......TVTLGFPES......-......PE.....SV..TRH..................................................ADQAGRILLDDLKlgk................getvLTKRVD.RFAGNLDRMARLDKLSVM.........PQLNC.HEAVAGIYDSLERL-------...YkWEVARLteee..................amsgkTQEQISRAALLKKSGRPAMN...AHGSVG........................LCLEYWQERHA..TPQGE--..----.....----------.....................-----.--G.....CKTWSLLLECDQS.S...........SM......VYPPVRV......................SSAWISPSVVKSnpta..............................ddvlLSASDVVLDWQDPPNILlpsdpdqk......................ddsgmegieQSGQ....lPNQKFP...DVRFVAKFSPPLTLPYSAAMQIY.DSTG.AHLEPDAL-..................-.-AAFDALAFP.PVTAEPSepd.....................................gahRRIRKEQLVSVY-..........--NRAGE..HEKQRHTNTL.T.IP...KM.EYA.......................................L..--TLAEVPFSHPRELVQMLPILRQFTRLSTLLERSF-g.......................................................................................................................................................................
B7PD89_IXOSC/76-180                  .............................................................................................adrnrlqkcldti---------...-----....----------------..-----......................--QklifTTGPDGQECFISS.DM.FYVEVLL.........ETS..G..EV.....K......DVKIAHHGD......-......-P.....VS..CPE..................................................-------LTQVLL.......................-KGDFA.EFTSHLEGLASIYQLNA-.........DNLPS.FAALSNLN-------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------st......................................................................................................................................................................
A0A074YXT7_9PEZI/145-600             ..............................................................................................tvlttllgrqkq---------...RRFGR....-VSEEGVRRVGRWVGL..DVEVE......................AKRe..aRKFEGNRPVAVAGkNN.VLIDFQF.........-KD..N..LP.....T......HVDLSFSSQ......-......ND.....AV..TAH..................................................QSAAASVLLEDLTppp................avsaINTNLD.KFAANLETLARLDKLSVY.........DQLNC.TEAITGVYESLKTLYEHEKQA..aQtMA-TAKr........................gdPALRAERHVMCKRSGRPQMH...ARRRIG........................LSLDYWMDKSN..IYPSNPA..TTSA.....-KKDESAMGIdt.................ktPDKPV.KEA....dETIFALEITVEA-.S...........TP.....dPYSSLRV......................SFSWIANRILKSaeet.............................tdptdLLSGTQSIDWLEPAPTYlsdnnqn........................tsdvmaidNNTN....pGAQKLP...AVRFVAKLNPPLAMPWTAASAIL.QSVGaGTLMSEIPD..................L.QRTYEGALLD.-----KTfdipll..............................nrpvvqpSGPSTSTTINVL-..........--APDGK..HV--EHKNAL.Y.VP...KQ.DFG.......................................Y..--VLTSIPFAHPRQVVALLPVLRQWASLGSLLRGTF-........................................................................................................................................................................
A0A074XQG0_9PEZI/152-596             ................................................................................................sllgprhnrr---------...--FGR....-VSEEGLRRVGRWAGL..DVEVE......................AKRe..aRKFEGNRPVAVAGkNN.VLIDFQF.........-KN..N..LP.....T......HIDLSFSSQ......-......DQ.....AV..TAH..................................................QAAAASVLLDDLTplp................gtsaINTKLD.RFAANLETLARLDKLSVY.........DQLNC.FEAITGVYESLKKLYEHEKQA..aR.TIVQAKr........................gnAELRAERHVLCKRSGRPQMH...ARRKIG........................LSLDYWMEKSN..MYPSDYS..DASA.....MDIDPKPSDT.....................PRK--.ESG.....DTIFALDITAEA-.G...........TP.....dAYSSIRV......................SSSWIADRIFKSaeet.............................tdptdLLSGTQSIDWQDPAPTLlsdsnqnn.......................ndamaidsNPNT.....GAQKLP...AVRFVARLNPPLAMPWTAAAAIL.QSVG.AADVLSAMP.................dV.QRTYEGSLLQ.KPSDVPLlnkp..................................lqscgPAASTTTSVLTP-..........----DG-..-ASVQHENAL.Y.VP...RQ.DFG.......................................H..--VLTSIPFAHPRQVVALLPVLRQWAYLGSLLKGT--f.......................................................................................................................................................................
H2AYU2_KAZAF/11-289                  .........................................................................................................g-EIVELFKE...YKPGS....-ITLDNITKLCQTLGL..ESFTE......................EID....---SEVSRLSTAS.KI.IVIDIDF........nNNE..E..RV.....K......DVKLVLASS......F......DDf..dyFN..ARN..................................................NEASKNILYNSLT.......................QYPDLK.EFHHNLQFLCLLDAFSR-.........TEIDAtHSNSNNTSGHLETS-------...-.------...........................---------TSSSNNTNTNT...ASGTID........................L-FRYFTELSG..CIKQYFE..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------dsslnlniatnlnnrfgiyildsdnetilakigfekaldpkqrlyeyvysketkcwingspknyttgvklvmelnehnkskvgdsvdsffpkdyipsevilafek...............................................................
H2U0Q5_TAKRU/59-429                  .........................................................................................................h-SCLENLQRa.mKVSSL....SAMTDRLESIARQNML..G-S--......................---....HLSPSGTECYITS.DM.FYVEVQL.........DNG..G..QL.....V......DVKVAHQGE......-......NP.....TS..CLE..................................................-------LIQHLR.......................-EKNFD.EFSKHLKGLVELYKLPGDn.......kLKTKM.YIALQSLELDLTKMMHMYRLA..tS.------...........................-ANTL-ETLLHGSVGLLSAR...SGGHL-........................VSLHCYLSPYD..LLEERTC..--AP.....--LNLTDNNV.....................PRS--.-LG.....VSVSVTIEGTSAVyKl........piAPl...itGSHPVDNkgtps............fstvtNSNCVDL-----......................................-----------------.......................................----.....------...PACFFLKLNRPMPFSVAFIQRMG.NATS.IPVFESPP-..................T.LSPLYQLIVQ.-------...........................................-------SELRL-..........QEDGSVT..PP-CPHNMTF.Y.SV...--.LPGqlhcyflng....................dapvqdgqslQ..GAIVSKIPFRHPAQVPLLLDIVRHQAAYNSLISSCVK........................................................................................................................................................................
A0A084FU74_9PEZI/120-538             ........................................................................................................da--IIGILSQ...K-KGY....-VSEEGLERLVQRIGL..DCIWD......................TYT...aPGGQKMKMLVIAG.KA.LQLDISI.........-DN..N..IV.....R......NVALSFPLS......-......AP.....IV..IER..................................................VGRATAILMRDLElrp................gqnpLTKKLD.DFYANLSRLADLDKLSVI.........PGLDL.QEALAGMCSSLERI-------...HhYDLEKLrae....................hagkGERYVHNMVTCHRHGYPVMH...ARNRVG........................LNLDYWIQRHC..VPPKNT-..--QA.....----------.....................-EKFV.EQN.....EGVWSLLITCAPM.G...........EM......IYPPVRI......................SESWISPKIEKEdpsa..............................edvlSATTGPALDWLEPENTVipp................................peenK-DSs..vdMSLKYP...EVIFKALLEPSVILPQPVWLQMY.ELVG.AQPPPLYA-..................-.YPTFDSLYFP.IPPSTEAhdp.....................................sapRTIEYQREIVCV-..........--SKEGQ..TSTKKHKNTL.Y.IY...KP.VYG.......................................Q..--TLSELPFSHPKQLISLLPNLRQYALLSTLLRRSF-g.......................................................................................................................................................................
R0KRI9_SETT2/92-540                  .........................................................................................................r-EIIDIVGK...K-PGR....-VSEEGLLALCDRMGI..P--YE......................KHM....-DEAGTWSLLIG-.DE.ALCDVTF.........-KN..D..EI.....A......SVNLQTGLD......D......SR.....PD..LNF..................................................GATGSEILVRSLKplp................gqskLNVTLE.RFSESLEKLLTLDKLGSSq.......nGGVSC.YNAIAGIYTSLRKLFEHEKKI...E.--LAKRapd.....................eryRTHKAEREVMCKKSGRPRFN...GGSCLG........................LSLEYWMDARW..VIPKTTP..EA--.....LDKGKDKMDAnspd.............aasyPEDDY.WTN.....NKMYSLTIECEAS.P...........SA......LYTPIRI......................SNEWISDQIEKTadnhd...........................adhlnnMLMNTSSIDWLEPKPTYleape............................qtddamNLDS.....AAGRLP...NARFVAKFNPPLVVPYAVHMQLH.QTVG.LEPRNDDL-..................R.PTTFVGLALR.PGEV--Dpgmsg................................ttgentHEIRSSHVVLSK-..........--DLEGN..HTEKHHSMSL.Y.VP...KL.EYS.......................................R..--TLESLPFSHPKQLVEILPVLRQYAHATTLLRNSF-y.......................................................................................................................................................................
A0A0D2WX50_CAPO3/213-556             .............................................................................................hlddppmpindpw---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------MLHLLQ.......................-QRHFD.EFGRQLARLAVLDNSSAFsq.....prEKSNM.AKLLRQLTTDLHTVEAAEMAA...A.------...........................-QKNLHQVVQ-KGHGLLAPR...SGARL-........................LGTTFFASHET..YARVEAM.vARLEri.pgL---SANTDE.....................-----.-AR.....KLARALSIPAVAV.Dqll.....vlrAS.....dQTPDV-Lrrellfklgf.slqvdieraslQSVNIQPTVAKA......................................GDEFSLVANKISRGLTTivp.................................spyESDE.....VSHASV...PGTLAATLNWHIPVCVSVLQELE.TNVL.GKSANIT-Evs..............snG.SVSVEQLVLD.-------...........................................-------TLQSS-..........GMFSEHL..RV-GDSNYLF.S.IP...LD.-QG.......................................T.pAVLVSRFPIVNIAQLHAVEQAFRQQIVFNQLLASC--aa......................................................................................................................................................................
MED1_MOUSE/59-426                    .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQQLR.......................-EKNFE.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAIMYWKA...-.TN----...........................--AAPLDKILHGSVGYLTPR...SGGHL-........................MNMKYYASPSD..LLDDKT-..--AS....pIILHEK--NV.....................PRS--.-LG.....MNASVTIEGTSAMyKl........piAPl...imGSHPA--......................DNKWT-------......................................-------------PSFS.......................................AVTS.....ANSVDL...PACFFLKFPQPIPVSKAFVQKLQ.NCTG.IPLFETPP-..................T.YLPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PLPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgqslQ..GTLVSKITFQHPGRVPLILNMIRHQVAYNTLIGSCVK........................................................................................................................................................................
A0A096LU77_POEFO/59-429              .........................................................................................................l-NCLETLQRa.lKVSSL....PSMTDRLESIARQNML..G-S--......................---....HLSTTKTECYITS.DM.FYVEVQL.........DTG..G..QL.....V......DVKVAHQGE......-......NP.....TS..CSE..................................................-------LIQHLS.......................-EKNFE.AFSKHLKGLVDLYRLPGDn.......kLKTKM.YIALQSLELDLTKMMTMFRLA...-.TN----...........................--ANTVETILHGSVGWLTPR...SGGNL-........................VSLQCYVSPYD..IFEVETG..---S.....-QLSLPDNNV.....................PRS--.--L....gVSVSVTIEGTSAVyKl........piAPl...itGSHPVDNkgtps............fstvsN-----------......................................-----------------.......................................----.....SNSVDL...PACFFLKMNRPMPFSLSFIQRLG.SATS.IPVFETPP-..................P.LSLLYQLIVQ.-------...........................................-------SQLQLL..........EE--GSA..TPATLNNMHF.Y.SI...--.LPDqhhcyflng....................dapvqdghslQ..GAMVSKIPFRHPAHVPLLLDIIRHQAAYNTLIGSCVK........................................................................................................................................................................
W5N508_LEPOC/91-460                  .........................................................................................................l-TCLETLQRa.lKVSSL....PAMTDRLESIARQNGL..G-S--......................---....HLSPSGTECYITS.DM.FYVEVQL.........DSG..G..QL.....V......DVKVAHHGE......-......NP.....AS..CPE..................................................-------LVQHLR.......................-ERNFE.EFSKHLKGLVNLYKLPGDn.......kLKTKM.YLALQSLEMDLTKMMHMFRLA...T.-N----...........................--ANTVETILHGSVGLVTAR...SGGHL-........................VTLQCYVSPYD..VFEEE--..----.....-TGALLNLTD.....................SNVPR.NLG.....VGVSVTIEGTSSVyKl........piAPl...itGTHPVDNkgtps............fssvtNSNCVDL-----......................................-----------------.......................................----.....------...PACFFLKLRRPLPFSLSFIHRMG.NATG.IPLFETAP-..................P.LAPLYELITQ.-------...........................................-------SQLQE-..........--EGGGA..LPPLAHNMRF.Y.AS...--.LPGqqhcyflnr....................dapvqdgrclQ..GALVTKVPFRHPAQVPALLDIIRHQAAYNTLIGSCVK........................................................................................................................................................................
T1KY15_TETUR/35-398                  ..........................................................................................................QKCLDIIQKs.iKITSL....QSMMERLEAITRQLGL..K-Y--......................---....TEGPSGKELFISS.DM.FYVEIQF.........NPD.nG..RV.....K......EVKISHQSE......-......-P.....VS..CPE..................................................-------ITDVLN.......................-NSDFQ.EFTKHLDGLSAIYQLNADk.......kQKTKA.YLALHALESDLSMLAQLQSSN..iN.-E----...........................---------------PNNLV...HKSPVGilepr..............kgghpMKLTFFISPYD..LLDLKTK..SSVP.....LTVDVVV---.....................KRK--.--L....gYSASVCIESSTSH.K...........LQ......TVSLLSV......................TKTAEGK-----......................................-----------SLPQFA.......................................ALSN.....LNSSTL...PACFVLRLPKQLPMSIETLRKIQ.AITG.IEIVSAEIM.................sR.SVPLVDLIAN.SLLPASE...........................................-----LRDLSSY-..........HGPYYVQ..LPDQCHSYYM.N.YT...--.LGD.......................................L.kGVEVSSIPFTHPTSVPQILFILRQQVLFNVVICSCIR........................................................................................................................................................................
A7TRW6_VANPO/11-428                  .........................................................................................................d-TIIRLFQE...YKPGS....-ITLDNITKLCQTLGL..ESFID......................DID....---SHLSRLSTAS.KI.IVVDIDF........nKIE..G..KV.....V......DVKLVLASN......F......DN.....FNyfNDE..................................................NGKGDNILLNSLT.......................QYSTLR.EFHHNLQYIYLLDTYSQ-.........IDSDP.SNSNNGTANSTGANST-----...GlLNVDGN...........................TSAATPAISV-----SASTT...GNGKLD........................L-FKYYTELSE..FMKNYFQ.aNCID.....LKIETNSGNIfgi..............yivsP----.DDN.....CKLAKIYLEKSKD.Ps.........hKL.....fEYVFSDD......................TKCWINENAENY......................................TTGVSLVMEIIDSDDSNiwfpkefispeliceqdk...nsrngfsndlnkennldaNK-N....nILSLFP...NNISEFSYNERVQVINDFTTDLI.NISK.FNIGNDNLDlil...........eiinW.IKWYKIVLTK.IYDTLSHtdnnsgi.............................fnskngfQ------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------ndninnksmnienntesnningrrrsssi...........................................................................................................................................
I3MZX3_ICTTR/63-424                  ....................................................................................................scfslq---------...-ITSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAIMYWKA...-.TN----...........................--AGPLDKILHGSVGYLTPR...SGGHL-........................MNMKYYASPSD..LLDDKT-..--AS....pIILHEN--NV.....................PRS--.-LG.....MNASVTIEGTSTMyKl........piAPl...imGSHPV--......................DNKWT-------......................................-------------PSFS.......................................SITS.....ANSVDL...PACFFLKFPQPIPVSRTFVQKLQ.NCTG.IPLFETQP-..................T.YVPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PIPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLVNKITFQHPGRVPLILNIIRHQVAYNTLIGSCVK........................................................................................................................................................................
E9J4L2_SOLIN/1-209                   .................................................................................................lgilerrkg---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------------.........-----.---------------------...-.------...........................--------------------...-----Gh......................pMKLTYFVSPYD..LIDEENR..---T.....-----YDTLN.....................PDTII.KRKi...gHSVTVCMEGSTGH.K...........LP......TSSIITV......................NRSPTGK-----......................................-----------STPSYA.......................................PLTS.....TNSSML...PACFVLKLGKKMPICMELVKRIQ.KVTE.LECGDISA-..................-.PHPMLSLIIQ.-------...........................................-------HASDGQl........dCRNNRGL..YVTLPDQQHC.Y.FM...TE.NKN.......................................M.eGVLVCSIPFTHPAHVPQILVYLRQQALFNCLIASCVR........................................................................................................................................................................
L8GFY0_ACACA/139-458                 ....................................................................................................grqqlf---------...-----....---VRNLQSVAEAHGL..QLYAF......................DPSemgmEVATKTLSASISG.QH.FLVDVHV.........TLQ..G..HV.....D......KVNVTFTST......A......GD.....PS..GEGeqp............................................qfsRPEVDEEITKLLR.......................-EGDLK.RFDEVVRLLNELDVIYTE........nPTTDL.KQALWILEDDLFEL-------...H.-RREREit.......................ggD----DGALLRDRHGAPMWQ...PE---G........................LFLHYHASPRH..LLLDKLS.gK---.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------rlahthgalvtlregrtlvklpmashlpglpplddqslppglaiepieialdggrihfdlhlrpavpiltdtlrrmldlvwgphpptdgarhskdhqpfvslqtllcpsagarfehhgvsyvysgqeergtv....................................
N4V1B0_COLOR/121-545                 .........................................................................................................d-AVIDILSK...A-KGR....-VSEAGLERLTLRTGL..TSMWD......................EHR...sPDGRKTKMLVMAG.NA.LGLDIFL.........-NN..N..IV.....E......NVSLSFPES......-......AP.....IV..TRH..................................................KDQASKILLKDLQlrp................dqspLTKTLD.KFAANLERLASLDRLSII.........PGLDC.QEALAGIYDSLDRL-------...HkWELSKLreep..................smsgkPERFLATTVMCTKSGRPAMH...ARDLVG........................LSVEYWTERRH..VVPKTPD..----.....----------.....................TGRFC.ERL.....EKVWSILVGCKAL.D...........GE......MFPPVRV......................SDNWISQKVVVEsg.................................pddILPGGMALDWQEPEAVNlpqtddn........................kdkgvdvvHPDG.....TTHKIP...NVKFVATLTPPVIVPQSVWNTLH.SLTG.AAAQPMLL-..................P.SYTFDSISFP.IADGSHHda......................................selRVITCKRALSIP-..........-SGDDGD..AKLRNHKNTL.L.IY...KP.VYG.......................................Q..--TVTELSFSHPRQLVDVLPILRQYALISTLLARSF-g.......................................................................................................................................................................
Q2UUL5_ASPOR/134-549                 .........................................................................................................e-DVVQLLRT...RVAGR....GVCREGIERLGQLEGF..ESIWQ......................EDS....--------LSIAG.NF.VDLEIEF........yRAQ..N..TV.....K......DVSLNIATP......-......EA.....TD..GER..................................................-REATAVLKRDLIespe..............dggrsSWKTLT.KFHENLQWLAKHDRLS--.........QEVNC.FEAIEGLYESLKRI-------...-.WDEEGHh........................rkFSGIHDHLCS-GWVGQPCLH...QGGRVG........................LNLEYWVHQAR..VLDSKQK..KVSPd...dMAIDQPSVSS.....................MGGES.GNH.....NGKWNIIIECEE-.-...........--......GYPSLRV......................SKEWVNSEVFTVvnnnan.........................epssnemGGSDVAVVNWADPPATLssqg..............................qqdamALDS....gMLGTAP...NRRFVARMEPPLELPILAASDIY.RHLG.IQMPQEFK-..................-.MVTYDGLLAP.GWSPLSAagamglg.............................peeasqlGRRRRRMAVQSV-..........--DQDGK..PCTKQHSYTF.Q.PF...ES.VAG.......................................R..--TMRDIPFAHPRQLADILP-----------------q.......................................................................................................................................................................
W5L7S1_ASTMX/16-385                  .........................................................................................................l-SCLETLQKa.lKVSSL....ASMTDRLESIARQNML..G-S--......................---....HLSPSETECYITS.DM.FYVEVQL.........DSS..G..QL.....V......DVKVAHHGE......-......NP.....AS..CPE..................................................-------LIQHLR.......................-EKNFD.EFSKHLKGLVNLYKLPGDn.......kLKTKM.YLALQSIEMDLTKMMHMFRLA...T.------...........................-SANTVETILHGSVGLLTLR...SGGNL-........................LSLQCYVSPYD..IFEEGS-..----.....--GTQLSFT-.....................-DSNI.PHSl...gVSVSVTVEGTSAVyKl........piAPl...imGSHPVDNkgtpt............fspvtNSNCVDL-----......................................-----------------.......................................----.....------...PACFFLKMNCPMPFSLSFIQKMG.NVTG.ISVFESAP-..................T.LSSLYDLIIK.-------...........................................-------SQLGE-..........--EEGAS..PPASGRSMRF.Y.AA...--.LPGqqhcyflng....................dapvqdgrslQ..GALVSKIPFRHPAHVPPLLEIIRHQAAYNTLIGSCVK........................................................................................................................................................................
F0U606_AJEC8/132-559                 ..........................................................................................................EEVIRLLRT...RVSGR....GICREGVERLGKFEGF..ECMWQ......................ENI....--------LSIAG.NL.VDLEIQF.........EDG.sE..NV.....K......DVSLKYTTP......-......SV.....VE..GER..................................................RVEATAVLKRDLMqtvg..............kneeiPWKSLD.AFHSNLHRLTKLDRLS--.........REINC.FEAVEGLYKSLNRL-------...-.WEGELSr........................ypGRGHCEHVCT-SQVGHPGIH...QDGRIG........................LSLQYWVERRQ..TLDSNGN.gRLNA.....MNIDQPTPDD.....................RKPAP.AKI.....HKTWRATIECEE-.-...........--......GYPSLRV......................SKEWIAAELFTTmnnges..........................slaadgNDSEILLVNWIDPPATLvsnp..............................ndiplDSTA.....LGTTTP...NRRFVARLEPPIDMPIIAAAEVY.RLLG.MNMPVEPK-..................-.TVTYDGLVVP.LPNLASTgdgqdd...............................nslaasNGRIHEKVVYSF-..........--DDDCQ..PRKHRHIYTF.H.PF...EH.IVG.......................................R..--TIRDLPFSHPRQLADVLPILRQYALLSSLLHRVF-v.......................................................................................................................................................................
H0YUE5_TAEGU/47-400                  ........................................................................................................ls--CMEKIERt.lNAKSM....FSVMNILELVARQKGL..T-V--......................---....HVSPSGTACYITS.MM.FYLEIQL.........EKD..G..DV.....M......DVKLAHFEE......-......AP.....VV..CDD..................................................-------LVQLLR.......................-MKNYD.AFGKILEDLSNMYQIPGNs.......eMKAKG.YLALQALEKDLYSMSLLDRTQ...D.LN----...........................----RVTEV-----------...LNGKVGhlvpr..............tggtpMNIEFYISPYQ..VLEAELS..HGSE.....----------.....................-----.V-C....gTKTVVTVEGTDML.H...........KL......PLSPLII......................EPQTGED-----......................................-----------SNPSFL.......................................QLTD.....ELSMDL...PAHFVLKFHQPVPMSSSSIEEIQ.KLTG.IQISGL---..................K.LAPLYELIVQ.-------...........................................-------STLKE-..........----KCS..EDLSTNKCCF.F.VS...--.LPDcskhcyfi.......................nkgsekpgL.aGALVSKIPFSHPKCVPGVIEILRHQVAYNTLISSCV-s.......................................................................................................................................................................
G8ZSA3_TORDC/11-270                  ..........................................................................................................DDMIQLFQD...YKSGS....-VKLDNITKLCQTLGL..ESFID......................DIN....---SEISRLSTAS.KI.IVIDIDF........dRNQ..G..KV.....A......DVKLVLASN......F......DN.....F-..--Nyfid..........................................qpesAATSNNIVLNSLA.......................LYPDLH.EFHHNLKYLYLLDTYSN-.........IDIDT.SNTTNNGSTNGNTSGAINND-...-.------...........................-------------NG-NNNS...YSGKLD........................L-FKYYTELAH..FIKHYFT.aNSAP.....FKVQT-----.....................-----.-NL.....NNRFGIYISTVNG.-...........--......-DKPLAKiylekaddpq.qrlyefifsesNGDWVNESAENY......................................TYGVSLVLELLED----.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------nlsswfp.................................................................................................................................................................
X0JKF1_FUSOX/118-539                 .........................................................................................................e-TIIATLDQ...K-KGL....-VSEAGLERLAQRIGL..DCLSE......................DHT...aPDGRKQRTLVIAG.SA.IQLEITL.........-HN..N..IV.....E......NISLAFPES......-......AR.....SV..TDH..................................................VTRASEILLRDLQllp................nqspLTKTLD.KFAVNLERLAVLDKLSII.........PGLDC.HEALAGIYVSLERL-------...HkWDVARLrdep..................gmggkPDSELSTMAMCTRHGYPVMH...SKDRVG........................LALQYWKALRL..VQPTNTK..-MAS.....----------.....................---FT.SSH.....EPVWSLLIGCAST.G...........GM......GHMPVRV......................SEDWISKDVVKAe...................................psMDPKRPNLDWQEPDNVVlphseen........................kdasmemlQPDL.....STARVP...QVMFVATFDPPVILPQNDWLRLH.SYAN.VNANPLFG-..................Y.SPTFDSLFFP.IPPGSAQdp......................................selRAISRSRDVRIY-..........--DKDQK..AIIKPHQNTL.Y.IY...KQ.IYS.......................................Q..--VVTEIPFSHPQQLIEMLPLLRQYAFVATLLENSF-g.......................................................................................................................................................................
A0A084WB85_ANOSI/138-509             ..........................................................................................................QKTLDSMQYc.iKVTTR....QGLVERLDCLTRQLGL..KLS--......................---....---EDTSGLFISS.DM.FYLEIIL.........DPA.gG..TV.....Q......DVKVHHECK......M......KQ.....QS..CSE..................................................-------LVACLQ.......................-RGDFA.DFTTQLEGLASIYQLNAEk.......kIKVNA.FVALQALETDLHTLYTLSAQR...Y.------...........................--PDVHSLLL----------...-KSPLGvvqkr..............rgghpMRLTYFVAPYD..LLDLDTR..---T.....----MNVLSA.....................--ELI.AKEr..igCSVAVVLEAASAN.Kl........qiQPl....lVVNPSTG......................SSAATNT-----......................................-------------TPVY......................................tPIEK.....HNSTSL...PATFVLRLSKPMPINAAMMRTIR.GIVA.GGT----GGggppveg....gatpgerV.PSSLLALIAH.HASGG--...........................................-------FVTD--..........--LSRGL..QVTLPDQYHC.Y.YL...TD.NPA.......................................L.qGVMVSSIPFTEPQHVPKILTLLRQAAVFNQLLASCIR........................................................................................................................................................................
G3JR60_CORMM/127-547                 ..........................................................................................................ENMIRMFNE...K-KGM....-VSEAGIGRLAQRLGM..EILAE......................ENS...tPGGRKTKTLAIAG.SA.IALDIVL.........-DN..N..IV.....Q......NATLSYHGN......-......AD.....SV..TKH..................................................IDAASQILMKDLQlfp................gqspLTKTLE.RFAMNFERLATLDKLSIV.........PGLDC.HEALASMYSSLERL-------...YdWDVEQLrrgg..................gmagkPDALLASAAMCTRHGKPVMH...ERGQVG........................LALQYWKEKRF..VAPPPVQ..----.....----------.....................---ND.NNK.....SKVWSMLLGCAAI.D...........GV......GLLPARV......................SENWISKDIIKQdd..................................mmGTLTSPILDWQEPEHVSlpqtden........................kdasmdllQDDL.....STTRVP...RVMFTATFDPPVILPQTEWARLY.ALAG.VEPPNDFNR..................Q.PPTFDALFFP.LAPGTRQdp......................................seaRTIVRRHQFPMI-..........--NTYND..ALTRTHQNSL.F.IY...KP.IYS.......................................Q..--ELSELPFGHPRQLVDMLPVLRQYAFLSTLLESSF-g.......................................................................................................................................................................
A0A0A1P8J8_9FUNG/106-250             ....................................................................................................erlees------LKEk.dESKSK....-IEIQRLEKIAQSMGL..ITFVD......................SSKm..fETENPITTITLGG.TL.IVIDIDI.........DDM..G..RI.....H......NTKVTFVSE......S......--.....MQ..AEE..................................................GDRVDRILKENLQ.......................-SCNFE.LFERNLQSLALLDQLNVK........hKPMDF.FSIINNLLKDLKTI-------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------csne....................................................................................................................................................................
H0V005_CAVPO/59-426                  .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAVMYWKA...-.TN----...........................--AGPLDKILHGSVGYLTPR...SGGHL-........................MNLKYYASPSD..LLDDKT-..--AS....pIILHEN--NV.....................PRS--.-LG.....MNASVTVEGTSAMyKl........piAPl...imGSHPA--......................DNKWT-------......................................-------------PSFS.......................................AITS.....ANSVDL...PACFFLKFPQPIPVSRAFVQKLQ.NCTG.IPLFESQP-..................T.YVPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PIPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GILVSKITFQHPGRVPLILNMIRHQVAYNTLIGSCVK........................................................................................................................................................................
G1XNU3_ARTOA/98-503                  .........................................................................................................k-RVLKVLKS...R-PGK....-ISEEGIKRVARRAGM..QYHTD......................STT....-LMKGVHTLIISG.II.VVVDVDF.........-KD..A..AV.....S......RVTLSFAET......-......SG.....PT..AEF..................................................SDRAAKILENTLIsqssatsfsq...ntnsststysITSSLA.QFADNLERFARSDRLSHL.........PSLNC.FSAVTGLYVSMMKI-------...-.WEKEV-...........................ASFGGEVEAMCKGMGRPGMH...LRAKVG........................FCIDYWKERRF..ISEKMEG..KGKG.....----------.....................-REDG.EES.....GKFWRVVIDVDEL.P..........nEA......YITPVRN......................SEDWVSDNVLKGsd.................................glfGTADTHEIDWIEPPLNNye...................................paT--Kp...eVLTRLN...NTRFIAKLDPPVVISLQDEVEIL.NAAG.ASMMSQVM-..................-.PGPLEGVLCP.KIKGGK-...........................................EPLVNGRKV----..........--YAGKE..GESAEHSYNL.N.TL...RP.AYG.......................................R..--VLEEIPFSHPRQLGVIFQILRKYACFSTIFHSAF-p.......................................................................................................................................................................
A0A063C156_9HYPO/127-570             .........................................................................................................d-TILKILSA...S-RGL....-VSEAGLERLAQQIGL..ELLSE......................EQR...tPGGRKTRTLAIAG.SA.VALDIVL.........-DN..N..IV.....Q......SVTLSYHGS......-......AP.....SV..SRH..................................................MDAAGRILLQDLTlap................gqspLTKSLR.SFASNFERLAGLDKLSIV.........PGLDC.HEALAGIYASLERLYQWDMSK...-.-----Lrdeq..................aakgkPDHYLSDMAMCSRHGRPVMH...ERGTVG........................LAIQYWKERRF..AVPPADE..---P....tLSAAKKDGDS.....................GRDSD.RDS.....DRVWSLLLGCAPL.D...........GS......GVPPVRV......................SDNWLSKDITKEd...................................aaAGPAKTVLDWQEPENVSlpqsddn........................kdagmdllQPDL.....STTRVP...RVMFTVTFDPPVVLPQNDWARLY.MYAS.VNPPNPHSDmgqq.........rgqpaW.PPTYDSLLFP.FPSGAKVdp......................................sesRAICRRRRVRVF-..........--DRHHV..ARVKHHRNTL.F.VY...KP.IYS.......................................Q..--TVHEMPFSHPRQLLDMLPLLRQHAFLAILLENSF-g.......................................................................................................................................................................
K0KZ05_WICCF/10-201                  .........................................................................................................n-NIVKILKS...A-PGS....-ITIQNIQRLSNVYKF..ETFIE......................NID....---DKIKRLSIAG.KI.LVIDIDYeelanktkdQTK..F..EL.....K......DVKLILANN......N......ND.....FK..YTS..................................................SVNGENILNNVLA.......................KYSNFA.QFDKALETLAVFDQYSN-.........DDFDL.FHYYIQIYEDLKKLTKIKVEL...N.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------vndefaivvedqykitlvnderlcivkndhngdqwnqqhdt...............................................................................................................................
M2N0G7_BAUCO/149-532                 ......................................................................................................rmrn-----VLKSi.gKSKGR....-ISEEGIMRVARRAGL..DNDI-......................---....----DSSRISIAG.TK.MIIDISL.........-TS..Q..MP.....H......EVLVTFDTE......-......NA.....GL..TAQ..................................................ADSVSKVLADDLLake.................vdtINAKLD.RFAANLNRLARVDRLSS-.........SQVNC.FEALSGIYASLKRLYEQEVAT..aS.------...........................-----ALDVLREKSGRPVLH...ASGHIG........................YELAYWQQRSN..LPPAHKG..----.....----------.....................-----.--D.....DHVFRLRMSIERS.A...........AE......LYPSIRI......................SDKWLPGQLSLT.....................................aESGTASTLPWLDPAALLitad..............................tsvdaMA-T....eGQQKMP...DLRFTARLDPPLVLPWQVASAVL.QVMG.LPPPQFFV-..................Y.PPAWHAMLLDpSTTTP-Lnv.......................................anG---HPLQITHAV..........TVTRGGE..EVTVHHKYEL.D.VA...RN.DGG.......................................Y..--VLEALPFSHPRQLVELLPTLRQWACFGSLVEQI--lq......................................................................................................................................................................
E3QE57_COLGM/121-547                 ........................................................................................................dg--VIEILGK...A-KGR....-VSEAGLERLTLRTGL..TSMWD......................EHR...sPDGRKTRMLVIAG.QA.LTIDIEL.........-NN..N..IV.....E......SVSLGFPES......-......GP.....IV..TRH..................................................KDRAGNILLKDLQlrp................dqspLTKTLE.KFSANLERLANLDKLSVI.........PGLDC.QEALAGIFESLERL-------...HkWELSKLredp..................alsgkPDRFLEITVMCTKSGRPMMH...TRDMVG........................LSIEYWTERRH..VIPRTP-..ETA-.....----------.....................--RYC.EKM.....EKVWSILIGCKAI.D...........GN......MFPPVRV......................TENWISQKVEKDepgp..............................edilVAASGPALDWLEPEPTTlpqtddn........................kepgidvvQPDG.....TTHKYP...NVKFVATLTPSVIVPQSVWNTLH.TLTG.AQAQPMPL-..................P.TYTFDSISFP.IPEGINHda......................................selRVISCKRRVQVP-..........-GDGDT-..VPWRKHKNTL.L.IY...KP.VYG.......................................Q..--TVTDLSFSHPRQLVAMLPILRQYAFISTLLERSF-g.......................................................................................................................................................................
A0A093ZJ14_9PEZI/128-547             .......................................................................................................lmq--IVETLKA...V-KGR....-VSEDGIERLARSVGL..ECLWE......................TGM....GRGGKSKTLIIAG.TG.LSIDIEF.........-TD..N..AV.....E......TVTLGFPES......-......PE.....SV..TRH..................................................AERAGKILLDDLKlgk................netvLTKRID.RFAGNLDRMARLDKLSVM.........PQLNC.HEAVAGIYDSLEKL-------...HeWEVARLteee..................amsgkTQEQIVRAALLTKSGRPAMN...AHGSVG........................LCLEYWQERHA..TSRGE--..----.....----------.....................-----.--G.....CKTWSLLLECDQS.S...........SM......VYPSVRV......................SSTWISPSVVKSnptd..............................ddvlLSASGVVLDWQDPPNILlpadpdqk......................ddsgmegieQSGQ....lPNQKFP...DVRFVAKFSPPLTIPYSAAMQIY.DSTG.AHLEPDSL-..................-.-AAFDALAFP.PSTAEPSepd.....................................gahRRIRKEQLVSVY-..........--NRAGE..HEKRCHANTL.A.IP...KM.EYA.......................................L..--TLTEVPFSHPRELVQMLPILRQYTRLSTLLERSF-g.......................................................................................................................................................................
A0A0A1N7A4_9FUNG/124-268             ....................................................................................................erlees------LKEk.dESKSK....-IEIQRLEKIAQSMGL..ITFVD......................SSKm..fETENPITTITLGG.TL.IVIDIDI.........DDV..G..RI.....H......NTKVTFVSE......S......--.....MQ..AEE..................................................GDRVDRILKENLQ.......................-SCNFE.LFKRNLQSLALLDQLNVK........hKPMDF.FSIINNLLKDLKTI-------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------csne....................................................................................................................................................................
D4ATV5_ARTBC/171-651                 .........................................................................................................s-EVLAMLRS...RVAGR....GVCREAVERLGTLEGF..ECMWQ......................DNN....--------LSIAG.NS.VDLEIEFgr.....dgTEA..D..VV.....K......DVTLRYATQ......D......M-.....AE..GEK..................................................REAASAVLKRVLTfgddgdgd.......aeervaagEWKPVD.VFHANLTRLARMDGLC--.........REVNC.FEAVEGVHESLQKV-------...-.WDSTGKgtdpdlklntdt..dtdtdtkkttsgpESRFWERLCRSSSVGCPTMH...RGENVG........................LAIHYWADQRR..LLDAQRT..SLEE.....-----VLQAEls................pslKRSKG.SSR.....RQVYSAVIECEA-.-...........--......GYPSLRI......................SKGWVGDPTVLPtqdennnennnendinitnneksnnndnegnngaedtnGKVGKTRTNWLEPDPTL.......................................VSTDp...lLPSSPP...NVRFVARLEPAIHVPIVVAAEVY.RLVG.IAMQQETR-..................A.PAAYDALVVP.VERRPSRtvkge.................................ggdeqEEEEHVRTVPIFG.........qTEGGEDE..VTRKKHVYSF.H.AL...EH.VPG.......................................Y..--TVRELPFSHPRQIEEVIPLLRQYALLGKLL-SVF-q.......................................................................................................................................................................
S6E396_ZYGB2/11-267                  ..........................................................................................................DEMIQLFQE...YKSGS....-VTLDNITKLCQTLGL..ESFID......................DID....---SETSRLSTAS.KI.IVIDIDF........sKSK..G..RV.....K......DVKLVLASN......F......DN.....FN..--Yynd...........................................psgqASERGNILLNSLT.......................EYPDLH.EFHHNLKFLHLLDAYSS-.........INIDA.SNTVGNGNFGSNNG---SGNN...-.------...........................------------DSNTASND...YGGELD........................L-FKYYTELAQ..FLRQYFA.dNSAPf...rV-ETNLNNRFgiy...............iltQ----.EGQ.....QLLVKIMFQKSKD.Q...........-Qhr..lyEYVY--Se....................gHKEWINESPESY......................................TSGISLVME--------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------vndencqi................................................................................................................................................................
F2PJJ9_TRIEC/179-465                 .........................................................................................................s-EVLSMLRS...RVAGR....GVCREAVERLGTLEGF..ECMWQ......................ENN....--------LSIAG.NS.VDLEIEFgr.....ggTDA..E..VV.....K......DVTLRYATQ......D......M-.....AE..GEK..................................................REAASAVLKRVLTfgnvddddggddhgdaeervaagEWKPVD.AFHANLTRLARMDGLC--.........REVNC.FEAVEGVHESLQKV-------...-.WDSTGRgtdpklelklkpdtdtdtdtkkptsgpESRFWERLCRSSSVGCPTMH...RGENVG........................LAIHYWADQRR..LLDAQRT..SLEEv..lqA--------Elspps...........aslspKRSKG.SSR.....RQVYNAVIECEA-.-...........--......GYPSLRI......................SKAMQQ------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------et......................................................................................................................................................................
A0A086T5X4_ACRCH/130-546             ......................................................................................................hlgp---------...KRKGL....-VSEAGLERLGQRNGF..DCLLE......................DYM...aPDGRKMRALIIAG.SS.TQIEIVL.........-DN..N..IV.....Q......NVTLAFPES......-......SE.....ST..SRH..................................................MEPASKILLDDLRlpp................nqspLTKTLD.KFALNLETLAALDRLSVM.........PAFDC.RAALVGIYTSLERL-------...HqWDISRLree.....................gthPEKMLPLLAMCSRNGLPAMH...ARNRVG........................LALRYWKERRL..IPPESQS..----.....----------.....................TSSFA.ENR.....EKTWSLIIGCASM.D...........GL......QVPPARV......................SEDWLSKDIVKDdg..................................lgGEPKSFPLDWQEPVNVAlpaseet........................kntgiemmQPDL.....STIKVP...AVIFTVTFDPPVVLPQSDVMRIY.ACAD.MEPPPPHM-..................R.PPTFDQLYFP.IPPGVHQgep.....................................sepRTIKRERQVSVL-..........--DRNRN..ATIKTHHNTL.F.IY...KQ.IYS.......................................M..--RVSNLAFCHPRQLISMLPLLRQWAFTSTLLENSF-g.......................................................................................................................................................................
A0A0A1MVU8_9FUNG/3-264               ..................................................................................lskvevtnlmnrqvesdllmvlle---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------------.........-----.---------------------...-.------...........................------------GHGIPCLH...LNYP-G........................ISICYWVDKFH..NDIDWEQ..----.....-VKEQYIQR-.....................-DKY-.HPI....lSQSSKLLISFEDCiQ...........EM......HYLPT--......................------------......................................-TRSSYLLEFDETEEDIdseqfkvvyen.................nypkfmsplrfV--Kp...lSSTPSV...QIRFIATLDPPIPVSDGLCQKIM.NLSG.MINTDSA--..................-.--ISDHVVAS.TTSTSVT...........................................SETLSLEEI---Lv........pDIAPTKQ..YIHDKQIYKW.M.SS...SK.VSA.......................................K..--IVTRIPFQHPVQLYSIIQCLRQQEMFNILFKSIF-s.......................................................................................................................................................................
A0A094GKH6_9PEZI/1-419               ........................................................................................................mq--IVDTLKA...V-KGR....-VSEDGIERLARSVGL..ECLWE......................TGM....GRGGKSKTLIIAG.TG.LSIDIEF.........-TD..N..VV.....E......TVTLGFPES......-......PE.....SV..TQH..................................................ADQAGKILLDDLKlgk................detvLTKRVD.RFAGNLDRMARLDKLSVM.........PQLNC.HEAVAGIYDSLEKL-------...HkWEVARLteee..................amsgkTQEQIVRAALLHKSGRPAMN...AHGSVG........................LCLEYWQERHA..TTQGE--..----.....----------.....................-----.--G.....CKTWSLLLECDQS.S...........SM......VYPPVRV......................SSAWISPSVAKSnpta..............................ddvlLSASDVVLDWQDPPNILlpsdpdqk......................ddsgmegidQPGQ....lPNQKFP...DVRFVAKFSPPLTLPYSAAMQIY.DSTG.AHLEPDAL-..................-.-AAFDALAFP.PLTAEPSepd.....................................gahRRIRKEQLVSVY-..........--NRAGE..HEKQRHTNTL.T.IP...KM.EYA.......................................L..--TLTEVPFSHPRELVQMLPILRQYTRLSTLLERSF-g.......................................................................................................................................................................
MED1_XENTR/44-412                    .........................................................................................................v-SCLETLQKa.lKVSSL....SAMTDRLESIARQNGL..T-S--......................---....HLSPNGTECYITT.DM.FYLEVLL.........DTE..G..QL.....C......DVKVAHHRE......-......NP.....VS..CPE..................................................-------LVEQLR.......................-EKNFE.DFSQHLKGLVNLYKVPGDn.......kLETKM.YLALQSLELDLTKMAAMYWQA...-.TN----...........................--ASVLEKILHGTVGYLTPR...SGGQV-........................MSLKYYVSPYD..LFDDTT-..----.....--GASISLSEgh.................avPRS--.-LG.....MNVSVTIEATSAM.Y...........KL......PIAPLIM......................GSHPIDN-----......................................----------KGTPSFT.......................................SITN.....ANSVDL...PACFFLKFPQPIPVSRAFIQKIQ.HCTG.IPLIDGSH-..................T.FLPHYELVTQ.-------...........................................-------FEL---..........--AKEKE..PGTLNHNMRF.Y.AS...--.LPGqqhcyfvnk....................daplpdgrslQ..GTLLSKIPFQHPGRVPIILSLIRHQVACNTLIGSCVK........................................................................................................................................................................
F1RWL2_PIG/59-426                    .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAVMYWKA...-.TN----...........................--AGPLDKILHGSVGYLTPR...SGGHL-........................MNLKYYASPSD..LLDDKTT..--SP.....IILHEN--NV.....................PRS--.-LG.....MNASVTIEGTSAMyKl........piAPl...imGSHPV--......................DNKWT-------......................................-------------PSFS.......................................SITS.....ANSVDL...PACFFLKFPQPIPVSRAFVQKLQ.NCTG.IPLFETQP-..................T.YVPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PVPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
M3B1G6_PSEFD/79-497                  .........................................................................................................r-SVLNTIGQ...R-KGR....-SCEESIARVASRVEL..DISID......................DDN....NRKVGSRTIAMAG.SSkVLVDVEL.........-QN..H..AA.....S......EVKVSLMGS......E......AL.....MA..QQE..................................................--AASKVLLHDLAvpn.................gilLNAHLD.KFAANLNKLATLDKLSTEa.......yGGVDC.FEAITGIYTSLKKLYEMEKDA..vK.--TLKKfs......................vseADRRAEHEVLCKRSGRPSVH...EGGKIG........................LSLAYWSTDFA..TSDQDDT..A--M....dVDGDEGVGQ-.....................---AD.GDA.....KGTWSVDIEVEKS.S...........AG......LYPSMRL......................SDAWLPEFFELP......................................SPESGESLPWQEPPPTYvnnp..............................atdknD--Am..avEPQRLP...DLRFIAKFDPPLVVPLQTAMNIL.NVIG.AQPPSTNM-..................-.FPAYHYAVLN.VPSIKHAs.........................................pQDIRAEKKVLSLH..........----GSD..ELETTHCYNL.D.LS...-Q.VPL.......................................S..-MKLERLPFSHPRQLIELLPTLRQWASTGALLHGTF-g.......................................................................................................................................................................
C5DL71_LACTC/27-152                  ........................................................................................................gq--MICLLQE...YKPGL....-VTLENITRLCKTLKL..ESFTD......................NID....---NETIRLSTAS.KI.IVIDMDF........hKSD..K..QV.....K......DVKLVLASN......F......DN.....FN..YYN..................................................DGDNGNILFNSLS.......................CFPNLQ.TFYYNLRFLTTLDTHSNI.........-----.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------etepgiaa................................................................................................................................................................
U9U283_RHIID/7-82                    ........................................................................pikhsstsrapkiihqwekkfddslylqvfnlds---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------------.........-----.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.--Kcn..................................tkaR..--RIDRIPFSNLFQVYGLIKILRQQLLFNKLYQSCFN........................................................................................................................................................................
A7S6R2_NEMVE/463-532                 ...................................................................................................lefskdn---------...--NSI....KGVVQRLEAITRNVGL..KFY-D......................NG-....----NGTDCFISS.DM.FYVEVKM.........ETN..G..KV.....S......EVKVAHAGD......-......--.....--..---..................................................-------------.......................------.------------------.........-----.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------peln....................................................................................................................................................................
B4KV47_DROMO/79-454                  .........................................................................................................q-SALDKLQHy.iKVTSR....HGLVERLESLSRQLGL..KFM--......................---....---EDQQTLFIST.DM.FYVEILL.........DAS..G..NL.....S......DVKVHHECK......I......EQ.....QS..NSS..................................................--ASSTELLNCLK.......................-AGDFA.DFTVQLEGLSSIYQLNAEp.......kVKKKA.FVALQAMETDIFSLYQHQLQL...Q.------...........................-------QQLSSSTDSYHIM...NNSSVGlvlqr..............rgghpVKLTYFCPPLH..LIEKKVK.gEKVAt...sSGTASRD--Ls...................iEQVIK.SPN....gLSVTLNLEASSAN.K...........LQ......ILPIVSI......................TNEAGLP-----......................................----------LEQPVYA.......................................PLTQ.....NNSMLM...PATYVLRLSKPMPVCIESLRALG.-LPG.LTSNANEE-..................-.TPTVMNLIVQ.-------...........................................---TASRQLIKN-..........--TQKGL..YVNLPKETHC.Y.FF...TD.NHR.......................................L.kGTMISSLPFTEPAQVPKIIAFLKKQALFYTLLSSCIR........................................................................................................................................................................
A0A016PIN7_GIBZA/118-538             .........................................................................................................e-TIIATLDK...K-KGL....-VSEAGLERLAQRIGL..DCLSE......................DTT...aPHGRKQRTLVIAG.SA.IQLDIIL.........-DN..N..VV.....Q......NISLAFPES......-......AA.....SV..TKH..................................................VSRASEILLKDLQllp................nqspLTKTLD.EFAVNLERLAVLDKLSII.........PGLDC.HEAITGIYASLERL-------...HqWDVAKLreep..................evsskSNGALSTAAMCTRHGYPVMH...SKDRVG........................LALQYWKVLRH..IEPTSEQ..-M--.....----------.....................-ASFT.ASQ.....EQIWSLLIGCAPI.-...........-V.....dEVMPVRV......................SEDWISKDIVKAe...................................psMDPKRPNLDWQQPNNVVlpsteen........................knagmevlQPDL.....STARVP...QVMFTATFDPPIIMSHNDWSHLY.NIVN.IKAPQLYG-..................Y.LPTFDSLLFP.IPPGSNQdp......................................selRAISRKRDVRIY-..........--DKDQS..PAVKPHRNTL.Y.IY...KQ.VYS.......................................H..--RVTEIPFSHPQQLIYMLPLLRQYAFLSTLLENSF-g.......................................................................................................................................................................
Q1K715_NEUCR/122-537                 ..........................................................................................................DEVISILSQ...N-RGY....-VSEAGLERLAQKLEL..DCMWD......................EHM....-AGESKRTLIIAG.SA.LELLIGF.........-TD..N..IV.....Q......SLTLAFPES......-......SE.....SV..NKH..................................................AEDAGKILLENLKlqp................gqspLTKQLD.KFSVNFERLAILDKLSIA.........SVLNL.YEAIAGVFDSLSRL-------...HqWELQKVreda..................slagrTDEYLRNIILCNRSGTPAMN...ARGKVG........................MRIDYWKNKHL..QPPTNPQ..-TAA.....----------.....................---YV.EKH.....EKIWGILVGCAPVnRn.........lDV......NVHPVRV......................SNHWISENVELPhi..................................pgDLQTSPMVHWLEPEDTIvpp................................dpekAGDS....lLGPRLP...SVTFSATFDPPIHISFGLWEQLR.SMG-.IGIPAMDV-..................-.SKSFDNLVFP.IAPGGYYdp......................................tepREIHHTKDINYQ-..........-LPGSPA..WVSRKHANSL.Y.IY...KP.VYG.......................................K..--TLTEASFSHPQHLIAMLPYLRQYAFLSTLLENSFK........................................................................................................................................................................
A0A0G2IGT8_9PEZI/115-281             ..........................................................................................................DDVIQILRQ...K-KGI....-VSDEGLERLTKRVGL..ECMWE......................DVN....---GPIRTFVVAG.AT.VALEIGM.........-RD..H..VA.....Q......TVKLDFTVS......-......KD.....AV..TKY..................................................ASKAEAVLLDDLRlap................gqhpWTKSLD.KFAANLERLAGLDKLSVLdk....dgkPQLVT.HDAVAGLYESLEKL-------...HeWDVRRL..........................hENAEL---------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------strgdehi................................................................................................................................................................
F2PJJ9_TRIEC/459-583                 ........................................................................................................ka---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------------.........-----.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.--MQQETR-..................P.PAAYDALVVP.VERRPSRtwkgdgeggyqe..................qeqeqenqeqehqEEEEHVRTVPIFG.........qTEGAEDE..VTRKKHVYSF.H.AL...EH.VPG.......................................Y..--TVRELPFSHPRQIEEVIPLLRQYALLGKLL-----gvfq....................................................................................................................................................................
K1W989_TRIAC/149-215                 .....................................................................................................spkgt---------...-----....---SDLLHALAKRVGL..QCFAE......................DAG....---GQKTTLTLAG.ER.FVVDVDIe.......tDRD..G..KV.....T......---------......-......--.....--..---..................................................-------------.......................------.------------------.........-----.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------ihkltathitpgg...........................................................................................................................................................
A0A0H5C146_CYBJA/9-160               ......................................................................................................tria----TILKQ...S-PGS....-VTLENLLRLANFYKF..ETFNE......................EIS....---PGVKRVSIAG.KI.LVIDIDFhelessirgQTR..I..DV.....D......TVKLILANN......D......S-.....MF..TVN..................................................NADGSIVLEMALK.......................-QQKLV.QFDRCLEQLSVLDQNS--.........TQVDL.FHQYTSIMGTLQ---------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------aefpnseystqefs..........................................................................................................................................................
G4MW62_MAGO7/129-559                 ..........................................................................................................QEILAMLSK...H-KGR....-VSEAGLERLAKSIGL..ETLWE......................DGT....GDNPMTRTLVIAG.SA.LALEIII.........-TN..N..IV.....D......QVALAFPGL......-......NE.....TV..TKH..................................................EGRASQVLYDDLKlep................rqspLCKMLE.KFAANLERLAMLDKLSTI.........PGFSC.QEALAGMHESLNRL-------...YeWDLQRLradp..................alegrSEQFKELTAICARSGHPGMH...IQGRVG........................LTLEYWKEKHL..APGTATD.pE---.....------EAKQ.....................MQDYI.DRT.....ERTWGLWVGCSAM.N...........VM......GYPPARV......................STDWLSPAVEKQgat...............................aeelVLGNGPILDWQQPPNTVlppdae..........................dktvdqmAVDG....mEFQRLP...NVMFTVDFDPPVVMSLIDSDHIY.AIAQ.SQPI---YS..................E.LRTFDSLLFP.DPLGLNPt........................................etRTITRMREI---Elq.....prdKADHGDG..LPVARHKNSL.F.IY...KP.VYG.......................................R..--LLTSLPFSHPSQLIDMLPLLRQYALLTTLLEKSF-g.......................................................................................................................................................................
A0A074VXZ9_9PEZI/153-603             ...............................................................................................tkllgpqhhrr---------...--FGR....-VSEEGVRRVGRWAGL..DVEVE......................AKRe..aRKFEGNRPVAVAGkNN.VLIDFQF.........-KD..N..LP.....T......HIDLSFSSQ......-......DP.....AV..TAH..................................................QAAAASVLLQDLTpap................gtsaINTKLD.RFAANLETLARLDKLSVY.........NQLNC.FEAVTGVYESLKKLYEHEKQA..aHaIVQAKRg.........................nPELRAERHVLCQKSGRPQMH...ARRKIG........................LSLDYWMEKSN..IYPADSV..ESAKda.saMDVDS----Qp...................aENPLK.EAD.....ETIFALDITAEA-.G...........TP.....dPYSSIRV......................SSAWIADRILKSaeet.............................tdptdLLSGTQSIDWQDPAPTYlsdnsqdn.......................ndamaidsNPST.....GVQKLP...AVRFVARLNPPLSMPWTAAAAIL.QSVGsASVMSEIPE..................I.QHTYEGSLLQ.KPSDVPLlnk.....................................plqSSGPAASTIKTV-..........---LTPD..GVNVQHKNAL.Y.VP...KQ.DFG.......................................Y..--LLTFIPFAHPRQVVALLPVLRQWAYLGSLLKGTF-a.......................................................................................................................................................................
F6TRR2_ORNAN/53-414                  ........................................................................................................vg--CLETLQKa.lKVTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DSS..G..QL.....C......DVKVAHHGE......-......NP.....AS..CPE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLAKMALMYWKA...-.TN----...........................--ASPLDKILHGSVGYLTPR...SGGHL-........................MNLKYYASPYD..LLEGKT-..--AA....pIVLHENNV--.....................PRS--.-LG.....LNASVTIEGTSTMyKl........piAPl...imGSHPV--......................DNKWT-------......................................-------------PSFS.......................................SVTS.....ANSVDL...PACFFLKFPRPIPVSRPFVQKLQ.SCTG.ERLTPAGR-..................R.----------.LPRGRRV...........................................ARETRPRAGFRG-..........--DRYHX..ALPGQQH-CY.F.LN...KD.APLpdg.................................rslQ..GTLVGKIAFQHPGRVPAVLGLIRHQVAYNTLIGSCVK........................................................................................................................................................................
E7KV13_YEASL/12-300                  ..........................................................................................................DSMIELFKD...YKPGS....-ITLENITRLCQTLGL..ESFTE......................ELS....---NELSRLSTAS.KI.IVIDVDY........nKKQ..D..RI.....Q......DVKLVLASN......FdnfdyfNQ.....RD..GEH..................................................--EKSNILLNSLT.......................KYPDLK.AFHNNLKFLYLLDAYSHI.........-----.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------esdstshnngssdksldssnasfnnqgkldlfkyftelshyirqcfqdnccdfkvrtnlndkfgiyiltqgingkevplakiyleenksdsqyrfyeyiysqetkswinesaenfsngislvmeivanaxesnytdliwfpedfispeliidkvtcssnssssppii.
A0A0A2KIN0_PENIT/133-555             .........................................................................................................e-QVVQLLRA...RVSGR....GVSRESVERLSRLEDF..ESIWQ......................DDN....--------LNIAG.NF.VDLEIGF.........YPG.qD..VV.....K......DVSLRYATP......-......EY.....TE..GVR..................................................REEATAVLKRTLAqspe..............daecgKWRSLQ.KFHENLQWLAKLDKLS--.........QEVNC.FEALENLEENFRRI-------...-.WVEENKn........................gkHGGEYQHLCA-GVLGRPTMH...KGTRIG........................LGLEYWVEQAK..VLDTKRS.lPSPD....aMEIDPQHDQG.....................SKVEL.DDQ.....SRSWTVMIECEE-.-...........--......GYPSLRI......................SKEWVGSEVFTAgest..............................ellpSNGAAGSVNWLDPPQTTrlthg.............................nhdpmALDSs...mLESSPP...NRRFVGRLEPALDVPILAASEIY.RQLG.MQLPQEFK-..................-.MITYDALLVS.ESLPSTSpvs....................................spqiGRRKRRMSVLAV-..........--DSKGK..QFTKQHNYTF.Q.SF...ES.ITG.......................................C..--TIRDLPFSHPRQLADILPILRQYAVLANLIRKTF-h.......................................................................................................................................................................
S0E4B0_GIBF5/118-539                 .........................................................................................................e-TIIATLDQ...K-KGL....-VGEAGLERLAQRIGL..DCLSE......................DHT...aPDGRKQRTLVIAG.SA.IQLEITL.........-HN..N..IV.....E......NISLAFPES......-......AR.....SV..TDH..................................................VTRASEILLRDLQllp................nqspLTKTLD.KFAANLERLAVLDKLSII.........PGLDC.HEALAGIYVSLERL-------...HkWDVGRLrdep..................gmggkSDSELSTMAMCTRHGYPVMH...SKDRVG........................LALQYWKALRL..VQPTNTK..-LA-.....----------.....................--SFA.SSH.....EPVWSLLIGCAST.G...........GM......GHMPVRV......................SEDWISKGVVKAe...................................psMDPKRPNLDWQEPDNVVlphseen........................kdasmemlQPDL.....STARVP...QVMFVATFDPPVILPQNDWLRLH.SYAN.VNANPLFG-..................Y.SPTFDSLFFP.IPPGSAQdp......................................selRAISRSRDVRIY-..........--NKDQE..AIVKPHQNTL.Y.IY...KQ.IYS.......................................Q..--VVTEIPFSHPQQLIEMLPLLRQYAFVATLLENSF-g.......................................................................................................................................................................
I4YB95_WALMC/90-466                  ....................................................................................................dntenr---------...---ST....SSMMSRIEATAKEFGL..EAFQD......................QSQ....QADVTVHTVTIAG.TI.LVIDVDLt......stQSN..T..SL.....T......RLKTTYATN......-......SS.....IN..LEP..................................................---VDNLLIRDLDgyvslepns.....sdpesaalqSERHFI.NFKRNLQQLVVLDKLSQSi.......gNQTDL.FVNFEILSKAFADLSVIENAA...T.------...........................--SEVKHLHL-----YPSLD...INGH-Gfsllh..............tprpyLTQVLHVSSQH..LLDPDE-..----.....----------.....................---AL.RSIs...lQDTYSIHLELREN.-...........GFpf..kqTFPSKVQpylk..............aqlpF-----------......................................NT---------------.......................................NIQP.....LPGNVD...RITAYAVLNKSLYLPKSACIAIQ.AALG.YSDNVSDQQi................vK.LTWLD-CIYQ.-------...........................................------RELQKPI..........GLVSQSV..ANFKRQIYRF.N.NP...--.END.......................................Q.tIIKLSAIPFKSFSDLLRIIEILKTHLFIDELITSCL-r.......................................................................................................................................................................
G6CLW2_DANPL/60-438                  ..........................................................................................................QKCLDSLQHc.iKVSSL....QSLIERLECLSRQLGL..KFV--......................---....-VGTSGVNLFISS.DM.FYLEILV.........ESS..G..SV.....K......DVKIHHEGK......I......EQ.....QS..CEE..................................................-------LVQCIS.......................-RGDFA.DFTAQLEGLTAVYQLNAEk.......kVKCKA.FSALQSLEEDLCTLRQLQSFI..kDpWA----...........................-------------------Q..vHKSPIGflqrr..............rgghaLRLTYFVSPYE..LLDKEKG..-LQP.....LTVDLLTSGKpssss..........glaslvSP---.--ShtpigHSATVLLEGSAAN.Kl........qlSPii..agGQRPGK-......................------------......................................--GNG--------PVYA.......................................QLVP.....QNSAML...PACFTLKLSQPTPMCAGLAKLIH.ATTD.VEVAGDWA-..................N.AKPMLGLVAQ.-------...........................................-------QAYNK-..........--LAPGK..TVELNLSKGL.F.VS...--.LPEqwqcyf...........................lcetrgL.dGCMVTSVPFTHPSHVPPLLSVLRQQALFNALLASCVR........................................................................................................................................................................
U3IBF2_ANAPL/49-400                  .........................................................................................................l--CMEKIQRt.lNAKSL....FSMMNRLESLSRQKGL..N-S--......................---....HVSPSGTTCYITS.DM.FYIEVQL.........EKD..G..NV.....I......DAKLAHLGE......-......AP.....VI..CDD..................................................-------LVEHLR.......................-MKNYD.AVGKILENLSNLYQIPGNs.......eMKAKG.YLALQSLEKDLYSMSLLDRTQ...D.VN----...........................---------------RVTEV...LHGKVGhlvpr..............tggtpTNIEFYISPYQ..ILEAELN.pGSQV.....----------.....................-----.--C....gAKIDVTVEGTDML.H...........KL......PLSPLLD......................SQPGEDG-----......................................------------NPAFL.......................................PLTD.....ELSMDL...SAYFLLKFHQPFPMSSSSIEEIQ.RLTG.IQITGL-K-..................-.LAPLYELIVQ.-------...........................................-------STLKE-..........----KGS..EDLFTHKSRF.F.VS...--.LPDspkhcyfi.......................ntgsaksdL.aGALVSKIPFTHPKCVPDVIEILRHQMAYNSLISSCV-s.......................................................................................................................................................................
A0A0D9S3C2_CHLSB/59-426              .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....VS..CLE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAIMYWKA...-.TN----...........................--AGPLDKILHGSVGYLTPR...SGGHL-........................MNLKYYVSPSD..LLDDKT-..--AS....pIILHENNVS-.....................----R.SLG.....MNASVTIEGTSAMyKl........piAPl...imGSHPV--......................DNKWT-------......................................-------------PSFS.......................................SITS.....ANSVDL...PACFFLKFPQPIPVSRAFVQKLQ.SCTG.IPLFETQP-..................T.YAPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PIPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
A0A017S9D9_9EURO/137-567             .........................................................................................................e-DVVQILRT...RVAGR....GVCREGIERLGQLEGF..ESIWQ......................EDN....--------LSIAG.NF.VDLEIEF.........HPG.kH..TV.....K......DVSLKYATP......-......EA.....TE..GEG..................................................RDEATAVLKRDLMqsse..............eiergAWKSLT.GFYENLRWLAKLDRLS--.........QEVNC.FEAIEGLYESLKRI-------...-.WDEESKh........................lkFSEIYEHLCS-GWVGRPSLH...RGGRIG........................ISLDYWIYQAR..ILDAKRK..NTSPd...aMVLDNADQ--.....................--EFD.IPQ.....HRMWSVMIECEE-.-...........--......GYPSLRV......................SKDWVNSEVLTPmstdks..........................sapnenDTTDIPTVNWAEPPMTTtsdsq............................gnpgamTLDSg...mLGSSTP...NRRFVAKIEPPLDVPILAASDIY.RQLG.LQLPQEFR-..................-.MVTYDGLLVP.GSSPLSGadimgfg.............................tdeppqaDRRKRRLSVQAF-..........--DSEGK..PCKKQHGYTF.Q.AF...ES.VAG.......................................R..--TMRDIPFSHPRQLAEILPVLRQYATLENMIQKIF-y.......................................................................................................................................................................
F1QR19_DANRE/54-412                  .........................................................................................................a-KCLQKINEa.lNVSSS....AAMVSRLEMIAKQRGL..G-S--......................---....HLSPTETVCYLTA.DL.FYIEVLL.........LPG..G..RV.....E......DVRVAHHGE......-......AP.....VS..SPS..................................................-------LLQLLR.......................-MKQFE.EFSLKLDDLASFYNIPGDs.......dVKIKV.YSSLRHLETDLFKISHLPRSL...R.------...........................ESDLHIDLIMNGRIGNVQ--...-SGREGs......................pMTIEYYISPAD..ALMGLSS.tGEVS.....--AGRVALVT.....................AGSTD.SSH....rLQMESLISSPPQV.Ds.........cGF.....pVFQPL-T......................E-----------......................................-----------------.......................................----.....ACSLLL...PATFLLKLQPPLPVLTSFIEKMG.KITD.GVIAEKPL-..................Q.VEPLHKLLLK.-------...........................................-------TSRKY-..........-----NP..NTSCTDGLQF.L.VP...--.LPGsechsyvf......................pgaqwscenW.nGALMDAVPFSHPGHVPALLEILRHQSAISVLLESCF-s.......................................................................................................................................................................
F4QEV8_DICFS/160-549                 ..................................................................................................gtysdled---------...-----....---------LSSLHKV..DPS--......................-EM....-KPETVHSCSISS.AT.FLLDIFI.........NGD..G..TI.....N......EVKLMHISM......S......SE.....ES..TTA..................................................SQDVTDDLTKSLK.......................--TKEK.DFELKVRRICNQDLLFRK........yKNFDL.QKSVSILQDDFQSINNLIKDR..eDiFNSYGKi.........................tNDYCGIKFIYYQTIQQKMMD...EIGFVAcleleegmnpvklplislfsgensIDGTYFLNAQQ..LLQDQQQ..ESNN.....----N-NNNN.....................NNN--.--Ni...lPTTTTTTIESGGD.Si.........mAE......LNPPTTS......................TSTTT-------......................................-----------------.......................................TSTS.....PTFILS...PIRLVLKLEPCIHITYDGLCKIL.SIL-.-----EREK..................D.IVDYTGQVVG.NSNLAKNhllyi.................................enqiiGSKDRDKSILQQ-..........QFDNQVL..GV---AQRYF.Y.TN...EQfHVG.......................................Y..--EISRIPIGYPNQIFPIFQILRQQIVFNLLFKSCF-t.......................................................................................................................................................................
R9NWA4_PSEHS/188-404                 ................................................................................................dksvsswtca---------...-VETL....AALCQTLENAAKALGL..ETFSEpssea............aevrsDST....SSSTPTHSLTLGA.KI.LVIDIELhil...nigEARglS..PK.....A......KLKISYAND......S......AD.....SH..QAR..................................................DPRLGAILERDVQliadhlfgsa..ssdspqqgridVARALT.NWTDNLKDLLLLDDLEAAasqaassesRSTDL.FAAMQDLCSAAVRVADAEASS...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------sisaaalldrghghhklhgktp..................................................................................................................................................
A0A094G7S1_9PEZI/128-547             ......................................................................................................lvqi---VDTLKG...V-KGR....-VSDDGIERLARSVGL..ECLWE......................TGM....GRGGKSKTLIIAG.TG.LSIDIEF.........-TD..N..VV.....E......TVTLGFPES......-......PE.....SV..TRH..................................................ADEAGKILLDDLKlgk................getvLTKRVD.RFAGNLDRMARLDKLSVM.........PQLNC.HEAIAGIYDSLERL-------...HkWEVARLteee..................amsgkTQEQIMRVALLKKSGRPAMN...AHGSVG........................LCLEYWQERHA..TSQGE--..----.....----------.....................-----.--G.....CKTWSLLLECDQS.S...........SM......VYPPVRV......................SSAWISPSVVKSnptd..............................ddvlLSASDVVLDWQDPPNILlpsdpdqk......................ddsgmegieQSGQ....lPNQKFP...DVRFVAKFNPPLTLPYSAAMQIY.DSTG.AHLEPEAL-..................-.-AAFDALAFP.PQTAEPSepd.....................................gahRRIRKEQLVSVY-..........--NSAGK..HEKQHHTNTL.T.IP...KM.EYA.......................................L..--TLTEVPFSHPRELVQMLPILRQYTRLSTLLERSF-g.......................................................................................................................................................................
Q6BS77_DEBHA/9-436                   ..........................................................................................................DDCLVTLYD...YSSNF....YINVELIQKLAQHLKL..DTFVDkdays............hifepTKS....SERVKFQRLSIAG.SF.ILIDIDF.........TEI..N..KI.....I......KVSLSLANH......I......DE.....TN..GNIpnfdlkshvtigekdeqgnm.........lveidstenkltfltkgnqeaEPSADDILLSSLQ.......................-AEKLG.KFPFNLKFLATLDRLSS-.........TDEDL.FLYLDKTAVILQTAYLLETKH..nEdWL----...........................-----YTEGLYTSVGKISTNd.pKSSQLG........................VFIDFWNDFRY..INHEYTT.sDSST....lLMGNSYKGFLnika............snstqKDYLL.QNK.....ESIWKLVGRDEVI.Esy.......klAFn....dGPQPKAP......................STATSSI-----......................................-----------------.......................................--KS.....SNKNNS...NWILSLDLNYPVFVHLQVLEFLG.I-T-.-DYEKSNEK..................-.--IIDSDLFD.-------...........................................-------KLNDS-..........NEYNYNS..GINKDSPSKL.H.IT...QQ.ISQ.......................................E..YIPLTSVSLNSLTNLIQLIPLFRNYIVLANLLRTLIK........................................................................................................................................................................
A0A0R4IIM4_DANRE/54-227              .........................................................................................................a-KCLQKINEa.lNVSSS....AAMVSRLEMIAKQRGL..G-S--......................---....HLSPTETVCYLTA.DL.FYIEVLL.........LPG..G..RV.....E......DVRVAHHGE......-......AP.....VS..SPS..................................................-------LLQLLR.......................-MKQFE.EFSLKLDDLASFYNIPGDs.......dVKIKV.YSSLRHLETDLFKISHLPRSL...R.------...........................ESDLHIDLIMNGRIGNVQS-...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------gregaqgtlnrvfrsacl......................................................................................................................................................
H2KVL0_CLOSI/104-459                 ....................................................................................defvtitsvlfefnhdkilpcs---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..--E..................................................-------LIPDLN.......................-SGNFD.SLSQHVTNLVTVYAVPGNk.......iDRARA.YMCLEAIEQDLSMLSQVSRSP..dAsVDQ--Rgsslnslpsf......tslrqqlgsrsDVFALRTLVNQSMV------...-----Ghfvgr..............sggrlARLTYLVTPAQ..AAVFRAG..NSST....gSRKSSVNCSI.....................-----.VGK.....GSTEGLVGGHMV-.Rv........glRPr....iTYPEFVD......................TDGCQSS--GPQ......................................QLAFIPLVTLQEDAHGNrlp.................................dfaKPDD.....ITCVAI...EAEFVLYLDPPVPLTSDAVHQLQ.HITG.LTDSD-FGIld..............stE.EQDLVQVILS.-------...........................................--RHGQQHLYGIN..........-S-HLQM..PNMTQHSYEI.R.SS...--.LRG.......................................F..--LVSQIPFTCSNQLSSIISLLRQHASTSAFLETF--v.......................................................................................................................................................................
A0A0F4XBH0_HANUV/38-237              .........................................................................................ektvsflldykpdyvep---------...-----....---VTNISNLCKLLNL..DFFQDtiqd.............ddvekEEG....ATNLKYQRLSIAG.KI.LVLDIDYst....nleTKK..E..QI.....S......NVMLVLASN......F......D-.....QF..NYK..................................................NSKNENIFLNNLT.......................KEHTLS.KFYKNLKTMKSMDDCTDId.......dTATDC.FQYYNSTMKSFYNHF------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------isklnistnhisinkhdelnmifsingvdvltispafdnskaes............................................................................................................................
G1QJ97_NOMLE/24-391                  .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAIMYWKA...-.TN----...........................--AGPLDKILHGSVGYLTPR...SGGHL-........................MNLKYYVSPSD..LLDDKT-..--AS....pIILHENNVS-.....................----R.SLG.....MNASVTIEGTSAMyKl........piAPl...imGSHPV--......................DNKWT-------......................................-------------PSFS.......................................SITS.....ANSVDL...PACFFLKFPQPIPVSRAFVQKLQ.NCTG.IPLFETQP-..................T.YAPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PIPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLVSKITFQHPGRIPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
W5N203_LEPOC/57-414                  .........................................................................................................l-DCLERLHKa.lNATSF....TDMVTRLEIIAKHKGL..G-S--......................---....HLSPSEDVCYITS.DI.FYLEVLF.........QPA..G..EV.....A......DVKVAHHGE......-......AP.....VS..SEM..................................................-------LCNLLR.......................-LKNFE.EFGKELEGLSSLFNTSGDs.......eTNMKM.FSALQFVEKDLLKMFQIPRPV...S.------...........................-------------SGDPWLDn.vLHGRIGnvtprn............ngirypMSIEYYISPYD..LLEEKMK.pESRS.....----------.....................-----.--C....gNKVFVTAEVTNTI.Q...........RL......PSASVIA......................DSPQMTN-----......................................-----------EGFPVH......................................aTLDD.....LVSMEL...SACLFLKFPRPVPILSCFIEEFH.RLTAgISVSEDLK-..................-.QVPFYELLMK.-------...........................................----TKMNVTTW-..........-------..---GSDSCCF.L.VT...--.LPGhhrqgyvi.......................sqqwwlkpW.eGALVHKIPFTHPGHVPSLLSLLRHQTAFSTLIASCV-t.......................................................................................................................................................................
I2FTE2_USTH4/203-416                 ......................................................................................................qdal---------...--QNL....AALCDTLEKRAQSLGL..ETFSEpssdpa..........appshpQ--....SADTLTHTLTLGA.KI.LVIDVEFh......iiKNS..A..GLgfrpkC......KLKLSYATD......S......PD.....SQ..QTRdprl..........................................glllE--------QEVQkiadnlfglf..nnanlqhdrsaVSKALA.SWTNNLNELLLLDHLEAQasqaapagsRSKDL.FAAMQELCAAVIKLSHAEASS...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------ftstalldrghglhqlhsnkpflhsv..............................................................................................................................................
W5N208_LEPOC/57-414                  .........................................................................................................l-DCLERLHKa.lNATSF....TDMVTRLEIIAKHKGL..G-S--......................---....HLSPSEDVCYITS.DI.FYLEVLF.........QPA..G..EV.....A......DVKVAHHGE......-......AP.....VS..SEM..................................................-------LCNLLR.......................-LKNFE.EFGKELEGLSSLFNTSGDs.......eTNMKM.FSALQFVEKDLLKMFQIPRPV...S.------...........................-------------SGDPWLDn.vLHGRIGnvtprn............ngirypMSIEYYISPYD..LLEEKMK.pESRS.....----------.....................-----.--C....gNKVFVTAEVTNTI.Q...........RL......PSASVIA......................DSPQMTN-----......................................-----------EGFPVH......................................aTLDD.....LVSMEL...SACLFLKFPRPVPILSCFIEEFH.RLTAgISVSEDLK-..................-.QVPFYELLMK.-------...........................................----TKMNVTTW-..........-------..---GSDSCCF.L.VT...--.LPGhhrqgyvi.......................sqqwwlkpW.eGALVHKIPFTHPGHVPSLLSLLRHQTAFSTLIASCV-t.......................................................................................................................................................................
F6XL29_HORSE/59-426                  .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAVMYWKA...-.TN----...........................--AGPLDKILHGSVGYLTPR...SGGHL-........................MNLKYYASPSD..LLDDKT-..--SS....pIILHEN--NV.....................PRS--.-LG.....MNASVTIEGTSAMyKl........piAPl...imGSHPV--......................DNKWT-------......................................-------------PSFS.......................................SITS.....ANSVDL...PACFFLKFPQPIPVSRAFVQKLQ.TCTG.IPLFETQP-..................T.YVPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PIPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
A0A015N9U4_9GLOM/130-539             .....................................................................................................aldac-------HD...NSTAF....KFIIQQIESLGKQLGL..LIYHD......................TG-....--EPGETVLTMSG.AI.IVLDIKY........dEIL..N..RI.....I......KVVVSYATD......-......AR.....QN..DK-..................................................DDRVNNLLTQQLS.......................DFKQFN.LFKKNLETLKTLETMSKL........iQPVDC.FHCIKCISNDIKTIYEKEFAI...-.------...........................TNGDV-QKILTEGHGIP-LF...NVDRVG........................PSIAYWAPKHQ..IMEIDWK.fIKDI....iIQGE------.....................MHESF.RSL.....HRMWISMEKSRT-.P...........HL......FLPPGRN......................-QYLLNDELENEielm..............................enyyI---------------Spelpevqfsl...................lqaplkflhpKEDS.....TIFASA...LIEFVVWLDPPVYVSDNVARHIG.SYAG.IVNRGYFVSsafq..........kkdpQ.TLSLEQLLIE.GIIPPIKh.........................................sSTSRAPKIIHQW-..........-----EK..KF--DDSLYL.Q.VF...NL.DSKcn..................................tkaR..--RIDRIPFSNLFQVYGLIKILRQQLLFNKLYQSCF-n.......................................................................................................................................................................
MED1_ASHGO/10-150                    .........................................................................................................g-KMIAILVN...YKPGS....-ITLENITRLCQTMGL..ESFVD......................QVS....---ANISRLSIAS.KI.IVIDIDY........eVTD..G..KV.....I......DVKLVLASN......F......DK.....FD..YF-..................................................-NGEANILHRSLT.......................TYSDLH.EFHHNLKFLTLLDACSSIdie...snvSQFDL.FEYYS----------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------mlpqymqsy...............................................................................................................................................................
A1CW33_NEOFI/136-568                 .........................................................................................................e-DVVQLLRT...RISGR....SVCREGIERLVQLEGF..ESIWQ......................EDN....--------INIAG.NF.VDLEIEF........hRGQ..N..VV.....K......DVSLSYATP......D......A-.....TD..GER..................................................REEATAVLKRDLVqnpe..............dgergSWKSLT.GFHGNLQWLSKHDRLS--.........QEVNC.FEAIEGLYQSLKRV-------...-.WDEEQKl........................prFSSVFEHLCA-GSIGRPSLH...KGSRLG........................LSLDYWMHQAK..VLDAKHA..NSPPd...aMDIDRPANRA.....................LDEVA.EPQ.....NGKWFVMIECEE-.-...........--......GYPSLRV......................SKEWVDSDVLTVvnnaan.........................gsssneaAASDIAVVNWADPPPTLgsgg...............................sdamALDSn...mLGSSAL...NRRFVARMEPPLDVPILAASDIY.RHLG.IQLPHEFR-..................-.MVTYDGLLVP.GWSPLSAtgavglg.............................aeditqpGRKRRRTSVQGF-..........--DQEGN..PCTKHHSYTF.Q.AF...ES.VAG.......................................R..--TMRDIPFSHPRQLADVFPILRQYALLANLIHKIF-n.......................................................................................................................................................................
L8G3U6_PSED2/125-543                 ........................................................................................................mq--IVDTLKA...V-KGR....-VSEDGIERLARSVGL..ECLWE......................TGM....GRGGKSKTLIIAG.TG.LSIDIEF.........-TD..N..VV.....E......TVTLGFPES......-......PE.....SV..TRH..................................................ADQAGRILLDDLKlsk................detvLTKRVD.RFAGNLDRMARLDKLSVM.........PQLNC.HEAVAGIYDSLERL-------...HkWEVARLteee..................amsgkTQEQIVRAALLQKSGRPAMN...AHGNVG........................LCLEYWQERHA..TSQGE--..----.....----------.....................-----.--G.....CKTWSLLLECDQS.S...........SM......VYPPVRV......................SSAWISPSVAKSnpta..............................ddvlLSASDVVLDWQDPPNILltsnpdqk......................ddsgmegieQPGQ....lPNQKFP...DVRFVAKFSPPLTLPYSAAMQIY.DSTS.AHLEPDA--..................-.LAALDALAFP.PQTAETSepd.....................................gahRRIRKEQLVSVY-..........--NRAGE..HEKKCHTNTL.T.IP...KM.EYA.......................................L..--TLTEVPFSHPRELVQMLPILRQYTRLSTLLERSF-g.......................................................................................................................................................................
A0A068RT73_9FUNG/117-520             ..............................................................................................etveqamndret---------...-SKS-....KVQTRKLEKLAQSLGL..MVFVD......................TTQk..nDAGQPITTITLGG.TV.IVVDIDI.........DEG..G..SI.....L......KCKVTYVSE......-......V-.....IQ..SDQ..................................................DDRVDQMLAENLQ.......................-SQDYD.RFKRNLGALALLDQLNVK........yAPTDF.FLIMRAMMADMKSI-------...-.FDQEML..........................vASNDMA-SVLMEGHGIPNQH...FDY-PG........................LSISYWMCKEL..VLGNDWS..----.....----EVHGYI.....................TESKN.HPS....fSHASKLLISFEDSqK..........lNS......FIPPTRNkyll..............eydeSQDA-----VKE......................................GENGEHLDVVLEPNWPAlmqp..............................mrfvkMLPS....yPNVKPV...PIRFVAKLDPPVPAANVIVRKLM.VASG.IADDASVHTsqd............ppaV.TSSLENMLVD.-------...........................................--DNAPLDTTTT-..........--WTSTF..ENSTDQVYRW.M.GS...SL.TPG.......................................K..--LVRRVTFNHPSQIYTILLHLRQQQMFNTLFQSIF-h.......................................................................................................................................................................
K1PRJ6_CRAGI/75-412                  .........................................................................................................r-SCLDRLQSc.iKVVSQ....QTLLERLETTSRLVDL..SFS--......................---....PPTGTENSAIISS.EM.FRIEIIF.........DPG..G..LV.....K......DVRISHQGE......-......-P.....TS..CDE..................................................-------ITEVLR.......................-QGNFD.EFIVHLKGLQSIYNISGDr.......kQKSKA.YLALQALETDLNSLAQLQSSI...K.------...........................--------------GCP---...------........................MKLVYFVSPYD..LLNKRTR..SPHP.....MTVEAITEH-.....................-----.--Gl...gQSVTVCIEPHSHR.R...........LQ......TIPLMSV.....................vPQDGKSL-----......................................-------------PSFQ.......................................ALSQ.....VNSTSL...PACFTLMLARPIPVAMSVIHAIQ.EVTD.IDVITEGE-..................-.PESLLKLILA.QSSGG--...........................................--KLSPG------..........SEFFVTL..PD-QQHAYYLrD.IG...ES.SLD.......................................Q.tAKMVSRIPFTHPTNVANILNLLRQQLLFNTVISSCIR........................................................................................................................................................................
W1Q964_OGAPD/13-242                  ......................................................................................................sris----EILLK...R-PGR....-VTVDGIKRLANIYGF..ETFSDvlamneqndlvfafsdgrsaspEG-....RDGTQIERLSLSG.KI.LLIDIDF.........-QD..G..HV.....K......NVALSSAIS......I......ES.....ID..ARSydfv.........................................egfgdFVKVERVLYENLQ.......................-AATLD.NFNKNLRLLGQLDRLSVP.........APFDL.FNTFNLLTYNLLKAAEAEKQQ...HrQDPQDAl........................teSEAAADLACGVQGFGQVLVN...YDDKIG........................LFVKYWHDDRF..L------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------pglphpdy................................................................................................................................................................
A6RBM1_AJECN/1-232                   .......................................................................................................mni---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------------.........-----.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....---DQPTPDD.....................RKPAP.AKT.....HKTWRAAIECEE-.-...........--......GYPLLRV......................SKEWIAAELFTTmnngds..........................sltadgNDSEILLVNWIEPPATLvsnp..............................ndvplDSTA.....LGTTTP...NRRFVARLEPPIDMPIIAAAEVY.RLLG.MNMPVEPK-..................-.TVTYDGLVVP.LPNLTSTgdgqde...............................nslaapNGRIHEKVVYSF-..........--DDDCQ..PRKHRHIYTF.H.PF...EH.IVG.......................................R..--TIRDLPFSHPRQLADVLPILRQYALLSSLLHRVF-v.......................................................................................................................................................................
M3CJL5_SPHMS/1-303                   ..........................................................................................................---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.-----------MDRLCK-.........EQVDC.FEAMKGLHTSLEKLYELEKAA..vK.TLRELKg........................ssADAIAEREVLRKRSGRPSLH...GNGKIG........................LTLDYWTSNFD..PSVSKD-..--DS....aMDVDGPEDA-.....................-DTQA.DDS.....PDVWSLRVEAQSC.A...........AG......IYPPLRV......................SDAWLPETFELP......................................SPESADGIPWQDPPNTTvsasss...........................gtggdaM--Ai...dGGERLP...DLRFVAKLDPPVLLPLGIAAPVL.ASLG.DQYSQSTMF..................P.LYHLKLLGFH.--SGDMA...........................................FRVISESSVPVS-..........-GAPKDR..EEDALHEYVL.E.VS...KA.DLG.......................................Y..--TLEEVPFSHPRQLVELLPTLRQWARISILLKETF-d.......................................................................................................................................................................
B4LDA1_DROVI/78-453                  .........................................................................................................q-SALDKLQHy.iKVTSR....HGLVERLESLSRQLGL..KFMED......................---....-----QQMLFIST.DM.FYVEILL.........DAS..G..KL.....S......DVKVHHECK......I......EQ.....QS..NSS..................................................--ASSRELLNCLK.......................-AGDFA.DFTVQLEGLSSIYQLNAEp.......kVKKKA.YVALQAMETDIFNLYQHQLQQ...Q.------...........................---------ISGSSDSYYIM...NKSSVGlvqqr..............rgghpMKLTYFCPPLH..LIETKTK.gEKVG....aATGSGTASRDf..................siEQVMK.SPN....gLSATLNLEASSAN.K...........LQ......ILPILSF......................TSESGLP-----......................................----------LEQPGYA.......................................PLTQ.....NNSMLM...PATYVLRLSKPMPVCIDSLRALS.-LPG.LSGLSSEG-..................-.TTTVMNLIVQ.-------...........................................---TASRQVIKG-..........--TQKGL..YVNLPRETHC.Y.FL...TD.NRR.......................................L.kGTLISSLPFTEPAQVPKIIAFLKKQALFYTLLSSCVR........................................................................................................................................................................
A0A0E9NK52_9ASCO/106-266             .....................................................................................................grgvg---------...-----....QVTEDNVQLLAKSFGY..DTYLD......................PTS....----DKRTLSFGG.AT.MIIDIDF........iPPH..N..MI.....T......RAELTMVTP......-......NP.....LF..PAP..................................................NPAGDKILLDALK.......................-EKELG.SFARNLGVLARLDKVCTE.........GGCDA.FDIVSKLHEGLKEK--TGRE-...-.------...........................-----SRE---GTVGKVRAN...GNGLLG........................LGITYWSEK--..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------frgr....................................................................................................................................................................
G2Q8D8_MYCTT/1-388                   .......................................................................................................mgd---------...-----....----------------..-----......................---....---DDKKTLIIAG.SA.LELLIEF.........-SN..N..IV.....Q......SVALSFPDS......-......TE.....IV..NKH..................................................AEAAGEILFKDLQlre................gqspLTKSLE.KFAANFERLAVLDKLSS-.........PGLNM.FEAVAGVYESLCRL-------...HaWELKKAredp..................aaaakGEDYLESLVLCTKSGKPSMN...ARGRVG........................MTLDYWKERRL..QPPPTNP..DMA-.....----------.....................--AWV.AEH.....ERTWSILIGCAPL.R...........EI......GVNPVRI......................SDKWIGPNVEKMpl.................................pdeLHTRGPIIDWLEPESTFvpmpdq..........................skggdpmQPDAs...lLGPRLP...DAVFHATFDPPVHIPTALWEQIQ.QLGC.VMDETP-LK..................Q.LATFDSLVIP.HSPGSNPds......................................agaRTVTCKK-----Kt.......pyTAPGETK..LSFKSHVNTL.F.VN...KP.IPS.......................................R..--TLTEMTFSHPQQLVTILPYLRQYVFLATLLEHS--la......................................................................................................................................................................
G0SEC7_CHATD/118-567                 ..........................................................................................................EEVIHILSK...S-KGL....-VSEAGLERLARSLEL..EFMWE......................SSM....-GSDNKRTLIVAG.SA.LELLVEF.........-SQ..D..VV.....Q......SVTLNFPDS......-......PE.....IV..TKH..................................................AQKAGEILFNDLRlap................gqspLTKSLA.RFAANFERLAVLDKLSIN.........PGLNL.YEAVADVYESLARL-------...HaWELQKLredp..................slagkDDEYLENLVLCTKSGKPAMN...DRGRVG........................LALDYWKEKHL..LRTPDA-..EVA-.....----------.....................--SWI.ADN.....ERTWSILIGCAPL.R...........DL......SINPVRI......................SDKWIGPNVVKTsl.................................pdgLHTGEPIIDWLDPEPTFipatdqqqqqqq..............qqqqqqqqqqqqqQADAp...lLPPRLP...EVAFHAVFDPPVHIPINLWQHLQ.EMGC.VLPDETATQpf.............qqhH.FRSFDSLVIP.PPQGKETdate...................................trvfSCRKKTPFVPRRSgv......rnGEGATQK..MEYRIHQNTL.F.VP...KP.VMC.......................................R..--TLTEMSFSHPQQLVSILPYLRQYAFLAQLLENSFK........................................................................................................................................................................
B4GRY3_DROPE/48-406                  .........................................................................................................k-SALDKLQHy.iKVTSR....HGLVERLESLSRQLGL..KFM--......................---....---EDQQLLFIST.DM.FYVEILL.........DAS..G..NL.....S......DVKVHHECK......I......E-.....QQ..SSE..................................................-------LVKCLK.......................-SGDFA.DFTVQLEGLSSIYQLNAEp.......kVKKKA.FVALQAMETDIYSLYSHQMQN...RtGD----...........................---------------SYDIM...NSSAVGlvlqr..............rgghpMKLTYFCPPIH..LAEGESK.lASSE.....FSIDQVMHS-.....................-----.SHG.....LSATVNLEGSSAN.K...........LQ......IMPILSF......................SRDPQTG-----......................................----------LELPTYA.......................................QLNQ.....NNSMLM...PATYVLRLNKPMPVCYETLKGLG.-LPG.VEGMAAAPS.................pP.VATVLNLIVQ.-------...........................................---TASKQAIKN-..........--TQRGL..YVNLPKETHC.Y.FF...TD.NRK.......................................L.qGTLISSLPFTEPAQVPKIMTFLKKQALFYTLLASCVR........................................................................................................................................................................
A0A094DZY9_9PEZI/128-547             ......................................................................................................lvqi---VDTLKG...V-KGR....-VSDDGIERLARSVGL..ECLWE......................TGM....GRGGKSKTLIIAG.TG.LSIDIEF.........-TD..N..VV.....E......TVTLGFPES......-......PE.....SV..TRH..................................................ADEAGKILLDDLKlgk................getvLTKRVD.RFAGNLDRMARLDKLSVM.........PQLNC.HEAIAGIYDSLERL-------...HkWEVARLteee..................amsgkTQEQIMRVALLKKSGRPAMN...AHGSVG........................LCLEYWQERHA..TSQGE--..----.....----------.....................-----.--G.....CKTWSLLLECDQS.S...........SM......VYPPVRV......................SSAWISPSVVKSnptd..............................ddvlLSASDVVLDWQDPPNILlpsdpdqk......................ddsgmegieQSGQ....lPNQKFP...DVRFVAKFNPPLTLPYSAAMQIY.DSTG.AHLEPEAL-..................-.-AAFDALAFP.PQTAEPSepd.....................................gahRRIRKEQLVSVY-..........--NSAGK..HEKQHHTNTL.T.IP...KM.EYA.......................................L..--TLTEVPFSHPRELVQMLPILRQYTRLSTLLERSF-g.......................................................................................................................................................................
E3JQ96_PUCGT/357-642                 ........................................................................................................ss---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------------.........-----.---------------------...-.------...........................--------------------...------........................--IDYFMVFRK..LISDYHQ.hQSEQ.....---DQLGKTDepippir......vppsgiplT----.---.....-------------.-...........--......S-----VnqlkldlvyhynatdllkdaikT----------Ksshglai........................svaltptTTHASTHPDSLQPPPAPltt.................................ttaTTTS....sTGQAGT...KGLFTAHFYPPLAVGRVTAAALA.QVSA.IDLPPPSSPppp............pptT.--------TH.-SH---Hhdhggfsdhattsediy.........ledllvyqsmsslnphpNKTDW--------..........-------..----------.-.--...--.--DikasnwktkqfgkafdrglsqvycfldpeddgysgdpnsR.lGFLITQVRFDNLDSLLKIIKICQRQAIFNELFNSCF-n.......................................................................................................................................................................
K3VPF3_FUSPC/118-538                 .........................................................................................................e-TIIATLDK...K-KGL....-VSEAGLERLAQRIGL..DCLSE......................DTT...aPHGRKQRTLVIAG.SA.IQLDIIL.........-DN..N..VV.....Q......NISLAFPES......-......AA.....SV..TKH..................................................VSRASEILLKDLQllp................nqspLTKTLD.EFAVNLERLAVLDKLSII.........PGLDC.HEAITGIYASLERL-------...HqWDVAKLreep..................gmgskSNGALSTAAMCTRHGYPVMH...SKDRVG........................LALQYWKVLRH..IEPTSEQ..-M--.....----------.....................-ASFT.ASQ.....EQVWSLLIGCAPI.-...........-V.....dEVMPVRV......................SEDWISKDIVKAe...................................psMDPKRPNLDWQQPNNVVlpsteen........................knagmevlQPDL.....STARVP...QVMFTATFDPPIIMSHNDWSHLY.NIVN.IKAPQLYG-..................Y.LPTFDSLLFP.IPPGSNQdp......................................selRAISRKRDVRIY-..........--DKDQK..PAVKPHRNTL.Y.IY...KQ.VYS.......................................H..--RVTEIPFSHPQQLIYMLPLLRQYAFLATLLENSF-g.......................................................................................................................................................................
W9YJN5_9EURO/142-550                 ........................................................................................................lv---ADILKS...RVAGR....GVTREGVERIAQLQGF..TTLWD......................DEN....--------LTIAG.NA.VDLEVIFd.......aADR..D..RV.....T......DVSLNLNTS......D......S-.....EE..PQP..................................................QIRGSEILKDNLKplnm..............vlgspQWMSLD.TFESNLQYLSQLDHIE--.........GGAPC.FEAVTGLYDAFQKI-------...-.WNVERQk.........................fSGRTTRQHLRRTAVGRPSLD...RKPILG........................LALDYWCAKED..LQEKTAD.gEVEP.....----------.....................---SA.NAS.....PHLYTARIACEP-.-...........--......GSPSTVL......................AKQWVSESAITQdvd...............................tdgdIEAAKVRPDWQDPVDNAtgadq............................dvtadsD--Kp..atLSSTVL...DMHFVCHLLSEVYLPLNVAAHLN.VDLT.MVELKHEL-..................-.TVTYQTALQK.HFNTTQAgs......................................astSQERWPRTLPAL-..........--DEDHT..PQWRRHSYAL.H.SA...QH.AAA.......................................L.wCYPVKQLKFTHPRQLAAVIPILRQYALLWSILRSLV-d.......................................................................................................................................................................
MED1_KLULA/10-184                    ..........................................................................................................DEMIERLLN...YKPGS....-RTLPNVIKLCQTLGL..ESFVD......................QVD....---STKSRLSIAS.NI.VVIDIDY.........ENE.mE..TI.....L......DVKLVLASN......-......FD.....KF..NYF..................................................NEKGENILLTSLS.......................DVQDLK.AFHHNLNFLVFLDSFSNIdie...sghTSLDL.FKYYTDLPKMLQDY--I----...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------sdqhlpftvkmnenstfgvsiydaqgqtkimt........................................................................................................................................
J3NG50_GAGT3/125-561                 .........................................................................................................h-RILSILKE...S-KGR....-VSDAGLERLVRSVGL..EFLWE......................EGG....-GSDKSKTLIIAG.SA.LSIDIVM.........-AN..N..IV.....E......KVTLSFPDS......-......SD.....VV..SRH..................................................VEQAGRILLDDLKlgp................nespLTKKLN.RFAVNLERLAVLDKLSVI.........PGFNC.HEAIANIYGCLERL-------...HqWDMSKLradp..................amagrGEERLLTTALCSRNGQPGMH...KRGKVG........................LTLDYWREQHL..VPPPASD..---S.....--------TE.....................LRENT.EAT.....ERAWSIWVGCAPL.I...........AM......GYQPARI......................SDAWLSPAIEKHasmv.............................gedhlLMTANQLFDWQDPPNTVipgeg............................gdqqqqKT-DgmdvdNSGRLP...AVVFSAEFDPPVVMTLQDWEHIQ.QIAQ.-APLSEFL-..................-.HSTYDSLMFP.VPENSQHdp......................................tepRSITRLKEVAVYPplp...rgvtGATAAAE..PTKALHRNSL.F.IY...KP.VYG.......................................R..--TLSSVPFSHPSQLVEMLPRLRQYAFLSTLLERSF-g.......................................................................................................................................................................
A0A0A1NPB3_9FUNG/8-264               ......................................................................................vanlmnrqvepdlltilleg---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------------.........-----.---------------------...-.------...........................-------------HGIPCLH...LNYP-G........................ISICYWVDKSH..NDIDWEQ.vKEQY.....IQRDEY----.....................----H.-PI....lSQSSKLLISFEDCiQ...........EM......HYLPTTR......................SNYLL-------......................................--------EFDETEEDIdseqfkvvyen.................nypkfmsplrfV--Kp...lSSTPSV...QIRFIATLDPPIPMSDGLCQKIM.NLSG.MINTDSVI-..................-.---SDHAVAS.TTSTSVTs.........................................eTLSLEEMLVP---..........DIVPTKQ..YIHDKQIYKW.M.SS...SK.VSA.......................................K..--IVTRIPFQHPVQLYSIIQCLRQQEMFNILFKSIF-n.......................................................................................................................................................................
A0A0A2JIU8_PENEN/133-555             ..........................................................................................................EEVVQLLRA...RVSGR....GVSRESVERLSRLEDF..ESIWQ......................DDN....--------LNIAG.NF.VDLEIDF.........YPG.qD..VV.....K......DVSLRYATP......-......EY.....TE..GVR..................................................REEATAVLKRTLAqspe..............daecgKWRSLQ.KFHENLQWLAKLDKLS--.........QEVNC.FEALENLEENFRRI-------...-.WVEESKn........................gkHGGEYQHLCA-GVLGRPTMH...KGTRIG........................LGLEYWVEQAK..VLDAKRS.lPSPD....aMEIDPQHDQS.....................SKGEL.DDQ.....GRSWTVMIECEE-.-...........--......GYPSLRI......................SKEWVGSEVFTAgest..............................ellpSNGAAGSVNWLDPPQTTrlthg.............................nhdpmALDSs...mLESSPP...NRRFVGKLEPALDVPILAASEIY.RQLG.MQLPQEFK-..................-.MITYDALLVS.ESSPLTSpvs....................................spqiGRRKRRMSVHAV-..........--DSKGE..QYTKQHNYTF.Q.SF...ES.ITG.......................................C..--TIRDLPFSHPRQLADILPILRQYAVLANLIRKTF-h.......................................................................................................................................................................
W7IA65_9PEZI/102-511                 .........................................................................................................k-RVLKILKE...R-PGK....-ISEEGIKRVARRAGM..QYHTD......................SAG....-VVKGVHTLIISG.II.VVVDIDF.........-KG..G..AV.....T......RVALSFAET......-......SG.....PT..AEF..................................................SDRAAKILEQTLSpg..................sysMTSSLA.QFADNLERFARSDRLSHL.........PSLNC.FSAVTGLYVSMMKI-------...-.WE--KE...........................TASMGEVEAMCKGMGRPGMH...LRGKVG........................FCIDYWKERRS..IPTATAG..KGKG.....----------.....................--KGE.DES.....GRYWRVVVDVDEL.P..........nEG......YITPVRN......................SEDWVSDNVLKAad..................................glFSHDAYEVDWIEPPLNNye...................................paT--Kp...eVLARLN...NTRFIAKLDPPVVIGLQDEVEIL.NAAG.ASAMSQVM-..................-.PEPLETVLCP.KMRGSREplahsrvvhsgkdqtaifqvlrkyacfdtifhaafpqdispplG------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------ttskeqqaqqaqqqqqqqplkqqkedrmelddfladdtpskaipv...........................................................................................................................
A0A0N0DF56_9HYPO/118-538             .........................................................................................................e-AIITTLDK...K-KGL....-VSEAGLERLAQRIGL..DCLSE......................DTT...aPGGRKQRTLVIAG.SA.IQLDIIL.........-DN..N..IV.....E......NISLAFPES......-......AA.....SV..TKH..................................................VSRASEILLKDLQllp................nqspLTKTLE.KFAVNLERLAALDKLSII.........PGLDC.HEAITGIYTSLEKL-------...HqWDVAKLreep..................gmgskSNNALSTAAMCTRHGYPAMH...SKDRVG........................LALQYWKVLRH..IEPTNEQ..----.....MA--------.....................--LFT.ASR.....EQVWSLLIGCAPI.-...........-V.....dEVMPVRV......................SEDWISKDIVKAe...................................psMNPKQPNLDWLQPDNVVlpsteen........................knagmevlQPDL.....STARVP...QVMFTATFDPPIIMSHNDWSHLY.NIVN.MKAPQLYG-..................Y.LPTFDSLLFP.IPPGSNQdp......................................selRAISRKRDVRIY-..........--DKDQK..LAVKPHRNTL.Y.IY...KQ.VYS.......................................H..--SVTEIPFSHPQQLIFMLPLLRQYAFLATLLENSF-g.......................................................................................................................................................................
K9FWL6_PEND2/133-555                 ..........................................................................................................EEVVQLLRA...RVSGR....GVSRESVERLSRLEDF..ESIWQ......................DDN....--------LNIAG.NF.VDLEIDF.........YPG.qD..VV.....K......DVSLRYATP......-......EY.....TE..GVR..................................................REEATAVLKRTLAqspe..............daecgKWRSLE.EFHENLQWLAKLDKLS--.........QEVNC.FEALENLEENLRRI-------...-.WVEESKn........................gkHNGEYQHLCA-GVIGRPTIH...KGTRIG........................LGLEYWVEQAK..VLDTKRS.lPSPD....aMDLDPQHDRA.....................SKGEL.DDP.....SRVWTVMIECEE-.-...........--......GYPSLRI......................SKEWVGSEVFTVgest..............................ellpSNGASGSVNWLDPPQTTrlthg.............................nhdpmALDSs...mLESSLP...NRRFVGKLEPALDVPILAASEIY.RHLG.MQLPQEFK-..................-.MITYDALLVS.ETSPLTSpvs....................................spqiGRRKRRMTVHAV-..........--NSKGA..PYTKQHNYTF.Q.SF...ES.ITG.......................................C..--TIRDLPFSHPRQLADILPILRQYAVLANLIRKTF-h.......................................................................................................................................................................
A0A088AEF8_APIME/74-431              ..........................................................................................................QKCLDTLQHs.iKVTSL....QSMVERLESLTRQLGL..KFM--......................---....MSGPPGTELFISS.DM.FFLEVLL.........EPT..G..VV.....K......DVKIHHEGK......N......EQ.....QS..CDV..................................................-------LVSCLS.......................-RGDFL.DFTVQLEGLASIYQLNADk.......kVKCKA.FSALQSLESDLGILAQLQTFI...-.------...........................---------------KEPFNl.vHKSPVGilerr..............rgghaMKLTYFVSPFD..LIDQENR..----.....-TCDALSSEIv...................iKRK--.--I....gHSVTVCMEGSTAH.K...........LP......TSSIITV......................NRSPTGK-----......................................-----------STPSYA.......................................PLTG.....TNSSVL...PACFVLKLAKKMPMCMELVRRIQ.KVTE.LECGDISA-..................-.PHPLLSLIIQ.-------...........................................-------HASEGQl........dCRNNRGL..YVTLPDQQHC.Y.FM...TE.NKN.......................................M.eGVLVCSIPFTHPAHVPQILVYLRQQALFNTLIASCVR........................................................................................................................................................................
A0A093YIM8_9PEZI/127-547             ......................................................................................................kliq--IVDTLKA...V-KGR....-VSEDGIERLARSVGL..ECLWE......................TGM....GRGGKSKTLIIAG.TG.LSIDIEF.........-TD..N..AV.....E......TVTLGFPES......-......PE.....SV..TRH..................................................AEKAGKILLDDLKlsk................setvLTKRID.RFAGNLDRMARLDKLSVM.........PQLNC.HEAVAGIYDSLEKL-------...HeWEVARLteee..................amsgkTQEQIVGAALLKKSGRPAMN...AHGSVG........................LCLEYWQERHA..TSRG---..----.....----------.....................-----.-DG.....CKTWSLLLECDQS.S...........SM......VYPSVRV......................SSTWISPSVVKSnptd..............................ddvlLSASGVVLDWQDPPNILlpadpdqk......................ddggmegieQSGQ....lPNQKFP...DVRFVAKFSPPLTIPYSAAMQIY.DSTG.AHLEPDSL-..................-.-AAFDALAFP.ASTAEPSepd.....................................gahRRIRKEQLVSVY-..........--NRAGA..HEKRCHANTL.T.IP...KM.EYA.......................................L..--TLTEVPFSHPRELVQMLPVLRQYTRLSTLLERSF-g.......................................................................................................................................................................
F2UHE5_SALR5/300-445                 .............................................................................pecacvclvgtrcvaaddtwgfactnlat---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------------.........-----.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................---Q.....DGSKTP..fPAQHFLRLTKPVIVPSHLVSDLA.AVAK.LDESV--L-..................R.TKLPSQPILP.-------...........................................-------QATP--..........---TQQQ..HVVGHYFVSI.H.AD...ES.TTS.......................................S.tGAVVHELPFSSPEQLPPLLQILRQSVAFCALLKSAV-t.......................................................................................................................................................................
G3NMI4_GASAC/44-403                  ........................................................................................................vr--SLERLQDv.fNVSSM....KTMRSRLEMIAKQQGM..G-F--......................---....HL--TEATCYLTA.DL.FYLEVVL.........LPY..G..GV.....A......EVKVAPHGK......-......AP.....VP..SES..................................................-------FLQLLR.......................-SKEFA.EFSVKLAGLFTQYDIPGDs.......eTRLKL.FSSMQWLWKDLQQISQLPSVP...K.-D----...........................-SDPRVDVM-----------...NHGRSGcliae..............kedfpMTIQFYAPPTD..GMKTSDR..----.....---QETAAT-.....................-----.EPP.....VQAARVTVGVSD-.-...........--......AAHRLQ-......................-MASL-------......................................-LPQPPQLDPQGHPVFL.......................................SSAE.....APHETL...PACFLLKLQPAVPMTLSFVDKLR.HITD.IPIPDVDL-..................Q.WAPLPKLLTG.RSNGP--...........................................------GELPDEQ.........dTIFTVPL..PDGALHRYVL.L.AA...--.AWGea...................................paQ.rAAAVDSIPFTHPAHVPALLQLLRHQSAINTLLRSCI-g.......................................................................................................................................................................
M3WCB5_FELCA/59-426                  .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAVMYWKA...-.TN----...........................--AGPLDKILHGSVGYLTPR...SGGHL-........................MNLKYYASPSD..LLDDKTT..--SP.....IILHEN--NV.....................PRS--.-LG.....MNASVTIEGTSAMyKl........piAPl...imGSHPV--......................DNKWTPS-----......................................---------------FS.......................................LITS.....ANSVDL...PACFFLKFPQPIPVSRAFVQKLQ.NCTG.IPLFETQP-..................T.YVPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PIPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
J7RP93_KAZNA/11-321                  .........................................................................................................d-QMVKLFKV...YKPGE....-VTLENILRLCQTLNL..ESFIE......................DVG....---EGTERLSTAS.KI.IVIDIDF........dKME..G..KV.....K......QVKLVLAST......Y......NS.....FN..--Yyapd..........................................atgnPNKEDNILLNSLV.......................NFADLK.QFQANLQFLYLLDTYSQL.........DMENG.SSTTNGHGNNNNADSSANSTN...-.------...........................-----------PIGGGNSLSsttKNGKLD........................L-FKYYTELVE..FLGQYFI..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------dfniqlevtpnlnsifgiyihsgdqilaviklakakspttrlyeyvysketkrwinefpenyvnglslvmeiqdkavwfpreflsediiferlkdddfvapivdvlinnttegvngsisnrlfnts..........................................
H9J7D1_BOMMO/66-140                  ..........................................................................................................QKCLDSLQHs.iKITSL....QNLIERLQCLSRQLGL..KLV--......................---....-VGTSGVNLFISS.DM.FYLEILV.........ESS..G..SV.....K......DVKIHHEGK......-......--.....--..---..................................................-------------.......................------.------------------.........-----.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------vkc.....................................................................................................................................................................
A0A0L9SRG0_9HYPO/117-537             .........................................................................................................d-AILKLLAE...K-RGL....-VSEAGLERLAQRLGL..ELLAE......................EQT...tPGGRKTRTLAIAG.SA.MALDILL.........-DN..N..IV.....Q......SVSLSYHGN......-......AP.....SV..SRH..................................................MDAAGRILLQDLQllp................dqspLTKSLA.SFASNFERLAVLDKLSIV.........PGLDC.HEALAGIYDSLERL-------...HrWDLAKLrqe.....................sdkSEAELTVMAMCTLHGVPVMH...ARRKVG........................LALQYWKALRL..VPPSSDR..----.....----MK----.....................--AFT.QQD.....DKVWSLVVGCASI.D...........GL......GLPPVRV......................SENWIAKDVVKS......................................VDGHGFVLDWLEPDNLSlpqsddn........................kdaamdllQPDL.....STTRVP...RVMFTVSFDPPVVLPQNDWSRLY.LYAD.VSPPNMELGp...............rgA.APTFDSLLFP.VPPGTRLda......................................seaRVISRRRRVRLF-..........-SRDGGE..PVFRHHQNTL.L.VY...KP.VYS.......................................Q..--MVTEMPFSHPRQIVDMLPLLRQYAFLSRLLENSF-g.......................................................................................................................................................................
L9JWL8_TUPCH/1-218                   ...............................................................................................mkaqgeteghl---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------------.........-----.---------------------...-.------...........................--------------------...------........................MNIKYYASPSD..LLDDKTT..--SP.....IILHEN--NV.....................PRS--.-LG.....MNASVTIEGTSAMyKl........piAPl...imGSHPV--......................DNKWTP------......................................--------------SFS.......................................TVTS.....ANSVDL...PACFFLKFPQPIPVSRTFVQKLQ.NCTG.IPLFETQP-..................T.YVPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PVPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
H9J7D1_BOMMO/135-405                 .......................................................................................................egk---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------------.........VKCKA.FTALQSLEDDLCTLRQLQSFI..kDpWA----...........................-------Q-----VHKSPIG..fLQKRRGg.....................haMRLTYFVSPYE..LLDKDAG.lQPLTt..elLTTG-----Kptasn..........gfashgTP---.--AytpigHSATVLLEGSTAN.K..........lQLs....tIISNAQR......................SGKS--------......................................---NGP---------VY.......................................APLV....pQNSAML...PACFTLKLSQPTPLCSGLAKLIQ.ATTE.VEVSGDWA-..................N.AKPLLGLVVQ.-------...........................................-------QAYDK-..........--LVPGK..NIELNLSKGL.F.VN...--.LPKqtqcyf...........................vcerrgL.eGCIVNSVPFTHPSHVAALLACLRQQALFNTLLASCVR........................................................................................................................................................................
A0A0P7V018_9TELE/53-411              .........................................................................................................l-NCLERLSGa.lKVSSV....SAVVSKLETIARERGL..G-S--......................---....HLSPAGTECFLTS.DM.FYVEVLL.........-SE..E..GV.....Q......DVKVAQHKE......-......TP.....MS..CAT..................................................-------LLNLLR.......................-LNKFK.DFSMKLERLHSLYDIPADn.......eTKVKV.YTALQCLEKDLLKISNLPRSL...SdHN----...........................---PHVDTVLNGRTGKIIER...KEGN-P........................MSIEYYLCPND..LLKEKSH..---A.....---DQ-----.....................----C.TLG.....HVALVTAWTSSS-.-...........--......-PQRL-P......................MSSLISQ-----......................................----PPEIDAHGLPVFT.......................................TLGE.....DNSAIL...PASFVLKLSPPLPVTSSFVRRIE.HLTG.MAISESGL-..................Q.WKPFLQLLLG.TFLQEND...........................................CRESWEMGVAHF-..........----VML..PENRMHSYIV.S.GP...TDgTAG.......................................L.eGTLVLNVAFTHPAHVPKILELLRHQSALNALLTSCI-p.......................................................................................................................................................................
D5GDH3_TUBMM/2-94                    .................................................................................................lssppglsv---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------------.........-----.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.-DTLQAKLFP.--DSPSA...........................................TGVQRRLYVPTN-..........---GMEE..EEGIRHEYKL.H.SI...KS.ILA.......................................R..--QIFEIPFSHPKELAGVFSILRQFAHVSALFKSCF-s.......................................................................................................................................................................
E5R2V9_ARTGP/171-437                 .........................................................................................................s-EVLSMLRS...RVAGR....GVCREAVKRLSTLEGF..ECMWE......................KNN....--------LSIAG.NT.VDLEIEFgp....qdgAEA..D..VV.....K......DVTLRYATQ......D......M-.....AE..GEK..................................................REAASAVLKSVLTfsadta..........eeqiaagEWKAVD.AFHANLTRLARMDGLC--.........REVNC.FEAVEGVHESLQKV-------...-.WDSSGTgtgmdvdmdm......gtdadthpagrESRFWERLCWSSSVGCPTMH...RGENVG........................LAMHYWADQRR..LLAAQHT..SLEE....vLQADQPL---.....................KDSKGsSSR.....RQVYSAVIECEA-.-...........--......GYPSLRI......................SKGWQHE-----......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------tr......................................................................................................................................................................
A0A0G2HYM7_9EURO/72-499              ..........................................................................................................EEVIRLLRT...RVSGR....GVCREGVERLGKFEGF..ECMWQ......................DND....--------LSIAG.NF.VDLEVQF.........EDG.aE..NV.....K......DVSLKYTTS......-......SA.....LE..GER..................................................RVEATAVLKRDLIqtig..............gpaemPWKRLD.AFHANLHRLAKLDQLS--.........RDVNC.FEAIEGLYESLQRI-------...-.WEGEISr........................ypGRGHWEHVCT-SQVGKPGLH...QDKRIG........................LSLQYWAEQRR..TLDSKQR..SIPD....aMNIDQPPADD.....................KISAP.VDK.....HKIWSAAIECEE-.-...........--......GYPSLRV......................SKEWVAAELFTTvntves..........................ssaangNDSEILLINWTDPPATLvsnp..............................ndvplNSTT.....LGTTTP...NRRFVARLEPPIDIPIIAAAEVY.RLLG.LNMPPDPK-..................-.TVTYDGLIVP.LPHFVSPgdgqye...............................ntslssNGRIHEKVVYSF-..........--GDDGQ..PKKHRHIYTF.H.PF...EH.IVG.......................................R..--TIRDLPFSHPRQLANILPILRQYALLSSLVQKVF-t.......................................................................................................................................................................
F4NW87_BATDJ/149-503                 .....................................................................lersielttldlgiqfyateplnnttpatvtlcgtif---------...-----....----------------..-----......................---....-------------.--.----IEF.........GND..S..HV.....S......KVNLSIASS......V......N-.....--..-LT..................................................NSQAESLILDQLR.......................-LRKLN.DFKQTLALLSFLDTTSIP.........GQVDL.FQCISWIEKDLSDIFALEMSM..pE.------...........................---QTVGTVMVSGHGVPRFH...Q-EQWG........................PSILYWCHPSRtdILQDPIT..-VSK.....-----ETESKci.................ykAFVSM.EHS.....TETVFLAQSCTQ-.-...........YL......ITPSTQA......................DVDILGSSLPTS......................................MSLGGNLLRFLDPTHAN.......................................----.....--ACTA...NASFVLQLAPPIVVTLEAAKELM.RINN.DGMDGSDN-..................I.FESYTDLMKQ.-------...........................................-----YTPLQQ--..........-SISIKS..KIQQDQSSVF.A.FP...ES.ILK.......................................T.pALIASRIPFTSPVQLSRIYSILRQHIVFQHLYCSMF-t.......................................................................................................................................................................
S3CL37_GLAL2/117-528                 .........................................................................................................e-DVISILSV...S-KGR....-LSAAGVERLAQRLGL..EIMWQ......................DNM....--RDGSKTLIIAG.PAhLALDIDF.........-MS..D..VV.....Q......KVALSFPDS......-......PD.....IV..TRH..................................................TEKAGNILLEDLKigp................eestLTKSLN.RFAANLERLAALDKLSGN.........PGLNC.HEAIAGIYENLEKL-------...HeWEVQKVkads..................dmakkDHEFVQRAVMCTRSGKPVMH...SRDRLG........................LSLDYWQNKRM..ITRKRLK..----.....----------.....................-----.HEE.....EKTWSLLVECAPL.P...........SL.....tVFPPLRV......................SQEWISQKIVRDtaa...............................ndifAEALQPQLDWQEPDSTVvpak..............................adamgGVEG.....SKEKVL...DVIFMAKFDPPLIVPYSMAMTIY.NSTN.A--PFDMY-..................Q.TSRFDGLMFP.HSGDLVDsn.......................................asRTINSQTTIQI--..........PEREGRE..GQTRIHKNTL.L.ID...KI.GYG.......................................R..--TLTELPFSHPQQLVAMLPSLRKYAFLSSLLLKTF-g.......................................................................................................................................................................
A0A0D9N3H4_ASPFL/134-565             .........................................................................................................e-DVVQLLRT...RVAGR....GVCREGIERLGQLEGF..ESIWQ......................EDS....--------LSIAG.NF.VDLEIEF........yRAQ..N..TV.....K......DVSLNIATP......-......EA.....TD..GER..................................................-REATAVLKRDLIespe..............dggrsSWKTLT.KFHENLQWLAKHDRLS--.........QEVNC.FEAIEGLYESLKRI-------...-.WDEEGHh........................rkFSGIHDHLCS-GWVGQPCLH...QGGRVG........................LNLEYWVHQAR..VLDSKQK..KVSPd...dMAIDQPSVSS.....................MGGES.GHH.....NGKWNIIIECEE-.-...........--......GYPSLRV......................SKEWVNSEVFTVvnnnan.........................epssnemGGSDVAVVNWADPPATLssqg..............................qqdamALDS....gMLGTAP...NRRFVARMEPPLELPILAASDIY.RHLG.IQMPQEFK-..................-.MVTYDGLLAP.GWSPLSAagamglg.............................peeasqlGRRRRRMAVQSV-..........--DQDGK..PCTKQHSYTF.Q.PF...ES.VAG.......................................R..--TMRDIPFAHPRQLADILPTLRQYAFLANMIRNIF-s.......................................................................................................................................................................
G3XTB0_ASPNA/135-570                 ..........................................................................................................DDVVQLLRA...RVSGR....GVCREGIERLSDLEGF..ESIWQ......................EDS....--------LSIAG.NF.VDLEIDF.........HRG.yN..VV.....K......DVSLKYATP......D......A-.....QD..GEQ..................................................RDEATAVLKRDLIqspe..............egdrgAWKSLR.GFHENLQWLAKHDRLS--.........QEVNC.FEAIEGLYESLKRVWEAEWNH...-.----RK...........................FAGVYDHLCS-GWVGQPCMH...KGSRIG........................LSLDYWVQQAR..VLDAKEK.qKTSSd...aMVVDAPNGQP.....................SDDDS.SSL.....EGKWSIVVECEE-.-...........--......GYPSLRV......................SKDWVGSEVLTGvnnndn.........................gpssseaHGSEAAVVNWVDPPATLtnnqg.............................hpdamALDSn...mLGSSAP...NRRFVAKLEPALDLPILAASDIY.RHLG.MQLPQEFK-..................-.MVTYDGLLAP.GWSPLSAagamglg.............................peeasqlERRRRRMSVQSV-..........--DSTGK..PCTKHHSYTF.Q.PF...ES.VAG.......................................R..--TMRDIPFAHPRQLADILPILRQYAFLANLIRSIF-s.......................................................................................................................................................................
A0A096P5A9_PAPAN/1-207               ..........................................................................................................---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------------.........-----.---------------------...-.------...........................--------------------...------........................MNLKYYVSPSD..LLDDKT-..--AS....pIILHENNVS-.....................----R.SLG.....MNASVTIEGTSAMyKl........piAPl...imGSHPV--......................DNKWT-------......................................-------------PSFS.......................................SITS.....ANSVDL...PACFFLKFPQPIPVSRAFVQKLQ.SCTG.IPLFETQP-..................T.YAPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PIPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
D6RLP0_COPC7/115-264                 ........................................................................................................dw---------...-----....--CISRLQNWCELAGL..QAFLD......................DTK....--PKDTPTIILGG.NV.IVVDIDFvier.tnplKPR..V..SV.....S......RVKTSYAIP......S......A-.....QS..TST..................................................--ALDGFLLNIIQafcvevqq.......pedvrdpqKAAKLGeNVLLQLQYLVMLDQLTQRq......hdGGLKW.FTALDEV--------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------gptvegfa................................................................................................................................................................
F7G498_CALJA/1-284                   .........................................................................................................r---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAIMYWKA...-.TN----...........................--AGPLDKILHGSVGYLTPR...SGGHL-........................MNLKYYVSPSD..LLDDKT-..--AS....pIILHENNVS-.....................----R.SLG.....MNASVTIEGTSAMyKl........piAPl...imGSHPV--......................DNKWT-------......................................-------------PSFS.......................................SITS.....ANSVDL...PACFFLKFPQPIPVSRAFVQKLQ.NCTG.IPLFETQP-..................T.YVPLYELITQ.-------...........................................-------FEL---..........--SKDAD..PIPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
A0A072PQJ3_9EURO/138-551             ........................................................................................................wv---ANLLKT...RVAGR....GVTREGVERMAQLQGF..NTLWD......................DDN....--------LTIAG.NA.VDLELNFe.......aLSR..D..VV.....K......DVSLKLSTS......E......N-.....DE..PQL..................................................QEGGTKVLKENLAwsqf..............aepslPWTSLS.SFESNLHYLRQIDQIE--.........NGAPC.FSAVNNLYHAFQLIWNAEKQK..lN.WHAT--...........................-----QSHQRRGAIGRPFLD...RGSKLG........................LSLDYWTRRHD..PESDSS-..---D.....----------.....................-DSIQ.IDP.....RDLYTVQISCES-.-...........--......DTTPTLL......................PANWVSDQVLSEqtqa.............................asileADSDTLMPEWQDPTLDSgepkdps.........................gttsddvAMEN.....PGNSLPsmlSMHFICSLFPQIYLPLNAAAGLR.MGF-.AMLDLDQE-..................S.TVTYQQALQD.YCNRGRStdp.....................................gehTGERWPRDLPIA-..........--NATDR..SGFRRHSYAL.H.SA...QN.GAP.......................................L.wCFPVRTLKFNHPRQLAAALPVLRQYALLWSILQSLV-e.......................................................................................................................................................................
A0A094BT81_9PEZI/13-433              ......................................................................................................kliq--IVDTLKA...V-KGR....-VSEDGIERLARSVGL..ECLWE......................TGM....GRGGKSKTLIIAG.TG.LSIDIEF.........-TD..N..AV.....E......TVSLGFPES......-......PE.....SV..TRH..................................................ADQAGKILLDDLKlnk................getvLTKRVD.RFAGNLDRMARLDKLSVM.........PQLNC.HEAITGIFDSLERL-------...HrWEVAKLteeg..................amsgkTQEQIMRAALLKKSGRPAMN...AHGSVG........................LCLDYWQERQA..TSQGE--..----.....----------.....................-----.--G.....CKTWSLLLECDQS.S...........SM......VYPPVRV......................SSAWISPSVVKSnpta..............................ddvlLSASDVVLDWQDPPNILlpsdpeqk......................desdmegieQSGQ....lPNQKFP...DVRFVAKFSPPLTLPYSAAMQIY.DSTG.AHLEPDAL-..................-.-AAFDALAFP.PQIAEPSepd.....................................gahRRIRKEQLVSVY-..........--SRAGD..HEKHCHANTL.T.IP...KM.EYA.......................................L..--TLTEVPFSHPRELVQMLPILRQYTRLSTLLERSF-g.......................................................................................................................................................................
A0A010R431_9PEZI/121-547             .........................................................................................................d-TVIEILSK...A-TGR....-VSEAGLERLTLRTGL..TSMWD......................EHR...sPDGRKTKMLVIAG.QA.LTIDIEL.........-NN..N..IV.....E......NVSLGFPES......-......GP.....VV..TRH..................................................KDQAGNILLKDLQlrp................dqspLTKTLK.AFSANLERLATLDKLSVI.........PGVDC.QEALAGIFESLERL-------...HkWEMSKLredp..................amsgkPERFLETTAMCTKSGRPRMH...SRGMVG........................LSIEYWTERRH..VIPKARE..----.....----------.....................TTRYC.ENM.....EKAWSILIGCKAL.D...........GE......MFPPVRV......................SENWISQKVEKTepgp..............................edllVAASGPALDWLEPEPTTlpqtddn........................kdsgidvvQADG.....TTHKYP...NVKFVATLTPSVIVPQSVWNTLH.TLTG.AQAQPMPL-..................P.TYTFDSISFP.IPEGSHHda......................................selRVISCKRRVPIP-..........--SNDST..VSSRKHKNTL.L.IY...KP.VYG.......................................Q..--TVTELSFSHPRQLVAMLPILRQYALISTLLERSF-g.......................................................................................................................................................................
E5A9R6_LEPMJ/88-534                  .......................................................................................................rlq-NILQTVGA...K-PGR....-VSEAGLLALCKSMGI..ACE--......................RA-....PDDPGTWSLLI-G.DE.ILCDVTF.........-KN..D..EI.....Y......NVSLQTRLD......E......SK.....PE..LRF..................................................GATGSQILMKSLRplp................gqskINNTLD.RFAESLGKLNALTVLGTEh.......gGGVSC.YDAIAGVYTSLRRLFEHEKKAa.lA.---AREpd......................erfRSHKAEREVLCKKSGRPRMN...GGSCLG........................LSLEYWMERRH..LIPKDAS.vQSEK.....--GKEKVSDEvn.................gtTEGAA.ADD.....EGLYSLTIECESC.Q...........ST......LYTPIRV......................SDEWIGESIEKAvdandt..........................nasidnILLNRPSINWLDPKPTYldts..............................aqgedAM-Ni...dSAGRLP...NIRFVAKFNPPLIVPLAVHMQLY.QIVG.IEPRMEDY-..................K.PMTFVGLALR.PGDE--Dpgsma................................tagestLEIQSSRTVLYR-..........--DTEGR..EKSRTHDMSL.Y.VP...KM.EYS.......................................R..--TLDSLPFSHPKQLVEILPTLRQYAATTSLMRDAF-........................................................................................................................................................................
D6WVF3_TRICA/68-424                  ..........................................................................................................QKCLDTLQHs.iKVTSL....QSMIERLESLTRQLGL..KFM--......................---....-VGPSGVELFISS.DM.FYLEIVL.........DQT..G..AV.....K......DVKVHHDSK......L......EQ.....QS..CAE..................................................-------LVNCLS.......................-SGDFA.DFTAQLEGFASIYQLNAEk.......kVKCKA.FTALQSLESDLSTLAHLQSFM..kEpF-----...........................-------------------Nl.lYKSPVGvlekr..............rgghpMKLTYFVSPYD..LLNVEKC..DIEP.....ITVDTIVSK-.....................-----.--Al...gYSVTVCMEGSATH.K...........LQ......TTTLITV......................NRNINGK-----......................................-----------STPSFS.......................................SLSS.....QNSAAI...PACFVLKLNKPMPMCVNLVRQIQ.QVTE.LDTIEQSA-..................-.THPLLSLIVH.-------...........................................-------HASEGKm........eSGNNKGL..FVTLPDQTHC.Y.FM...TE.NKN.......................................M.dGVLVSSIPFTHPAHVSQILVILRQQALFNTIIGSCVR........................................................................................................................................................................
V8P8M2_OPHHA/15-383                  ................................................................................................nsgghqnlit--CLETLQKa.lKVSSL....PAMTDRLD-------L..G----......................--S....HLSANGTECYITS.DM.FYVEVHL.........DTT..G..QL.....R......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQNLR.......................-ERNFN.EFSKHLKGLVNLYKVPGDn.......kLKTKM.YLALQSLELDLSKMAGMQATN..aSpLD----...........................-------KILHGSVGYLTPR...SGGHL-........................MNLKYYVSPYD..LFEEGT-..-GAP.....IILNE--NNV.....................PRYLG.---.....MNVCVTIEGTLTM.N...........KL......PIAPLIM......................GTHPVDN-----......................................----------KGTPSFS.......................................SVTS.....ANSVDF...PACFFLKFPKPVPVSQAFIQKLQ.NCTG.IPLFDTPP-..................T.YVPLYELITQ.-------...........................................-------FELSK-..........--EEEED..PCPLHHTMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLLNKIAFHHPSRVPLILSMIRHQVAYNTLIGSCVK........................................................................................................................................................................
J3K1M4_COCIM/136-554                 ..........................................................................................................DEVLQLLRT...RVAGR....GVCREGIERLGKLEGL..ECMWQ......................DND....--------LSIAG.NS.LDLEVEF.........EPG.qE..IV.....K......NVTLRYATP......D......A-.....PE..GER..................................................RVEASEVLKRNLMqgpg..............eqeggHWKSMA.EFHENLRRLARLDQLS--.........REINC.FEAVEGIYECLRRI-------...-.WDEEKKh........................gtRQSHLDHICK-GWIGKPSMH...GGKHVG........................LMLRYWVDQRR..MFEAKQV.pPSNA.....MDTDLPAQD-.....................-DEEV.PDK.....ANFYSAAIECET-.-...........--......GYPSLRV......................SKEWVSADVFTEirne..............................dggdNGLEIRMINWTEPPPTLvsplsn..........................npdsvalEPTI.....LSSTAP...NIRFVARLEPPVDMPIFAAVEIY.RAIG.ANMMQESK-..................-.TTTYDSLVVP.-SQGDSNfie.....................................fegRQVMQKREISTF-..........--GADGK..PVKQRHTYTF.N.TF...EQ.VPG.......................................R..--TIRDIPFSHPRQLADVLPILRQYAFISSLLRRIF-s.......................................................................................................................................................................
K2SC68_MACPH/159-596                 .........................................................................................................e-HIIATLKA...R-PGR....-VSREGMERLARQLGLssEVMSD......................SHG....-----EQQLLLAH.TS.FMLDIAF.........-RD..N..AV.....E......NVSLQFGEL......-......SD.....GV..QRH..................................................KASAGRLLKDDLSpap................gqarINLSLD.RFARNLERLARLDHLSIFkd.....gkPEVSC.FEAVAGVYNSLQKLFEHEKKAa.mHlFDVSKP..........................hVHEKAAREVLCKKSGRPRMN...VNSAVG........................LSLEYWMERRL..VFQKPEK..KEAA.....--GNDTSMDVd...................gEDEYD.ESP.....NRIFSLTIECESS.P...........AQ......LYPSIRV......................SDAWISDAVEKPsd..................................pnDLFGSPVIDWLDPPPTYsggsea...........................aqddpmALDG....nNIGKLP...NVRFVAKLNPPLVVPLNTAQNIL.ASVN.VQMNQESLK..................W.STSLEALVLK.PDEAATSlaa.....................................ditKEYHNIRNVFVV-..........--DKDGK..EQDRRHETTL.Y.VN...KA.EVA.......................................C..--ILDEIPFDHPRQLVQILPVLRQYAHLSTLLQSAF-q.......................................................................................................................................................................
H2NUA6_PONAB/59-426                  .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....VS..CLE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAIMYWKA...-.TN----...........................--AGPLDKILHGSVGYLTPR...SGGHL-........................MNLKYYVSPSD..LLDDKT-..--AS....pIILHENNVS-.....................----R.SLG.....MNASVTIEGTSAMyKl........piAPl...imGSHPV--......................DNKWT-------......................................-------------PSFS.......................................SITS.....ANSVDL...PACFFLKFPQPIPVSRAFVQKLQ.NCTG.IPLFETQP-..................T.YAPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PIPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLISKITFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
A0A0F8BTG9_CERFI/1-375               .........................................................................................................m---------...-----....----------------..-----......................---....-----------AG.KM.FSVEVNL.........-RN..N..IV.....V......DVQLLFDES......-......AE.....IV..KQQ..................................................SPRAAEILKQDLQlep................yqspLTKTLD.QFAVNLERLHSQDKLSVV.........PGFDC.QEALASMSLSLHKL-------...YdWDLEKTrmel...................apssGEEAIVNAVMCTRHGRPHLH...ARGSVG........................LSLQYWKEKRL..APANPAI.vK---.....----------.....................---VV.EET.....ELVWSLLIMCAKA.Pm.........gTM......PFALARV......................STEWIAPDVAKPnpma..............................eetlQSVTGVVLDWQHPNNTV.......................................LPDEt...gMGPKYP...DIVFKAILDPPVVLPQSVFVQVM.QAVG.QAPMDHQA-..................P.SSTFDALFFP.SQAPSSAagssiv..............................thdpsepRKISSKRKIRRL-..........--DIGGG..ESTALVDTTL.F.VY...KP.VYG.......................................Q..--VLQEIQFAHPQQIIELLPVLRQYAFVATLLRNSF-p.......................................................................................................................................................................
A3LUJ1_PICST/9-423                   .........................................................................................................e-NSLSSLYD...YSSNF....KVSIDLVQRLAHQLKL..ETFVDklgy.............tvdaaHQT....PGGGKTQRLTIAG.TS.ILIDIDF.........VDD..N..DI.....V......NVSLSLANH......T......SS.....SS..SISevknpnshiksstqdangvt.........nllidpaknpvsffqqgtsgsASIAEEILLSNLR.......................-SKKLN.SFPVNLKYLAGMDKLSS-.........SSVDV.FSFLERVALLLYTISSVQSTNd.pRdWL----...........................-----LSEGYITSTGKIRINd.dNKQQLG........................VFSDYWQDNRY..INHENGD..-KTN.....LVGKNYNMLLkivss...........hreskLDYFE.ENR.....TKVWDLHSP-QG-.-...........--......GYKPYRF......................DFDVTSN-----......................................-----------------.......................................----.....-PDFLPg.nNLSIELVLNHPVYLPVYLLEYLG.L---.LDYKKKKT-..................-.-GT----IVD.-------...........................................-------EMFETLn.......tgDEIVNKV..ILESNSEISF.K.IA...HN.FTS.......................................N.nVAPIKSVVINQLTDLAILIPNFRNFLVLANIYRSLC-d.......................................................................................................................................................................
B0WMI0_CULQU/153-215                 ...............................................................................................niakglfvtlp---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------------.........-----.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..-----DQHHC.Y.YM...NE.NKN.......................................L.eGIVVSSIPFTEPQHVSKILVFLRQQALFNQLLSSCIR........................................................................................................................................................................
MED1_YEAST/12-300                    ..........................................................................................................DSMIELFKD...YKPGS....-ITLENITRLCQTLGL..ESFTE......................ELS....---NELSRLSTAS.KI.IVIDVDY........nKKQ..D..RI.....Q......DVKLVLASN......FdnfdyfNQ.....RD..GEH..................................................--EKSNILLNSLT.......................KYPDLK.AFHNNLKFLYLLDAYSHI.........-----.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------esdstshnngssdksldssnasfnnqgkldlfkyftelshyirqcfqdnccdfkvrtnlndkfgiyiltqgingkevplakiyleenksdsqyrfyeyiysqetkswinesaenfsngislvmeivanakesnytdliwfpedfispeliidkvtcssnssssppii.
H3AUB1_LATCH/1-254                   ..........................................................................................................---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------------.........----M.YLALQSLELDLSKMAYMFWQA...-.T-----...........................-NASTLEKILHGSVGYLTLR...SGGHL-........................MNLKYYLSPYD..LFDEETG..----.....IQINMGDNNV.....................PRS--.-LG.....MNVSVTIEGTTAM.S...........KL......PIAPLIM......................GSHPVDS-----......................................----------KGTPSFS.......................................SVTN.....TNSVDL...PACFFLKFPRPIPVSRSFIQRIQ.NCTG.ISLFDTAP-..................P.FVPLYELITQ.-------...........................................-------FELSK-..........--D--SD..SVPLNHNMRF.Y.AS...--.LPGqqhcyflnk....................daplpdgrclQ..GTLLSKIPFRHPGQVPPVLDLIRHQVAYNTLIGSCVK........................................................................................................................................................................
G9NVY3_HYPAI/132-571                 .........................................................................................................d-HILELLNQ...K-KGF....-VSEAGLERLAQRLGL..ELLSE......................ENT...aPDGRKKKTLAIAG.SA.IAVDIVL.........-DN..N..IV.....Q......NVSLAYHGS......-......AP.....SV..HKQ..................................................MEAASQILLTDLKlgp................nqspLTKTLD.KFAYNFGHIANLDKLSII.........PGLDC.YEALAGIHTSLERL-------...HqWDMANLrkep..................emegkPDHYLSLAALCTRHGYPVMH...ARNKVG........................LALQYWKELRF..VPPSNDK..ISSP.....----------.....................-----.WEK.....EKIWSLLLDCAPM.Eal......glpTTie..tiGLPPVRV......................SEDWISKDVAKEvhqd.............................pgqalNPTSFPILDWQEPENISlpssde..........................nksatigV--Lg...lDLSISP...QVMFTVTFDPPVILPQNDYARLY.AYAG.AEPPSPDPSef.............eqrS.PPTFDDLFFP.MLAQNKQdp......................................sesRTVHRLRDVRVF-..........--DQQGK..SSMRSHHNTL.F.IY...KP.IYS.......................................R..--TITQMPFSHPRQLIDMLPLLRQFAFLSTLMNNSF-g.......................................................................................................................................................................
W4W4N7_ATTCE/74-432                  ..........................................................................................................QKCLDTLQHs.iKVTSF....QSMVERLESLARQLGL..KFM--......................---....MSGPPGTEIFISS.DM.FFLEVLL........ePPS..G..LV.....R......DVKIHHEGK......S......EQ.....QS..CEA..................................................-------LASALS.......................-HGDFV.DFTTQLEGLASIYQLNADk.......kVKCKA.FSALQSLEADLGILAQLQTFM...-.------...........................---------------KEPFNl.vHKSPVGilerr..............rgghpMKLTYFVSPYD..LIDEENR..---T.....----YDALN-.....................SDTII.KRKi...gHSVTVCMEGSTGH.K...........LP......TSSIITV......................NRSPTGK-----......................................-----------STPSYA.......................................PLTS.....TNSSML...PACFVLKLVKKMPICMELVKRIQ.KVTE.LECGDISA-..................-.PHPLLSLIIQ.-------...........................................-------HASDGQl........dCRNNRGL..YVTLPDQQHC.Y.FM...TE.NKN.......................................M.eGVLVCSIPFTHPAHVPQILVYLRQQALFNCLIASCVR........................................................................................................................................................................
A0A087X782_POEFO/91-461              .........................................................................................................l-NCLETLQRa.lKVSSL....PSMTDRLESIARQNML..G-S--......................---....HLSTTKTECYITS.DM.FYVEVQL.........DTG..G..QL.....V......DVKVAHQGE......-......NP.....TS..CSE..................................................-------LIQHLS.......................-EKNFE.AFSKHLKGLVDLYRLPGDn.......kLKTKM.YIALQSLELDLTKMMTMFRLA...-.TN----...........................--ANTVETILHGSVGWLTPR...SGGNL-........................VSLQCYVSPYD..IFEVETG..---S.....-QLSLPDNNV.....................PRS--.--L....gVSVSVTIEGTSAVyKl........piAPl...itGSHPVDNkgtps............fstvsN-----------......................................-----------------.......................................----.....SNSVDL...PACFFLKMNRPMPFSLSFIQRLG.SATS.IPVFETPP-..................P.LSLLYQLIVQ.-------...........................................-------SQLQLL..........EE--GSA..TPATLNNMHF.Y.SI...--.LPDqhhcyflng....................dapvqdghslQ..GAMVSKIPFRHPAHVPLLLDIIRHQAAYNTLIGSCVK........................................................................................................................................................................
E9G2Z9_DAPPU/46-408                  ..........................................................................................................QKCLDLLQTn.mKVTSL....QSMLERLESISRQAGL..KFT--......................---....-ADGSGRAFFISS.DM.FYLEVIV.........EQG..G..SV.....C......EVHIQHEGK......S......EP.....QT..CIE..................................................-------IAVCLN.......................-SGNFS.KFTSHLQGLCAIYQVSADk.......kLKAKA.FAALSALEMDLVSVSKLQAYR...-.QD----...........................----IVTLVH-----KSPLG..iLMPRVGg.....................lpLTLTYFLSPYD..LVNVQS-..---P.....-TIAM---T-.....................QEKII.EN-.....NAGISCTLGIDSS.Tn.........fQL.....pISPLFSV......................NRNSDGE-----......................................-----------SVPAFS.......................................PLSA.....TNSASL...PANFVLRMRDPLVLCFSFAQQIK.SITG.MEIGNWDE-..................P.EYLFRSLVKT.VSKGQMEc.........................................pGNEDRISRALHV-..........------T..LPDQQHSYFI.T.ES...ED.VAL.......................................K..CCCITSIPFCHPSHVPQILAILRRQGLLNVLLSSCIR........................................................................................................................................................................
A0A0N0NIG8_9EURO/2-104               ...............................................................................................levdpqkaity---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------------.........-----.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----QQTLQE.KR----Nlaasr.................................amdtaNEDRWKRRVTYV-..........--DSAGK..FSWHNHAYKL.Y.SS...TQ.DHD.......................................L.wCYPISKLRFNHPRQIADVLPLLRMHVVVWTLLDSV--a.......................................................................................................................................................................
G3R077_GORGO/194-400                 ..........................................................................................................---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------------.........-----.---------------------...-.------...........................--------------------...------........................MNLKYYVSPSD..LLDDKT-..--AS....pIILHENNVS-.....................----R.SLG.....MNASVTIEGTSAVyKl........piAPl...imGSHPV--......................DNKWT-------......................................-------------PSFS.......................................SITS.....ANSVDL...PACFFLKFPQPIPVSRAFVQKLQ.NCTG.IPLFETQP-..................T.YAPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PIPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
Q4WQK4_ASPFU/136-568                 .........................................................................................................e-DVVQLLQT...RISGR....SVCREGIERLVQLEGF..ESIWQ......................EDN....--------INIAG.NF.VDLEIEF........hRGQ..N..VV.....K......DVSLSYATP......D......A-.....TD..GER..................................................REEATAVLKRDLVqnpg..............dgergSWKSLA.GFHGNLQWLSKHDRLS--.........QEVNC.FEAIEGLYQSLKRV-------...-.WDEEQKl........................pqFSGVYEHLCA-GSIGRPSLH...KGSRLG........................LSLDYWIHQAK..VLDAKHA..NSPPd...aMDIDTPANRT.....................LDEVA.EPQ.....NGKWFLMIECEE-.-...........--......GYPSLRV......................SKEWVDSDVLTVvnnaan.........................dsssneaAASDLAVVNWADPPPTLnsgg...............................sdamALDSn...mLGSSAL...NRRFVARMEPPLDVPILAASDIY.RHLG.IQLPHEFR-..................-.MVTYDGLLVP.GSSPLSAtgavglg.............................aeditqpGRKRRRMSVQGF-..........--DQEGN..PCTKHHSYTF.Q.AF...ES.VAG.......................................R..--TMRDIPFSHPRQLADVFPILRQYALLANLIYKIF-n.......................................................................................................................................................................
Q0CSY8_ASPTN/134-565                 ..........................................................................................................DEVVQILRA...RVAGR....GVCREGIERLGQLEGF..ESIWQ......................EDS....--------LNIAG.NF.VDLEIDF........yRGQ..N..IV.....K......GVSLKYDTP......-......EA.....AN..GEP..................................................REEATAVLKHDLVqtpe..............dgergSWKSLA.GFHENLQWLARHDRLS--.........QEVNC.FEAIEGLYESLKRV-------...-.WEEEKKh........................ckVSGVYEQLCS-GWVGRPGLH...QGGRIG........................LSLDYWVHQAR..VLDAKQK..KTSPd...eMVVDQPAGQ-.....................PDDQL.ARG.....NGGWSVVVECEE-.-...........--......GYPSLRV......................SKEWVNTEVMTVvnngn...........................essadhAGSSVAVVNWADPPATLapgsq............................ghsdamTLDS....gMLGSAP...NRRFVARLEPPLDVPIIAASDIY.RHLG.IQMPPEYK-..................-.MVTYDGLLAP.GWSPLSTagamglg.............................pddmsqfGRKRRRLEVEAV-..........--DKDGK..PCTKKHSYTF.Q.PF...ES.VAG.......................................R..--TIRDIPFAHPRQLADILPTLRQYAFLANLIRNVF-a.......................................................................................................................................................................
M7P725_PNEMU/33-386                  ......................................................................................................dvai----HALEE..gKIDDF....-ISAEALETLGKKEGL..ECF-Q......................DKY....---ENKVTISLGG.KI.IVIDIDLe......kfSIY..W..KV.....I......RVTTTWADC......K......GG.....Q-..-YF..................................................SPSTDAILLANFS.......................ESYRLN.LFKSNFQRLLRFDRLSSP.........PIWDA.FSAIRSLYVAFEQIYGYELEI...Y.KD----...........................-----PEKILCEKFGKPEFD...VANIVG........................LTLWYWKQRRY..CSTE---..----.....----------.....................-----.---.....EKLWRVIIEVEEQ.Dt.........tAS......SISPA-V......................NIQWIDQKI---......................................-TLLNGDYNWMEPSSSF.......................................----.....----SS...SCQFVMILDPPVIVCTEDIKQIS.RIIK.-SYDFISQNdl.............eknN.YQVYETILTS.-------...........................................------QSLPIQ-..........TERILYL..PFS-VTQHQL.Y.TL...EK.STL.......................................S.pACHLNRIPFSHPKQIHSILKLLRKYILFQTLTESYI-n.......................................................................................................................................................................
J5JGW1_BEAB2/127-551                 .........................................................................................................e-NIIKMLNQ...K-KGM....-VSEAGLERLAQRLGM..ELLSE......................EHS...tPGGHKTKTLAIAG.SA.VALDIVL.........-DN..N..IV.....Q......NATLSYHGN......-......AD.....CV..TKH..................................................IDAASQILLRDLQllp................gqspLTKTLE.RFAMNFERLAKLDKLSIV.........PGLDC.HEALASMYSSLERL-------...YeWDLEQLrrdp..................amagkPDSLIATAAMCTRHGKPVMH...ERGQVG........................LALQYWKETRF..IAPPAGQ..----.....----------.....................---EA.NNK.....SKVWSMLLGCAGI.D...........GV......GLPPARV......................SENWISKDIVKHd...................................elGHTLTPLLDWLEPDHVSlpqsden........................kdasmdmlQADL.....STTRVP...RVMFTATFDPPVILPQTEWARLY.ALAG.VEPPNMNPSnd.............fnrQ.PPTFDALFFP.ITPGTRQdp......................................seaRTITRQHQVPMI-..........--NTYNE..PLIRTHQNSL.F.IY...KP.IYS.......................................Q..--ELSELPFGHPRQLVDMLPVLRQYAFLSTLLESSF-s.......................................................................................................................................................................
E2R4P0_CANLF/59-426                  .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAVMYWKA...-.TN----...........................--AGPLDKILHGSVGYLTPR...SGGHL-........................MNLKYYASPSD..LLDDKTT..--SP.....IILHEN--NV.....................PRS--.-LG.....MNASVTIEGTSAMyKl........piAPl...imGSHPV--......................DNKWT-------......................................-------------PSFS.......................................SITS.....ANSVDL...PACFFLKFPQPIPVSRAFVQKLQ.NCTG.IPLFETQP-..................T.YVPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PIPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
N1JH11_BLUG1/116-521                 ........................................................................................................em--VSEILKA...N-KGR....-VSEPGIERLARRVGF..ECLWE......................SHN....TSGSIRRTLIIAG.ST.LALDIDF.........-EN..N..VV.....K......KVSITFPDS......-......PE.....IV..TRH..................................................TDIASDLLLKDLTiqv................nenpLTKMLN.RFAENLERLAALDKLSVL.........PDLNC.HEAIAGIFESLNRL-------...YrWETEYHrk.......................ieENGDIEKLIMCAKSGRPAMH...TRERVG........................LSLDYWQDLWR..LKSN---..----.....----------.....................-----.-PQ.....ENIWSILIECDTI.L...........DL......VYTPIRI......................SENWISTEVEKKdthd.............................qdemmTPNLEPILDWLEPESTLlpst..............................nadsmS--Eig.vqRGQKFP...DAMFVAKFYPPLTIPSSLAIQIY.DSVQ.ATL--DIY-..................Q.TTTYDRLIFP.PKIDEKIsl.......................................dsRSIYCDVQVPTY-..........--PKPGQ..KVLKDYKFSL.H.FE...KI.DYG.......................................R..--TLKELPFSHPRQLVQMLPVLRQYAVISRILQNT--ss......................................................................................................................................................................
S9W278_SCHCR/301-360                 .....................................................................................nqttagypsmnkshiiylggi---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------------.........-----.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...-D.IPA.......................................R..--SVHRIPFSHPRQILGIFQHVRQYLALQTIFENV--k.......................................................................................................................................................................
A7S6R2_NEMVE/284-473                 ..........................................................................................................KECLDKLQHa.lRDNSI....KVVVQRLEAITRNVGL..KFY-D......................NG-....----NGTDCFISS.DM.FYVEVKM.........ETN..G..KV.....S......EVKVAHAGD......-......-P.....ES..CPE..................................................-------LTRVLR.......................-EGDYE.EFACHLKGLSDLYELSGDt.......fQKSKI.LMALKAAEVDLNMISALSGPC..dT.------...........................----STDTILQCPVGFATPR...QGGRL-........................MRLTYFASPYD..LLDRNNP.gKNLE.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------fskdnnsik...............................................................................................................................................................
S2JQM3_MUCC1/122-515                 ........................................................................................................kt------LREk.eESKSK....-IETQRLEKLAQSMGL..VTFVD......................STQk..fESNVPITTITLGG.TI.IVIDIDI.........DDK..G..RV.....L......RTKVTYVSD......T......M-.....-Q..NDQ..................................................DDRVDLMLTENLQ.......................-NRQFE.LFKRNLGSLALLDKLNVK........yNPVDF.FSIVKHLLTDLRTICNEEISM...-.------...........................-EPEF-KNVLLQGHGVPNLH...LNYP-G........................ISIAYWMDKEH..VDSVPWE.eAKTA.....---------F.....................ETGIS.HTA....lAEASRLLISFEDS.I...........QPv....tYLPSSRPscl...............lgndSEDSIDQ-----......................................-EQFKVVTETAAPSFMPhvk.................................fikALPT....hPEYQPI...PIRYVVTLDPPVPVSDEVCQKLM.NVTG.LSSLDTVSQvp.............yspS.TMSLEDMLVM.-------...........................................--HVADTALFSNN..........WISSFDD..MP--EQSYTW.M.KS...SP.TSA.......................................K..--MVSRIPFQHPVQIYNIIQCLRQQQMFNTLFKSIF-n.......................................................................................................................................................................
C7YRS3_NECH7/118-538                 .........................................................................................................e-TIIEVLNK...K-KGL....-VSEAGLERLAQRIGL..DCLSE......................DHT...aPNGRKQRTLVIAG.SA.IQLDIAL.........-DN..N..IV.....E......NLSLAFPES......-......AP.....SV..TKH..................................................VDRASQILLRDLQllp................sqspLTKTLD.KFAINLERLAVLDKLSII.........PGLDC.HEALAGIYGSLERL-------...YqWDVAQLsqep...................ginkSPSALSVAAMCTRHGFPIMH...PRERVG........................LALQYWKTLRL..IQPTTDK..-LA-.....----------.....................--SFA.EER.....EKVWSLLIGCASI.G...........GM......GHQPVRV......................SEDWISKNVVTTe...................................ptLDPKKPNLDWLEPDNVVlppseen........................kdagmemiQPDL.....STARVP...QVMFTVTFDPPVILPQNDWMRLH.ALAN.VNAPPIFG-..................Y.PPTFDGLFFP.VPPGSAQdp......................................selRTITRQRDVRVY-..........--DKDQK..PLVKSHRNSL.F.IY...KP.IYS.......................................Q..--VVTEIPFSHPRQLIDMLPLLRQYAFVATLLESSF-g.......................................................................................................................................................................
M4A1U0_XIPMA/15-377                  ........................................................................................................vr--SLERLQEe.lQAPTM....NNMKCRLEMIAKQQGM..GFH--......................--F....----TESTCYLTA.DF.FYLEVLL.........LPS..G..EV.....Q......EVKVALQGE......-......HP.....AP..SRS..................................................-------LLHLLR.......................-SNNFS.DFSMRLGELFAQYNIPGDn.......kTKSKM.LKSLQCLWKDLQQISDMPNEP...KcFE----...........................----------------AQMGl.iNNGRVGflmae..............kqdypPSLYFYSSPND..CLKNSE-..----.....LSFEE--LQ-.....................---EF.KPA.....VQAARATIGVSDLtR...........KL......QMTSL--......................----ISE-----......................................----APQLDTQSCPAVA.......................................AFSE.....VSNEML...PTCFLLRLKTPIPVLFHIVERVG.QITG.VTIPDCDL-..................Q.WAPLPKLLMK.ASASAKS..........................................pSEPLDGQEIFTVV.........fPE-----..--GGMHTYVL.PdSS...WD.IPT.......................................Q.rATLLASVPFTQPAHVSAVLELLRHQCAFNTLLRSCL-t.......................................................................................................................................................................
W4XA58_STRPU/74-449                  ..........................................................................................................KKCLDKLKMa.iKVTSV....PAMNERLDAIARQVGL..KANWS......................IDN....--------VYLSS.DC.FYVEVLL.........APN..G..GV.....K......DVILVHGMN......G......NL.....QS..CEE..................................................-------MCDVLK.......................-KNDFK.EFTEHLKGLCQMYQLGGDs.......kMKTTA.FNCLQALEVDIKTLFHISGIK..fG.------...........................--------ASQQQGGSPLLH..iTKGFVGyltpr..............vgghlMRLTYFVSPYD..LLDVEKK..----.....---QTKELSL.....................KEPLP.KDL....gLSVTVSIETAAQR.K...........IQ......TGPTVMV......................TDNKITN-----......................................---------------VM.......................................PLGN.....QNSITI...PASFVLKLSEPMPMSLILLKQLQ.NISG.VSTQYADPT..................A.ATPLNTLICK.FTLDPVTf.........................................lQNQAKEGRSNKT-..........--KNYVV..ELPDQHH-S-.Y.II...ND.GTNpnd.................................lrdM.qGALLSKITFTLPNTVVKIIALLRQQAVYNTLIASCVR........................................................................................................................................................................
A1CIN4_ASPCL/136-568                 ..........................................................................................................DDVVQLLRT...RIAGR....AVCREGIERLGQFEKF..ESIWQ......................EDN....--------LNIAG.NF.VDLEIEF........yRGQ..N..VV.....K......DVSLNYLTQ......-......EG.....TD..GER..................................................REEATAVLKRDLVqnpe..............dgergIWKSLT.GFHGNLQWLSKHDRLS--.........QEVNC.FEAIEGLYASLKRV-------...-.WSEEQKl........................pkYSREYEHLCA-GAIGRPGLH...RGNRLG........................LCLDYWIPQAR..VLDAKHT..KSSPd...aMAIDQPASQA.....................TDDDL.EPQ.....KGKWRVMIECEE-.-...........--......GYPSLRI......................SKEWVGSEALTVvnndan.........................gssssetAASDIAVVNWAEPPPTMsslnqg...........................gseamgL-DTs...mLGSSTP...NRRFVARMEPPLDVPILAASDIY.RHLG.IQLPHEFR-..................-.MVTYDGLLVP.GWSPLSAteada................................edsnqpSRRRRRTSVQGF-..........--DQEGK..PCTKHHGYTF.Q.AF...ES.VAG.......................................R..--TMRDIPFSHPRQLADIFPILRQYAVLANLVHKIFK........................................................................................................................................................................
A0A0M8PBE5_9EURO/98-520              ..........................................................................................................EEVIQLLRA...RVSGR....GVSRESVERLSRLEDF..ESIWQ......................DDN....--------LNIAG.NF.VDLEIDF.........YPG.qD..VV.....K......DVSLRYATP......-......EY.....TE..GVR..................................................REEATAVLKRTLAqsle..............daecgKWRSLQ.EFHENLQWLAKLDKLS--.........QEVNC.FEALENLEENFRRI-------...-.WVEESKn........................gkHGGEYQHLCA-GVLGRPTMH...KGTRIG........................LGLEYWVEQAK..VLDAKHS.lLSPD....aMEIDSQHDQG.....................SKGEL.DDQ.....SRSWTVMIECEE-.-...........--......GYPSLRI......................SKEWVGSEVFTAgest..............................ellpSNGAAGSVNWLEPPQTTrlthg.............................nhdpmALDSs...mLESSPP...NRRFVGKLEPALDVPILAASEIY.RQLG.MQLPQEFK-..................-.MITYDALLVS.ESSSLASpvs....................................spqiGRRKRRMPVHAV-..........--DSKGE..QYTKQHNYTF.Q.SF...ES.ITG.......................................C..--TIRDLPFSHPRQLADILPILRQYAVLANLIRKTF-h.......................................................................................................................................................................
M3YU90_MUSPF/59-426                  .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAVMYWKA...-.TN----...........................--AGPLDKILHGSVGYLTPR...SGGHL-........................MNLKYYASPSD..LLDDKTT..--SP.....IILHEN--NV.....................PRS--.-LG.....MNASVTIEGTSAMyKl........piAPl...imGSHPV--......................DNKWT-------......................................-------------PSFS.......................................SITS.....ANSVDL...PACFFLKFPQPIPVSRAFVQKLQ.NCTG.IPLFETQP-..................T.YVPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PIPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
U3JCS2_FICAL/53-420                  .........................................................................................................v-SCLETLQKa.lKVSSL....PAMTDRLESIARQSGL..G-S--......................---....HLSANGTECYITS.DM.FYVEVQL.........DPT..G..LL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQHLR.......................-EKNFD.EFSKHLRGLVNLYKLPGDn.......kLKTKM.YLALQSLELDLQKMAGMYWQA...-.TN----...........................---------------ANPLDk.iLHGSVGyltpr..............sggllMNLKYYVSPYD..LFEDGT-..-GAP.....-----VVLHE.....................NNVPR.SLG.....MNVSVTVEGTMAM.H...........KL......PIAPLIM......................GSHPVDS-----......................................----------KGTPSFS.......................................SITS.....ANSVDL...PACFFLKFPRPIPVSRAFIQKLQ.SCTG.IPLFDTAP-..................T.FVPLYELITQ.-------...........................................-------FELS--..........---KEAD..PLPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLLSKIAFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
F7EAR7_XENTR/44-412                  .........................................................................................................v-SCLETLQKa.lKVSSL....SAMTDRLESIARQNGL..T-S--......................---....HLSPNGTECYITT.DM.FYLEVLL.........DTE..G..QL.....C......DVKVAHHRE......-......NP.....VS..CPE..................................................-------LVEQLR.......................-EKNFE.DFSQHLKGLVNLYKVPGDn.......kLETKM.YLALQSLELDLTKMAAMYWQA...-.TN----...........................--ASVLEKILHGTVGYLTPR...SGGQV-........................MSLKYYVSPYD..LFDDTT-..----.....--GASISLSEgh.................avPRS--.-LG.....MNVSVTIEATSAM.Y...........KL......PIAPLIM......................GSHPIDN-----......................................----------KGTPSFT.......................................SITN.....ANSVDL...PACFFLKFPQPIPVSRAFIQKIQ.HCTG.ISLIDGSH-..................T.FLPHYELVTQ.-------...........................................-------FEL---..........--AKEKE..PGTLNHNMRF.Y.AS...--.LPGqqhcyfvnk....................daplpdgrslQ..GTLLSKIPFQHPGRVPIILSLIRHQVACNTLIGSCVK........................................................................................................................................................................
MED1_SCHPO/233-359                   .........................................ilqsskinwalentltpipttmelvfddinliipeqgvkplldllhvhditipwpvqnyshmlgl---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------------.........-----.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................---------PSK-..........-STVNYK..FINKNQAIQL.T.GF...-D.VSA.......................................R..--SLRHVPFHHPKQIRGILAIVRQYLLLQLILENI--ks......................................................................................................................................................................
M3JEJ4_CANMX/9-414                   ..........................................................................................................EKSLQSLYD...YSSNF....QVSVELIQKLAQQLKL..ETFIDnlgfpl..........qepsntT-T...gRNGTNTQKLTIAA.SS.ILLDIDF.........END..S..KI.....V......NLSLSINGS......E......NI.....QS..TEGrcftitppnetnvsqvk...............lncnynnvtflnkregssKTQVEEILLRNLH.......................-GVKLG.NFPLNLQYLATIDKYAN-.........FNPDL.FIYIESIALLLTTINQIEGKV..sDnWE----...........................-----IEQGFKSSVGAVKLN...INDKLG........................VRLDFWKDYRY..INHEYSI.mKSTDe...lLVGQEYNIQLkvvd............stsdqIDYLI.DNQ.....VQEWNLINGKYRF.E..........fEN......TLKPLIV......................EGENFSA-----......................................-----------------.......................................----.....------...-WAIQLDLNHPVYLPRYILEYFG.I---.DNYTTSNEQ..................E.----------.-------...........................................-------DVFEKLn.......ngDEFEQTL..NL-DATNVSF.Q.LV...ND.TSS.......................................N.gFINLKSLTINKLVEIAHIIPVLRNFLVFSNIIRTI--ln......................................................................................................................................................................
G7X5V6_ASPKW/135-570                 ..........................................................................................................DDVVQLLRA...RVSGR....GVCREGIERLSDLEGF..ESIWQ......................EDS....--------LSIAG.NF.VDLEIDF.........HRG.yN..VV.....K......DVSLKYATP......D......A-.....QD..GEQ..................................................RDEATAVLKRDLIqspe..............egdrgAWKSLR.GFHENLQWLAKHDRLS--.........QEVNC.FEAIEGLYESLKRV-------...-.WEAEWKh........................rkFAGVYDHLCS-GWVGQPCMH...KGSRIG........................LGLDYWVQQAR..VLDAKEK.qKTSSd...aMVVDATNGQP.....................SDDEP.NSL.....EGKWSIVVECEE-.-...........--......GYPSLRV......................SKDWVGSEVLTGvnnndn.........................gpssseaHGSEAAVVNWVDPPATLtnnqg.............................hpdamALDSn...mLGSSAP...NRRFVAKLEPALDLPILAASDIY.RHLG.MQLPQEFK-..................-.MVTYDGLLAP.GWSPLSAagamglg.............................peeasqlERRRRRMSVQSV-..........--DTTGK..PCTKHHSYTF.Q.PF...ES.VAG.......................................R..--TLREIPFAHPRQLADIIPILRQYAFLANLIRSVF-s.......................................................................................................................................................................
B7PD89_IXOSC/169-299                 .....................................................................................................psfaa---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------------.........-----.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................-LSN.....LNSTTL...PASFVLKLPQPIPMALALVRKIH.AITS.IECADTTC-..................-.CQSLLSLIIT.-------...........................................-------QASEGKl........nGSSDRGL..NVTLPDQHHC.Y.YL...SG.SPD.......................................L.qGVLVSGVQFTHPTHVPQILVFLRQQLLFNSLIASCVR........................................................................................................................................................................
G3WTX2_SARHA/51-419                  .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNAL..G-S--......................---....HLSANGTECYITS.DM.FYVEVQL.........DPT..G..HL.....S......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYKLPGDn.......kLKTKM.YLALQSLEQDLSKMALMYWKA...-.TN----...........................--ASPLDKILHGSVGYLTPR...SGGHL-........................MNLKYYASPYD..LLEDKTA..--TPi...lLHENNV----.....................PRT--.--L....gMNASVTIEGTPSA.Myk......lpiAPl...imGSHPV--......................DNKWT-------......................................-------------PSFS.......................................SITS.....ANSVDL...PACFFLKFPRPIPVSRAFVQKLQ.NCTG.IPLFDTQP-..................I.YVPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PVPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLIEKVTFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
Q5AHH0_CANAL/9-429                   ..........................................................................................................DKSLQLLYN...YSTNF....QVSIELIQKLAQQLKL..ETFIDslg................fnlDDS....KPGQKTQKLSIAG.SS.ILLDIDF.........ETD..N..KI.....V......GLSLSVNAG......D......SL.....EQ..QNNhreigppnhttngqssshisivtdelgihhvklncnnnpisflnkpndlnKTQVEQILLRNLQ.......................-ASKLG.NFPVNLQRLATIDKFTN-.........YNPDL.FIYVESIALLFNTIFEIEQQSn.sSnWE----...........................-----IENGLSSSIGKVNIN...NEDRLG........................VTLDFWQDYRF..INHEYEI.vKNQSg...lLVGDYYTIQVdive.............askqTDYLL.DNQ.....VQEWDISMSKYKF.E..........fDS.....nSLKPLVLdg..................dgFLAWS-------......................................-----------------.......................................----.....------...---LQFKLNHSVYLPVYILEYFS.LALG.NNYTLDTGD..................-.-HNCC-----.-------...........................................-------NVFAKIn.......egESFEQVL..NI-DSNSVSF.Q.LT...ND.IPG.......................................K..FVPLKSFHINKLVDISKLIPILRNFLVLINLCRTVIK........................................................................................................................................................................
E7M1Q8_YEASV/12-300                  ..........................................................................................................DSMIELFKD...YKPGS....-ITLENITRLCQTLGL..ESFTE......................ELS....---NELSRLSTAS.KI.IVIDVDY........nKKQ..D..RI.....Q......DVKLVLASN......FdnfdyfNQ.....RD..GEH..................................................--EKSNILLNSLT.......................KYPDLK.AFHNNLKFLYLLDAYSHI.........-----.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------esdstshnngssdksldssnasfnnqgkldlfkyftelshyirqcfqdnccdfkvrtnlndkfgiyiltqgingkevplakiyleenksdsqyrfyeyiysqetkswinesaenfsngislvmeivanaxesnytdliwfpedfispeliidkvtcssnssssppii.
A0A0Q9WWK4_DROVI/78-453              .........................................................................................................q-SALDKLQHy.iKVTSR....HGLVERLESLSRQLGL..KFMED......................---....-----QQMLFIST.DM.FYVEILL.........DAS..G..KL.....S......DVKVHHECK......I......EQ.....QS..NSS..................................................--ASSRELLNCLK.......................-AGDFA.DFTVQLEGLSSIYQLNAEp.......kVKKKA.YVALQAMETDIFNLYQHQLQQ...Q.------...........................---------ISGSSDSYYIM...NKSSVGlvqqr..............rgghpMKLTYFCPPLH..LIETKTK.gEKVG....aATGSGTASRDf..................siEQVMK.SPN....gLSATLNLEASSAN.K...........LQ......ILPILSF......................TSESGLP-----......................................----------LEQPGYA.......................................PLTQ.....NNSMLM...PATYVLRLSKPMPVCIDSLRALS.-LPG.LSGLSSEG-..................-.TTTVMNLIVQ.-------...........................................---TASRQVIKG-..........--TQKGL..YVNLPRETHC.Y.FL...TD.NRR.......................................L.kGTLISSLPFTEPAQVPKIIAFLKKQALFYTLLSSCVR........................................................................................................................................................................
Q6C9S6_YARLI/14-353                  ..............................................................................................kqlvsilaalek---------...--API....KATPAGIRKLAQQRGL..EVFGE......................DLA....----EGTRISLGG.ST.ILIDIDMi.......tSPI..D..RV.....V......RVNFSVDAK......V......AP.....SD..PIHsyt...........................................npeiSPSINDVLLSSLQ.......................-ASKLD.KFARHLAFLSDMERLSS-.........EKCNS.FRAIDEVAHALFFKYKKLGKK..dSpAD----...........................---------FCMGFGQPLLN...YEENLG........................LFLKYWTTQHQ..VRDAEKA..---A.....-VTAEY----.....................-----.---.....IAEFGLREN----.-...........-S......GDCHAKY......................STGWINE-----......................................------GGEWQEI----.......................................----.....-AAQDS...TAEFVLRLNPPVLMNKDLATKLG.ASYT.VV-GN----..................-.DTPFD-LLGN.-------...........................................---TFYRSFREVH..........TSDS--D..SVRMNVEYSN.L.VA...KD.E--.......................................-..LVSVTEVPVDHPRSLESLFDILRTQIQLSTVLESV--l.......................................................................................................................................................................
H2U0Q6_TAKRU/53-423                  .........................................................................................................h-SCLENLQRa.mKVSSL....SAMTDRLESIARQNML..G-S--......................---....HLSPSGTECYITS.DM.FYVEVQL.........DNG..G..QL.....V......DVKVAHQGE......-......NP.....TS..CLE..................................................-------LIQHLR.......................-EKNFD.EFSKHLKGLVELYKLPGDn.......kLKTKM.YIALQSLELDLTKMMHMYRLA..tS.------...........................-ANTL-ETLLHGSVGLLSAR...SGGHL-........................VSLHCYLSPYD..LLEERTC..--AP.....--LNLTDNNV.....................PRS--.-LG.....VSVSVTIEGTSAVyKl........piAPl...itGSHPVDNkgtps............fstvtNSNCVDL-----......................................-----------------.......................................----.....------...PACFFLKLNRPMPFSVAFIQRMG.NATS.IPVFESPP-..................T.LSPLYQLIVQ.-------...........................................-------SELRL-..........QEDGSVT..PP-CPHNMTF.Y.SV...--.LPGqlhcyflng....................dapvqdgqslQ..GAIVSKIPFRHPAQVPLLLDIVRHQAAYNSLISSCVK........................................................................................................................................................................
A0A0C4EE89_MAGP6/125-568             .........................................................................................................h-RILSILKE...S-KGR....-VSDAGLERLVRSVGL..EFLWE......................EGG....-GGDKSKTLIIAG.SA.LSIDIVM.........-VN..N..MV.....E......KVTLSFPDS......-......SD.....VV..SRH..................................................VDQAGRILLDDLKlgp................tespLTKKLD.KFAVNLERLAVLDKLSVI.........PGFNC.HEAIAGIYDSLERL-------...HqWDMSRLradp..................amagrSEEILRMTALCSRNGEPGMH...KRDKVG........................LTLDYWKEQHL..VPPPPGA..--SP.....------G---.....................LREHV.EAT.....ERAWSMWIGCAPL.I...........AM......GYQPARV......................SDAWLSPGVEKHeamv.............................gedhlLMTANQLLDWQDPPNTVipgeggdqq.....................qqqkadgmdVDNG....gHPGRLP...AVVFSAEFDPPVVMTLQDWEHIQ.QIAQ.-APLSEFL-..................-.HSTYDSLMFP.VPENSQHdp......................................tepRSITRLKEVSVFPpapaassgatGAAAAAE..PTKALHRNSL.F.IY...KP.VYG.......................................R..--TLSSVPFSHPSQLVEMLPRLRQYAFLSTLLERSF-g.......................................................................................................................................................................
C6H2U6_AJECH/132-559                 ..........................................................................................................EEVIRLLRT...RVSGR....GICREGVERLGKFEGF..ECMWQ......................ENI....--------LSIAG.NL.VDLEIQF.........EDG.sE..NV.....K......DVSLKYTTP......-......SV.....VE..GER..................................................RVEATAVLKRDLMqtvg..............kneeiPWKSLD.AFHSNLHRLTKLDRLS--.........REINC.FEAVEGLYKSLNRL-------...-.WEGELSr........................ypGRGHCEHVCT-SQVGHPGIH...QDGRIG........................LSLQYWVERRQ..TLDSNGN.gRLNA.....MNIDQPTPDD.....................RKPAP.AKI.....HKTWRATIECEE-.-...........--......GYPSLRV......................SKEWIAAELFTTmnnges..........................flaadgNDSEILLVNWIDPPATLvsnp..............................ndvplDSTA.....LGTTTP...NRRFVARLEPPIDMPIIAAAEVY.RLLG.MNMPVEPK-..................-.TVTYDGLVVP.LPNLASTgdgqdd...............................nslaasNGRIHEKVVYSF-..........--DDDCQ..PRKHRHIYTF.H.PF...EH.IVG.......................................R..--TIRDLPFSHPRQLADVLPILRQYALLSSLLHRVF-v.......................................................................................................................................................................
A0A068Y4B8_ECHMU/114-422             .......................................................................................................pec---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-----TVLVEDLK.......................-KRNYN.SLLKHVKNLIALYDLPGEi.......aQRCRA.YLCLQALEQDLLMLTTAVNNR..iP.-----Iaaaplnlelp......slpckltnspsDVNCLAQSINGSAVGQVVQR...TGGAFT........................V-LTYFVSAAQ..KAIAVSH.tSKHS.....-------AQV....................gPEA--.-GM.....LGGFCASVGLRATaN..........aSQ......HFLPLVS......................LVNIIKD-----......................................----------ADGYNVAq....................................ftNADN.....ITRVKI...AAEFFLRLHPPLLFDVESISEIE.AITQ.IPMDYLKQS..................E.PLPLHYLLLR.-------...........................................---QHNQEGLSFI..........--DVHMT..LPNKVQHAYH.V.VS...NN.LRG.......................................Y..--VINEIAFTCPSQLPPLIQLLRRKAA----------wlsfvesf................................................................................................................................................................
C1H823_PARBA/132-559                 ..........................................................................................................EEVIRLLRT...RVSGR....GVCREGVERLGKFEGF..ECMWQ......................DND....--------LNIAG.NF.VDLEIQF.........EDG.tE..NV.....K......DVSLKYTTP......-......SG.....VE..GER..................................................RVGATAVLKRDLIqtag..............npeekPWKKID.AFHANLHRLAKLDQLS--.........RDVNC.FEAVEGLYESLNRVWQGEIQR...Y.-P----...........................GKGHWEHVCT-GHVGQPVLH...QDRRIG........................LSIRYWVEQRR..TLDSQPR..NVPD....aMSIDQFSKDD.....................KVSSD.LEK.....HKTWSTMIECEE-.-...........--......GYPSLRV......................SKEWVASQLFTTmdsges..........................ssavneNDTDILLINWIDPPATLvsnp..............................ndvslNSTA.....LGTTTP...NRRFVARLEPPIDIPIIAAAEIY.RLLG.MNMPPEPK-..................-.PATYDGLVVP.LPNSFSPefsnse...............................ngypvsNERIHKKVVYGF-..........--DANGH..PEKHVHTYTF.H.PF...EH.IVG.......................................R..--TIRDLPFSHPRQLADILPILRQYALLSSLLQKAF-t.......................................................................................................................................................................
A0A0L0C5M4_LUCCU/81-448              ..........................................................................................................QKCLDNMQHc.iKVTSR....QGLVERLESLSRQLSL..K-FSD......................DT-....------KALFIST.DM.FFLEILL.........DSN..G..SL.....T......DVKVHHESK......A......DQ.....QS..CSE..................................................-------LVDCLN.......................-RGDFA.DFTAQLEGFSSIYQLNAEs.......kVKIKA.YDAMQAMETDLYNIFQMQNFT...K.-D----...........................----TLQVIQ-DSIVGVVLK...RRGGHP........................MRLVYFVSPYD..LISLESK..S---.....--LQSLSL--.....................-DSFK.NKQi...gFSVTVNLEASSAN.K...........LQ......ILPTVTV......................AKDPQTG-----......................................----------IDVPVFA.......................................PLNQ.....MNSMLL...PATFVLRLNRPLPVCFNTLRSMG.LCTG.ALNETNPLPsssle........aqhktPlVTNIMSLIIQ.-------...........................................---TASDQQMKS-..........--SQKGLfvCLPDQTHCYF.F.TE...NK.LLK.......................................S..-TLIHSLPFTEPSQVPKILDFLKKMALFYALLASCVR........................................................................................................................................................................
C1G3L8_PARBD/132-560                 ..........................................................................................................EEVIRVLRT...RVSGR....GVCREGVERLGKFEGF..ECMWQ......................DND....--------LNIAG.NF.VDLEIQF.........EDG.tE..NV.....K......DVSLKYTTP......-......SG.....VE..GER..................................................RVGATAVLKRDLIqtag..............npeekPWKKID.AFHANLHRLAKLDQLS--.........RDVNC.FEAVEGLYESLNRIWQGEIQR...Y.-P----...........................GKGHWEHVCT-GHVGQPALH...QDRRIG........................LSIRYWVEQRR..TLDSQQR..NIAD....aMSIDQFSTDD....................kVSSSD.REK.....RKTWSTMIECEE-.-...........--......GYPSLRV......................SKEWVASQLFTTmdsges..........................ssavneNDTDILLINWIDPPATLvsnp..............................ndvslNSTA.....LGTTTP...NRRFVARLEPPIDIPIIAAAEIY.RLLG.MNIPPEPK-..................-.PATYDGLVVP.LPNNFSPelssse...............................sgypvsNERIHKKVVYGF-..........--DANGH..PEKHIHTYTF.H.PF...EH.IVG.......................................R..--TIRDLPFSHPRQLADILPILRQYALLSSLLQKAF-t.......................................................................................................................................................................
B6QF18_TALMQ/132-549                 ..........................................................................................................EEVVQLLRG...RVAGR....GVSREAVERLGRLEGF..ESIWQ......................EDS....--------LSIAG.NS.VDLEIEF.........YPG.eD..NV.....K......EVSLSYASL......E......GE.....SE..SER..................................................RDEATNVLKGDLIqtpe..............erekrAWKPLK.GFQSNLERLAKLDQLS--.........QEINC.FEAVESLFDSLRKV-------...-.WEAENQg........................gtYQNVYDHLCR-GAIGRPSLH...KRGRVG........................MGLEYWVEGHR..ILHAKQT.kKSED....rMAIDTD----.....................-EDNA.NTQ.....DKLQSVTIECEE-.-...........--......GFPSLRI......................SKEWVGSEVLSTves................................ndtSNSSETVVNWMEPPPTLqp..................................pvnELDTg...mVGSGTV...NRRFVAKLDPHIHVPLLIANDIY.RHLG.LAIPQEYR-..................-.TTTYDDLLVP.GWTIGSMgsndsm..............................tseslemTEKRRRTAVLSF-..........--DEKNE..PVQKIHSYSF.Q.AF...EA.APG.......................................M..--TIRELPFSHPRQLADIFPIFRQYSLLVTLMQKVF-p.......................................................................................................................................................................
A0A0G2DUR1_9PEZI/139-295             .........................................................................................................e-AIIATLKA...R-PGR....-VSREGMERLARQLGLssEVMSD......................SHG....-----GQQLLLAH.TS.FMLDIAF.........-RD..N..VV.....D......GVTLQFGDL......-......SG.....GV..QTH..................................................SQSAATVFKADLVpap................geasINLSLD.RFAKNLEKLARLDHLSIFke.....gkPEVSC.FEAIAGVYNSLQKLFEHERKA...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------amhlig..................................................................................................................................................................
A0A094E560_9PEZI/121-539             ........................................................................................................mq--IVDTLKG...V-KGR....-VSEDGIERLARSVGL..ECLWE......................TGM....GRGGKSKTLIIAG.TG.LSIDIEF.........-TD..N..IV.....E......TVTLGFPES......-......PE.....SV..TRH..................................................ADQAGKILLDDLKpgk................getiLTKRVD.RFADNLDRMARLDKLSVM.........PQLNC.HEAVAGIYDSLERL-------...HkWEVTKLteee..................amsgkTQDQIVRAALLKKSGRPAMN...AHGSVG........................LCLEYWQERHA..TSKGE--..----.....----------.....................-----.--D.....YKTWSLLLECDQS.S...........SM......VYPPVRV......................SSEWISPSVAKTnpta..............................ddllLSASDVVLDWQDPPNILlpsdpeqk......................ddsgmegieQSGQ....lPNQKFP...DVRFVAKFSPPLTLPYSAAMQIY.DSTG.AHLEPDA--..................-.LVAFDALVFP.PQTAEPSepd.....................................gahRRIRREQLVSVY-..........--NHAGE..HEKQRHANTL.T.IP...KM.EYA.......................................L..--TLKEVPFSHPRELVQMLPILRQYARLSTLLERSF-g.......................................................................................................................................................................
H0X2X5_OTOGA/59-426                  .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAIMYWKA...-.TN----...........................--AGPLDKILHGSVGYLTPR...SGGHL-........................MNIKYYASPSD..LLDDKTT..--SP.....IILHEN--NV.....................PRS--.-LG.....MNASVTIEGTSAMyKl........piAPl...imGSHPV--......................DNKWT-------......................................-------------PSFS.......................................SVTS.....ANSVDL...PACFFLKFPQPIPVSRAFVQKLQ.NCTG.IPLFETQP-..................I.YVPLYELITQ.-------...........................................---------FEL-..........--SKDPN..PISLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLISKITFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
H1UXL2_COLHI/121-549                 .........................................................................................................d-AVIEILGK...A-KGR....-VSEAGLERLTLRTGL..TSMWD......................EHR...sPDGRKTRMLVIAG.QA.LTIDIEL.........-NN..N..IV.....E......NVSLGFPES......-......GP.....IV..TRH..................................................KDRAGNILLKDLQlrp................dqspLTKTLE.KFSANLERLANLDKLSVI.........PGLDC.QEALAGIFESLERL-------...HkWELSKLredp..................amggkPDRFLETTIMCTKSGRPMMH...TRDTVG........................LSIEYWTERRH..VIPKNT-..--ET.....----------.....................-MRYC.ETR.....EKVWVILIGCKAL.D...........GN......MFPPVRV......................SENWISQKVEKAepgp..............................edilVAASGPALDWLEPEPTTlpqtddn........................kdpgidvvQPDG.....TTHKYP...NVKFVATLTPSVIVPQSVWNTLH.TLTG.AQAQPMPL-..................P.TYTFDSISFP.IPEGSNHda......................................selRVISCKRNVQVQV..........P-GDGNT..VSSRKHKNTL.L.IY...KP.VYG.......................................Q..--TVTELSFSHPRQLVAMLPILRQYAFISTLLERSF-g.......................................................................................................................................................................
F4WYN8_ACREC/1-341                   ..........................................................................................................---------...-----....--MVERLESLARQLGL..KFM--......................---....MSGPPGTEIFISS.DM.FFLEVLL........ePPS..G..LV.....R......DVKIHHEGK......S......EQ.....QS..CEA..................................................-------LASALS.......................-RGDFV.DFTTQLEGLASIYQLNADk.......kVKCKA.FSALQSLEADLGILAQLQTFM...-.------...........................---------------KEPFNl.vHKSPVGilerr..............rgghpMKLTYFVSPYD..LIDEENR..---T.....----YDALN-.....................SDTII.KRKi...gHSVTVCMEGSTGH.K...........LP......TSSIITV......................NRSPTGK-----......................................-----------STPSYA.......................................PLTS.....TNSSML...PACFVLKLVKKMPICMELVKRIQ.KVTE.LECGDISA-..................-.PHPLLSLIIQ.-------...........................................-------HASDGQl........dCRNNRGL..YVTLPDQQHC.Y.FM...TE.NKN.......................................M.eGVLVCSIPFTHPAHVPQILVYLRQQALFNCLIASCVR........................................................................................................................................................................
W5PN52_SHEEP/59-426                  .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAVMYWKA...-.TN----...........................--AGPLDKILHGSVGYLTPR...SGGHL-........................MNLKYYASPSD..LLDDKTT..--SP.....IILHEN--NV.....................PRS--.-LG.....MNASVTIEGTSAMyKl........piAPl...imGSHPV--......................DNKWTPS-----......................................---------------FS.......................................LVTS.....ANSVDL...PACFFLKFPQPLPVSRAFVQKIQ.NCTG.IPLFETQP-..................T.YVPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PLPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
A0A096M5J1_POEFO/59-429              .........................................................................................................l-NCLETLQRa.lKVSSL....PSMTDRLESIARQNML..G-S--......................---....HLSTTKTECYITS.DM.FYVEVQL.........DTG..G..QL.....V......DVKVAHQGE......-......NP.....TS..CSE..................................................-------LIQHLS.......................-EKNFE.AFSKHLKGLVDLYRLPGDn.......kLKTKM.YIALQSLELDLTKMMTMFRLA...-.TN----...........................--ANTVETILHGSVGWLTPR...SGGNL-........................VSLQCYVSPYD..IFEVETG..---S.....-QLSLPDNNV.....................PRS--.--L....gVSVSVTIEGTSAVyKl........piAPl...itGSHPVDNkgtps............fstvsN-----------......................................-----------------.......................................----.....SNSVDL...PACFFLKMNRPMPFSLSFIQRLG.SATS.IPVFETPP-..................P.LSLLYQLIVQ.-------...........................................-------SQLQLL..........EE--GSA..TPATLNNMHF.Y.SI...--.LPDqhhcyflng....................dapvqdghslQ..GAMVSKIPFRHPAHVPLLLDIIRHQAAYNTLIGSCVK........................................................................................................................................................................
H0EMB1_GLAL7/35-446                  .........................................................................................................e-DVISILSV...S-KGR....-LSAAGVERLAQRLGL..EIMWQ......................DNM....--RDGSKTLIIAG.PAhLALDIDF.........-MS..D..VV.....Q......KVALSFPDS......-......PD.....IV..TRH..................................................TEKAGNILLEDLKigp................eestLTKSLN.RFAANLERLAALDKLSGN.........PGLNC.HEAIAGIYENLEKL-------...HeWEVQKVkads..................dmakkDHEFVQRAVMCTRSGKPVMH...SRDRLG........................LSLDYWQNKRM..ITRKRLK..----.....----------.....................-----.HEE.....EKTWSLLVECAPL.P...........SL.....tVFPPLRV......................SQEWISQKIVRDtaa...............................ndifAEALQPQLDWQEPDSTVvpak..............................adamgGVEG.....SKEKVL...DVIFMAKFDPPLIVPYSMAMTIY.NSTN.A--PFDMY-..................Q.TSRFDGLMFP.HSGDLVDsn.......................................asRTINSQTTIQI--..........PEREGRE..GQTRIHKNTL.L.ID...KI.GYG.......................................R..--TLTELPFSHPQQLVAMLPSLRKYAFLSSLLLKTF-g.......................................................................................................................................................................
S9YIH0_9CETA/4-188                   ............................................................qgetevprslgmnasvtiegtsamyklpiaplimgshpvdnkwtps---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------------.........-----.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................---------------FS.......................................SITS.....ANSVDL...PACFFLKFPQPIPVSRAFVQKLQ.NCTG.IPLFETQP-..................T.YVPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PIPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
G1KU28_ANOCA/60-427                  .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSANGTECYITS.DM.FYVEVHL.........DPT..G..QL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQHLR.......................-ERNFD.EFSKHLKGLVNLYKLPGDs.......kLKTKM.YLALQSLELDLTKMAVMYWQA...-.TN----...........................--ASPLDKILHGSVGYLTPR...SGGHL-........................INLKYYVSPYD..LIEDGT-..-GVP.....-----VILNEg..................gvPRN--.--L....gMNVCVTIEGTLTM.N...........KL......PIAPLIM......................GSHPVDN-----......................................----------KGTPSFS.......................................SITS.....ANSVDL...PACFFLKFPRPIPVSRGFIQKLQ.NCTG.IPLFDTPP-..................T.YVPLYELITQ.-------...........................................-------FELSK-..........----EQD..AGSLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLLSKIAFHHPSRVPLILNMIRHQVAYNTLIGSCVK........................................................................................................................................................................
C5FEF1_ARTOC/164-578                 .........................................................................................................a-EVLSMLRS...RVAGR....GVCRESIERLGTLEGF..ECMWQ......................ENN....--------LSIAG.NS.VDLEIEFgq....kdgADA..D..VV.....K......DVTLRYATR......E......M-.....AE..GEK..................................................REAASAVLKSVLTtag.................gdgEWKKVD.AFHANLTRLARMDGLC--.........REVNC.FEAVEGVHESMQKV-------...-.WDVTSG...........................ESRFWERLCR-SSVGRPTMH...RGENVG........................LAIQYWAAQRR..LLDARHV..----.....-SLDDVLASS.....................LRLGR.GSK.....HKIYNAVIECEA-.-...........--......GYPSLRI......................SKNWVGDPTVLPtqdgnsnensngn...........ndegnddsnntaneDTNNRARTNWVEPPPTL.......................................VSTDp...lLPSSPP...NVRFVARLEPAIHVPIVVAAEIY.RLVG.ITLQQDMR-..................-.PAAYDALVVP.VERRART...........................................GGGEHVRNVTTF-..........--TDGQT..AAVKKHVYTF.H.TL...EH.VPG.......................................F..--TVRELPFSHPRQVEEAIPLLRQYALLDRLL-----dvfd....................................................................................................................................................................
F7G3X2_CALJA/1-259                   ........................................................................................................kl---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------------.........-KTKM.YLALQSLEQDLSKMAIMYWKA...-.TN----...........................--AGPLDKILHGSVGYLTPR...SGGHL-........................MNLKYYVSPSD..LLDDKT-..--AS....pIILHENNVS-.....................----R.SLG.....MNASVTIEGTSAMyKl........piAPl...imGSHPV--......................DNKWT-------......................................-------------PSFS.......................................SITS.....ANSVDL...PACFFLKFPQPIPVSRAFVQKLQ.NCTG.IPLFETQP-..................T.YVPLYELITQ.-------...........................................-------FEL---..........--SKDAD..PIPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
V3ZAN0_LOTGI/67-425                  ..........................................................................................................QNCLDSIQRa.iKVCNH....QSLLERLESIARQVGL..TFGTD......................---....----NDLQVFISS.DM.FFIEIQL.........EKG..G..FI.....K......DVKIVHQGD......-......-P.....VS..CPE..................................................-------LTEILQ.......................-DGKFD.EFITHLEGLQKIYQLTGDk.......kIKTKG.YLALQSIEKDLNTLAQLQSST..iN.------...........................--------------GVARYI...HKTPLGillpr..............kgglpMELMYFVSPYD..LLDKLSK..-TAH....pLTLEAITE--.....................-----.FNL....gQRVTICMEPGPPK.K...........LQ......TMPLMTI......................NKTTDGK-----......................................-----------SLPSYT.......................................NISN.....INSHLL...PACFTLVLKQPIPVSLSVVQKIQ.SITN.IEIGEVG--..................D.VKPLLNLLIE.----KYS...........................................QGKIQPD------..........QIRQLYV..NLPDQHH-TY.F.IN...-G.VNGgs...................................ldQ.pGLMVSSVPFVHPTSVPRILNCLRQQLLFNTVVSSVIR........................................................................................................................................................................
F1NBE5_CHICK/54-407                  .........................................................................................................l-SCMEKLQRt.lSDRSL....FSVMNRLESLSKQKGL..N-S--......................---....HVSPSGTACYITS.NM.FYIEVQL.........EKD..G..RV.....M......DAKLAHLGE......-......AP.....VI..CDD..................................................-------LVQHLR.......................-MKNYD.AFGKILEDLSNLYQIPGNs.......eMKAKG.YLALQSLEKDLYSMSLLHRTQ...D.------...........................-------------VNRVTEV...LHGKVGhlvpr..............tggtpMNTEFYISPYQ..ILEAELN..-PGS.....----------.....................----L.VCG.....TKAVVTVEGTDTL.H...........KL......PLSPLLV......................DSQAGED-----......................................-----------GNPTFL.......................................PLTN.....ELSMDL...SAYFLLKFHQPIPLSLSNIEEIQ.MLTG.IQITALK--..................-.LAPLYELIIQ.-------...........................................-------STLKE-..........----KCS..EDLSVHKSCF.F.VS...--.LPDcpkhcyfi.......................nkgpeksnL.vGALVSKIPFTHPKCVPPVIEILRHQVAYNSLISSCV-s.......................................................................................................................................................................
A0A0G2DUR1_9PEZI/289-430             ....................................................................................................aamhli---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------------.........-----.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....--GKLP...NVRFVAKLNPPLVVPLNTAQNIL.TSVN.VQMNQESLK..................W.STSLEALVLK.PDDEPTTglt....................................teftKEYHNVRNVFVV-..........--DKNGK..EQDKRHEATL.Y.VN...KA.EVA.......................................C..--VLDEIPFDHPRQLIQILPVLRQYAHLTTLLQSA--lq......................................................................................................................................................................
R7Z0D1_CONA1/165-604                 .................................................................................................lgiiervgs---------...R-PGL....-VSEEGVERVCRRLGL..DWYAD......................EGK...aAQGTKDPFPSTAG.TK.FMLELDF.........-SG..R..TP.....S......CRELRYGAN......-......WE.....GK..EEH..................................................AERGKRILQRDLRpvd................eksaLGNTLD.RFAGNLGRLANLNRLST-.........EEVDC.FEVVAGVYVSLKRLFEHEKKAa.mA.-----Lldp....................vaadADEKAEREVMCKRSGRPRMN...VGKTLG........................LSLQYWMDRRH..IRRRRAR.lTSTPa...kAATRMDIDQ-.....................-KPDV.EEP.....EEIYSLTIECESS.P...........AE......LYPPIRK......................SDAWISEAIEKSs....................................hDIFSTSNIDWLEPPSTYetppsld.........................atqasamSLDA....nNTGKLP...NVRFVARLNPPLVVPLNIAVQIH.SSVG.TEIPPGSI-..................L.PTMFEDLLLK.RDDTDAAkatg...................................vgdaKEIRSETEVFVA-..........--GRDGT..GTKRRHVNGL.F.VP...--.KSG.......................................Y.yGCILEEVPFRHPREIVEILPVLRQHAFLNSLLRSTF-l.......................................................................................................................................................................
U9UQY8_RHIID/1-288                   .........................................................................................................m---------...-----....----------------..-----......................---....-----------SG.AI.IVLDIKY........dEIL..N..RI.....I......KVVVSYATD......-......AR.....QN..DK-..................................................DDRVNNLLTQQLS.......................DFKQFN.LFKKNLETLKTLETMSKL........iQPVDC.FHCIKCISNDIKTIYEKEFAI...-.------...........................TNGDV-QKILTEGHGIP-LF...NVDRVG........................PSIAYWAPKHQ..IMEIDWK.fIKDI....iIQGE------.....................MHESF.RSL.....HRMWISMEKSRT-.P...........HL......FLPPGRN......................-QYLLNDELENEielm..............................enyyI---------------Spelpevqfsl...................lqaplkflhpKEDS.....TIFASA...LIEFVVWLDPPVYVSDNVARHIG.SYAG.IVNRG----..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------yfvssafqkkdpqtlsleqllvsn................................................................................................................................................
C0NN58_AJECG/132-559                 ..........................................................................................................EEVIRLLRT...RVSGR....GICREGVERLGKFEGF..ECMWQ......................ENI....--------LSIAG.NL.VDLEIQF.........EDG.sE..NV.....K......DVSLKYTTP......-......SI.....VE..GER..................................................RVEATAVLKRDLMqtvg..............kdeeiPWKSLD.AFHSNLHRLAKLDRLS--.........REINC.FEAVEGLYKSLNRL-------...-.WEGELSr........................ypGRGHYEHVCT-SQVGHPGIH...QDGRIG........................LSLQYWVEQRQ..TLDSNRN.gRPNA.....MNIDQPTPDD.....................RKPAP.AKI.....HKTWRAAIECEE-.-...........--......GYPSLRV......................SKEWIAAELFTTmnnges..........................slaadgNDSEILLVNWIDPPATLvsnp..............................ndvplDSTA.....LGTTTP...NRRFVARLEPPIDMPIIAAAEVY.RLLG.MNMPVEPK-..................-.TVTYDGLVVP.LPNLASTgdgqdd...............................nslaasNGRIHEKVVYSF-..........--DDDCQ..PRKHRHIYTF.H.PF...EH.IVG.......................................R..--TIRDLPFSHPRQLADVLPILRQYALLSSLLHRVF-v.......................................................................................................................................................................
M7BXJ8_CHEMY/71-159                  .........................................................................................................l-SCLEKIQRt.lNAKSL....STVMTRLEFLSKQMGL..KS---......................---....HISPNGTVCYLTS.DM.FYVEVQL.........EKD..G..KV.....I......DVKLAHLGE......-......AP.....VV..CDD..................................................-------LVQLLS.......................------.------------------.........-----.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------dmka....................................................................................................................................................................
A0A0D1BZM4_USTMA/195-405             .....................................................................................................letld---------...-----....-ALCETLETTAKALGL..ETFSEpssea............tevpsDTA....SGSVLTHTLTLGA.KI.LVIDIELh.......iVKT..G..TV.....EgfrpktKLKLSYATD......S......VD.....SQ..QTR..................................................DPRLGAVLERDVEliaeklfgpv..sssslqqdrtvVAQTLA.KWTTNLNELLVLDDLEARasqaategsRTSDL.FAAMQGLCSAVARISEAEASS...S.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------ssaaalldrghglhklhetkpflhs...............................................................................................................................................
G4V7K4_SCHMA/112-452                 ............................................................................................siaavyfefnhdka---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....VP..CPE..................................................-------LATDLS.......................-MGKYS.SLLQHVDNLLTIYAVPGDk.......iDRART.YLCLQALEKDLSML--TQAMR...-.TDLENNidaistf............rrapnqkhDVFSMRNLVNRSLVGHFVGR...TGGRL-........................ARLTYLVTSAQ..AMISNAT..GVM-.....----------.....................KNNLQ.MNS.....KSTYSTSIGCGSR.D...........GL.....iGGYMARIglcp.............rlsyvEDTSVVV----Qsavqrlpf......................mplvtlqkD------------AYGIsvp.................................hfaQPDE.....IKCISI...EAEFVLHLDPPLPISTDAIQQLE.RTTG.LSNTEIIDQ..................K.EEDIVLLILR.-------...........................................--KHKQEHLYGI-..........--NT-HL..QNPNITQHSY.Q.IK...SD.VKA.......................................Y..--LVSSVPFTCSDQIGEIISILRKQAS----------alafyetfi...............................................................................................................................................................
A0A094D5I9_9PEZI/128-547             .......................................................................................................lmq--IVETLKA...V-KGR....-VSEDGIERLARSVGL..ECLWE......................TGM....GRGGKSKTLIIAG.TG.LSIDIEF.........-TD..N..AV.....E......TVTLGFPES......-......PE.....SV..TRH..................................................AERAGKILLDDLKlgk................netvLTKRID.RFAGNLDRMARLDKLSVM.........PQLNC.HEAVAGIYDSLEKL-------...HeWEVARLteee..................amsgkTQEQIVRAALLTKSGRPAMN...AHGSVG........................LCLEYWQERHA..TSRGE--..----.....----------.....................-----.--G.....CKTWSLLLECDQS.S...........SM......VYPSVRV......................SSTWISPSVVKSnptd..............................ddvlLSASGVVLDWQDPPNILlpadpdqk......................ddsgmegieQSGQ....lPNQKFP...DVRFVAKFSPPLTIPYSAAMQIY.DSTG.AHLEPDSL-..................-.-AAFDALAFP.PSTAEPSepd.....................................gahRRIRKEQLVSVY-..........--NRAGE..HEKRCHANTL.A.IP...KM.EYA.......................................L..--TLTEVPFSHPRELVQMLPILRQYTRLSTLLERSF-g.......................................................................................................................................................................
I3JGN0_ORENI/44-400                  .........................................................................................................e-RSLEKLQEe.sNVCTI....NTTKLRLEIIAKQQGM..SFHF-......................---....----AEATCYLSA.DL.FYVEVLL.........LPC..G..EV.....E......EVKVVLHGE......-......SP.....VP..SES..................................................-------LLQLLRv.....................hRSKNFA.AFSLKLQGLFAQYNIPGDn.......eMKLKL.LASLQCLGKDLRKISHLPREQ...K.YS----...........................---------------DPEMDl.iNNGRIGdlimg..............kedcpFTIRFFIPPTN..GTKTLVS..----.....-VVQAAQVTV.....................VVSDV.THK.....LQMASVVPQPPQL.D...........PQ......GYPVF-V......................------------......................................-----------------.......................................PLNE.....VPNEML...PACFLLKLQPAMPVMPSFVKKLS.QITD.VTVADVDL-..................Q.WAPLPTLLMR.-------...........................................-------DSLSA-..........---NSSW..EMTCESKMIF.T.VP...--.LPGgvmhsyicp.....................gaawdvpahR..GAVVDSVPFTHPGHVPALLELLRHQCTINTLLRSCF-t.......................................................................................................................................................................
G3AXY3_CANTC/1-408                   .........................................................................................................m---------...-----....--SIELIQKLSQQLNL..DTFIDtdaysh.........iidqpyhDES....GNSIKFQRLSIAG.SL.ILIDIDF.........-LD..S..VI.....Y......RVSFSSANQ......L......YD.....NK..LSDinssgaesntkspptvykqdn........invikltfafdsvesildkkeYNNIEVILLKSLQ.......................-APKLM.NFPRNLKYLAKLDRLSN-.........THIDA.FTYVDNAASILKAIYSLETQA..sVdWL----...........................-----IEAGYSNSIGKPCINk.pWSNDVG........................IFLEFWEDFRY..INHEYQQ..EGSG....lLLGQKYSLLFdldqs...........trkspTDFIG.EAR.....DHIWEFNGEKYQL.-...........QF.....gDNTYLTT......................GRSSIT------......................................-----------------.......................................ASTK....nDTSFTS...NWAFNLVLSHPIYLPINIIEFIG.I--E.SFEESDFK-..................D.DTFFDKLNVE.-------...........................................------KDFYV--..........-------..HSKVNKGLKF.S.IK...SD.IHS.......................................K..FVSVRSLSIKTLRDIPLFIRIFRNQIVLTNILKQLI-w.......................................................................................................................................................................
R8BHV8_TOGMI/58-485                  .........................................................................................................k-AVIDLLKQ...K-KGL....-VSEAGLERLTKSTGL..EYLWD......................EGT....INGAKSRTLIIAG.SA.LALDIVL.........-VN..N..IV.....Q......KVSLSFPES......-......SK.....SV..TKD..................................................VAKAEQIILEDLKllp................tqspLTKTLD.KFAANLERLAILDKSSVI.........PGLNT.HEAIAGIYESLGRL-------...HrWDIDKLredg..................slagkGDEFLAVTALCTRHGSPVMH...ARDRVG........................LSLDYWRERRL..QHSHSIT..-NAS.....----------.....................---QA.SEA.....LKTWALMVSCAPL.G...........GM......VYRPVRV......................SDKWISTEIEKLhptd.............................eellsNTTGQPILDWQEPENIIlpnadgsk.......................sdastdlmQAESi...lSGPKYP...EVIFMAKFDPPVAVPYSVWEHVH.QLTG.ATASVTS--..................-.LETFDILLFP.IPPGAHHdp......................................aepRTIGRTKKVSFV-..........--SKDGE..TSLKTHENTL.F.IY...KP.VYG.......................................K..--TLTEVPFSHPRQLVEMLPLLRQYAFLSILLDKSF-g.......................................................................................................................................................................
A0A080WGQ9_TRIRC/171-649             .........................................................................................................s-EVLSMLRS...RVAGR....GVCREAVERLGTLEGF..ECMWQ......................DNN....--------LSIAG.NS.VDLEIEFgr.....dgTEA..D..VV.....K......DVTLRYATH......D......M-.....AE..GEK..................................................REAASAVLKRVLTfgddgdgd.......aeervaagEWKPVD.AFHANLTRLARMDVLC--.........REVNC.FEAVEGVHESLQKV-------...-.WDSTSRgtdpdlklnthtdtdtdtdtkktssgpESRFWERLCRRSSVGCPTMH...RGKNVG........................LAIHYWADQRR..LLDAQRT..SLE-.....----EVLQAEls................pslKQSKG.CSR.....RQVYNAVIECEA-.-...........--......GYPSLRI......................SKGWVGDPTVLPtqdennnennnendinitsndnndnndnegnnggedtnGKVGKTRTNWLEPGPTL.......................................VSTDp...lLPSSPP...NVRFVARLEPAIHVPIVVAAEVY.RLVG.ITMPQETR-..................A.PAAYDALVVP.VERRPSRtgk.....................................gegEEEEHVRTVPIFG.........qTKGAEDE..VTRKKHVYSF.H.PL...EH.VPG.......................................Y..--TVRELPFSHPRQIEEVIPLLRQYALLGKLL-SVF-q.......................................................................................................................................................................
C4XW31_CLAL4/19-336                  .........................................................................eraskytskqseytinvvfsqanslsflrtrnd---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..--S..................................................STVAEAILLKNLS.......................-NNVLG.NFPTNLKYLTCLDSMSP-.........LDGDL.IVYLDNIALYLNAVHAMETNLn.pGiTD----...........................-----IRSGWKSRFGKIYLNd.pETQRLG........................VFLHFWKESRR..LSEVMKH..GATP.....----------.....................----C.NSR....vHKAILTIEEGES-.Q...........SL.....dVLKEA-K......................DQKWHLS---TS......................................QGLLQPYIFTFEDDSHL.......................................HNHQs...vTSFSSP...NWALHLRLDFPVFMPSVHIEYFG.-ITN.YGQAKKPR-..................E.PEVFKSLKED.-------...........................................-------GAVQF-..........------L..ARRNGENISI.S.FT...SD.DTA.......................................E..LVAVESFEITKLTQLEKIIPTIRNYIVFSSLVDNVM-q.......................................................................................................................................................................
F0XGS2_GROCL/141-570                 .........................................................................................................q-TVLTILKR...S-SGR....-VSEAGLERLAKSMGL..ECLWE......................EGM....-GGNKARTLIIAG.SA.LALEIVV.........-LN..N..IV.....E......SVSVTFPES......-......QN.....II..LRH..................................................VERANQILFDDLKllp................gespLTKKLD.AFSAHLEQLATLDKLSAE.........PGLNL.YEAVAGVYETLDRL-------...FrWDLQKLceep..................gqsgkPKDTLELTAQCSRHGRPAMH...ESGRLG........................LSLLYWKEMRL..VPPRQPD..-TAA.....----------.....................---YA.KTK.....EKTWAILVGCSAM.G...........AQ......VFQPVRV......................SDKWLSDAIEKDgg.................................mfgGDRTQPMLDWLEPENTIlssaqp...........................ggesdeKVNS....vAGARLP...GVVFHAIFDPPVAVPYSVWHHIS.ETVG.MVLEPETL-..................-.-VTFDALSFP.VEPGSQHdp......................................selRTISCDKDVYFVPkgsr.dddnaAADVTAA..AGSKKHHHTL.F.VY...KP.VYG.......................................R..--SVTELPFSHPSQLIDMLPKLRQYAFLSTVLEKTF-g.......................................................................................................................................................................
L1JL53_GUITH/206-512                 waklqrilstgdtvpneaesvqrqwiemnediaagmmsmdleaslrdkfkslqkteeshgrspnagvydalrkleievekevsaqlhqpkaentepmeetldhlsg---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------------.........-----.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................----------------Ygvvkrlveglqfefyqps..gfssdlttnrailelkgviQGQG.....SKSSVQ...PAM-CLKLNPPVHICIATAAKLE.ASER.ALRKAKDQT..................Q.RETTEDQG--.-KEGQKEskeggkeesqqrad..............sissplgdiplagasHAVRWQSLV---L.........pADFKYTS..NP--SNSMPF.P.SS...SP.HPH.......................................LvsGIEIHSIPVETAPQILQVLQDLRQTLVLNELLVSCF-q.......................................................................................................................................................................
N4TGE5_FUSC1/118-532                 .........................................................................................................e-TIIATLDQ...K-KGL....-VSEAGLERLAQRIGL..DCLSE......................DHT...aSDGRKQRTLVIAG.SA.IQLEITL.........-HN..N..IV.....E......NISLAFPES......-......AR.....SV..TDH..................................................VTRASEILLRDLQllp................nqspLTKTLD.KFAVNLERLAVLDKLSII.........PGLDC.HEALAGIYVSLERL-------...HkWDVARLrdep..................gmggkPDSELSTMAMCTRHGYPVMH...SKDRVG........................LALQYWKALRL..VQPTNTK..-MAS.....----------.....................---FT.SSH.....EPVWSLLIGCAST.G...........GM......GHMPVRV......................SEDWISKDVVKAe...................................psMDPKRPNLDWQEPDNVVlphseen........................kdasmemlQPDL.....STARVP...QVMFVATFDPPVILPQNDWLRLH.SYAN.VNANPLFG-..................Y.SPTFDSLFFP.IPPGSAQdp......................................selRAISRSRDVRIY-..........--DKDQT..AIIKPHQNTL.Y.IY...KQ.IYS.......................................Q..--VVTEIPFSHPQQLIEMLPLLRQ-------------deladf..................................................................................................................................................................
E9D245_COCPS/136-554                 ..........................................................................................................DEVLQLLRT...RVAGR....GVCREGIERLGKLEGL..ECMWQ......................DND....--------LSIAG.NS.LDLEVEF.........EPG.qE..IV.....K......NVTLRYATP......D......A-.....PE..GER..................................................RVEASEVLKRNLMqgpg..............eqeggHWKSMA.EFHENLRRLARLDQLS--.........REINC.FEAVEGIYECLRRI-------...-.WDEEKKh........................gtRQSHLDHICK-GWIGKPSMH...GGKHVG........................LMLRYWVDQRR..MFEAKQV.pPSNA.....MDTDLPAQD-.....................-DEEV.PDK.....ANFYSAAIECET-.-...........--......GYPSLRV......................SKEWVSADVFTEirne..............................dggdNELEIRMINWTEPPPTLvsplsn..........................npdsvalEPTI.....LSSTAP...NIRFVARLEPPVDMPIFAAVEIY.RAIG.ANMMQESK-..................-.TTTYDSLVVP.-SQGDSNfie.....................................fegRQVMQKREISTF-..........--GADGK..PVKQQHTYTF.N.TF...EQ.VPG.......................................R..--TIRDIPFSHPRQLADVLPILRQYAFISSLLRRIF-s.......................................................................................................................................................................
A0A0P7UC85_9TELE/109-487             .........................................................................................................l-TCLETLQRa.lKVSSL....PSMTDRLESIGRQNGL..G-S--......................---....HLSPSGTECYITS.DM.FYVEVQL.........DSG..G..QL.....V......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQHLR.......................-EKNFE.EFSKHLKGLVNLYKLPGDn.......kLKTKM.YLTLQSLELDLTKMMHMFRCC...MlREAEML..........................aTNAS-------------TIEt.iLHGSVGlltpr..............sggllLSLQCYVSPYD..VFEEGTG..---A.....-VLNFTDSTV.....................PRS--.-LG.....ISVSVTVEGTSSVyK...........-L......PIAPLIT......................GSHPVDN-----......................................----------KGTPSFS.......................................AVTN.....SNSVEL...PACFFLKMNQPTPFSLSFIQRMG.KATG.ISVFETTP-..................T.LAPLYELIVQ.-------...........................................-------SQLQE-..........--EGAGV..LPSHAQTMRF.Y.AS...--.LPGqqhcyflnr....................dapvqdgrclQ..GALVSKIPFRHPAQVPALLDVIRHQAAYNTLIGSCVK........................................................................................................................................................................
U3JRL1_FICAL/48-400                  .........................................................................scmekiertlngnelmdnsnfvfifliflrltv---------...-----....----------------..-----......................---....HVSPSGTACYITS.MM.FYVEIQL.........EKD..G..DV.....M......DVKLAHFEE......-......AP.....VV..CDD..................................................-------LVQLLR.......................-MKNYD.AFGKILEDLSNMYQIPGNs.......eMKAKG.YLALQALEKDLYSMSLLDRTQ...D.LN----...........................----RVTEVL----------...-NGKIGhlvpr..............tggtpMNIEFYISPYQ..VLEAELN..HGSR.....----------.....................-----.--Vc...gTKTVVTVEGTDTL.H...........KL......PLSPLIV.....................dPQDGESN-----......................................------------SPTFL.......................................QLTD.....ELSMDL...PAFFVLKFHQPVPMSSSSIEEIQ.RLTG.IQISGLK--..................-.QAPLYELIVQ.-------...........................................-------STLKE-..........----KCS..ENLSTNEYCF.F.VS...--.LPDcpkhcyfi.......................nkgsakadL.aGALVSKVPFSHPKCVPGVIEILRHQMAYNTLIGSCV-s.......................................................................................................................................................................
H2NUA7_PONAB/59-428                  ........................................................................................................vs--CLETLQK...ALKDLfflpFTMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....VS..CLE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAIMYWKA...-.TN----...........................--AGPLDKILHGSVGYLTPR...SGGHL-........................MNLKYYVSPSD..LLDDKT-..--AS....pIILHENNVS-.....................----R.SLG.....MNASVTIEGTSAMyKl........piAPl...imGSHPV--......................DNKWT-------......................................-------------PSFS.......................................SITS.....ANSVDL...PACFFLKFPQPIPVSRAFVQKLQ.NCTG.IPLFETQP-..................T.YAPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PIPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLISKITFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
H3CFE0_TETNG/59-434                  .........................................................................................................h-SCLENLQRa.mKVSSL....SAMTDRLESIARQNML..G-S--......................---....HLSPSGTECYITS.DM.FYVEVQL.........DNS..G..QL.....V......DVKVAHQGE......-......NP.....TS..CPE..................................................-------LIQHLR.......................-EKNFD.EFSKHLKGLVELYKLPGDn.......kLKTKM.YIALQSLELDLTKMMHMYRLA..tS.------...........................-ANTL-ETLLHGSVGLLSAR...SGGHL-........................VSLHCYLSPYD..LLEEKTC..--SP.....LSLTDNNI--.....................PRS-L.GLG.....VSVSVTIEGTSAIyKl........piAPl...itGSHPVDNkglrtp..........sfstvtNSNCVDL-----......................................-----------------.......................................----.....------...PACFFLKLNRPMPFSLAFIQRMA.NTTA.IPVFESPP-..................M.LSPLYQLIVQ.-------...........................................-------SELRL-..........QEDGNIT..PTLCPHNMTF.Y.SV...--.LPGqlhcyflng....................dapvqdgqslQ..GVIVSKIPFRHPAQVPLLLDIVRHQAAYNSLIGSCVK........................................................................................................................................................................
F7CMI2_XENTR/68-421                  ........................................................................................................lr--CKNMLQEa.lKAKSL....SVILSRIECISKQKGL..D-S--......................---....HLGPNEKICYITS.EM.FYIEVQV.........KKN..G..NV.....S......SVKLAHHGE......-......TP.....VV..CNE..................................................-------LLQFLR.......................-AKDFK.AFGRSLEGLLLLYNIPGNs.......eIKAKV.YIALRSLEADLSAMFNLYSSK...KpND----...........................---------------KEFAI...LHGQVGylspr..............cggtpMGIEYYISPCV..LLEEKLK..-PGS.....LVGG------.....................-----.---.....YKAYLSIMGSNNW.FllpnsplfsglQQd....sNMPSFSVl....................tEECSMDL-----......................................-----------------.......................................----.....------...PACFCFMFTDPLPLLLPFVQKIQ.CITG.LPVAGI-K-..................-.QAPFHELITH.LENSCCT...........................................TDEASTDAQFIL-..........SI-----..PDCRDHCYAI.T.--...-S.VTDnk...................................eaL.mGILVDKIPFTHPSQVPPTLEVLRHQAAYSTLINSCI-s.......................................................................................................................................................................
A0A094E6B0_9PEZI/28-446              ........................................................................................................mq--IVDTLKA...V-KGR....-VSEDGIERLARSVGL..ECLWE......................TGM....GRGGKSKTLIIAG.TG.LSIDIEF.........-TD..N..VV.....E......TVTLGFPES......-......PE.....SV..TRH..................................................ADQAGKILLDDLKlgk................detvLTKRVD.RFAGNLDRMARLDKLSVM.........PQLNC.HEAVAGIYDSLEKL-------...HkWEVARLteee..................amsgkTQEQIVRAALLQKSGRPAMN...AHGSVG........................LCLEYWQERHA..TAQGE--..----.....----------.....................-----.--S.....CKTWSLLLECDQS.S...........SM......VYPPVRV......................SSAWISPSVAKSnpta..............................ddvlLSASDVVLDWQDPPNILlpsdpdqk......................deggmegieQPGQ....lPNQKFP...DVRFVAKFSPPLTLPYSAAMQIY.DSTG.AHLEPDSL-..................-.-AAFDALAFP.PKTAEPSepd.....................................gahRRIRKEQLVSVY-..........--NRAGE..HEKQCHANTL.T.IP...KM.EYA.......................................L..--TLTEVPFSHPRELVQMLPILRQYTRLSTLLERSF-g.......................................................................................................................................................................
A0A0G4LXL5_9PEZI/126-550             ........................................................................................................da--IIDIIGN...A-KGR....-VSEAGLERLSQRTGL..NKIWE......................DHR...tPDGKVKKTLVIAG.HG.LQLDVIL.........-DN..N..IV.....E......GVTLAFPES......E......SP.....IV..AKH..................................................VDRAGQILLRDLQllp................dqspLTKKMD.EFAANLERLATLDKLSIF.........PGLDC.QEAVAGIFESLERL-------...YnWELARVkedp..................amagkPDVLLEKTVQCSRSGRPAMH...ARDQVG........................LSLDYWAERRL..VPPKTPA..----.....----------.....................TETYC.ANA.....EQIWSIIVGCRPL.D...........GE......LYPPIRI......................SEDWISQKVEKTdpvp..............................tdllEPSNGPLLDWLEPAATVlppasdn........................kvvavevvQPDG.....TTQRYP...NVKFVATLNPPVIVPQAVCNALY.NLSG.AQPPPMML-..................P.SYTFDGISFP.IVDGQNHda......................................selRTISCERDVFVL-..........-----GA..PQPRRHENTL.F.VY...KP.VYG.......................................Q..--TISELPFSHPRQLVAMLPTLRQYAFISRLLARSF-g.......................................................................................................................................................................
A0A099NXK8_PICKU/13-168              .........................................................................................................a-EIIDVLST...R-PGK....-VCREGIIRVAERHSL..TTFTE......................LE-....-------RISISG.HD.ILIDVDIekg..nlgdHGE..E..RV.....C......GVHVASASG......G......G-.....DA..LPV..................................................LKGLDELLLRNLQ.......................-METLT.RFNMNVCELSYIDREE--.........-RAPL.EEAIARMQEAGEVLFNY----...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------rdeigvtlryadenrengggy...................................................................................................................................................
Q2M094_DROPS/77-435                  .........................................................................................................q-SALDKLQHy.iKVTSR....HGLVERLESLSRQLGL..KFM--......................---....---EDQQLLFIST.DM.FYVEILL.........DAS..G..NL.....S......DVKVHHECK......I......E-.....QQ..SSE..................................................-------LVKCLK.......................-SGDFA.DFTVQLEGLSSIYQLNAEp.......kVKKKA.FVALQAMETDIYSLYSHQMQN...RtGD----...........................---------------SYDIM...NSSAVGlvlqr..............rgghpMKLTYFCPPIH..LAEGESK.lASSE.....FSIDQVMHS-.....................-----.SHG.....LSATVNLEGSSAN.K...........LQ......IMPILSF......................SRDPQTG-----......................................----------LELPTYA.......................................QLNQ.....NNSMLM...PATYVLRLNKPMPVCYETLKSLG.-LPG.VEGMAAAPS.................pP.VATVLNLIVQ.-------...........................................---TASKQAIKN-..........--TQRGL..YVNLPKETHC.Y.FF...TD.NRK.......................................L.qGTLISSLPFTEPAQVPKIMTFLKKQALFYTLLASCVR........................................................................................................................................................................
A0A0D9M943_9EURO/133-555             ..........................................................................................................EEVVQLLRA...RVSGR....GVSRESVERLSRLEGF..ESIWQ......................DDN....--------LNIAG.NF.VDLEIDF.........YPG.qD..VV.....K......DVSLRYATP......-......EY.....TE..GVR..................................................REEATAVLKRTLAqspe..............daecgKWRSLQ.EFHENLQWLAKLDKLS--.........QEVNC.FEALENLEENFRRI-------...-.WVEESKn........................gkHGGEYQHLCA-GVLGRPTMH...KGSRIG........................LGLEYWVEQAK..VLDAKQS.lISPD....aMEIDPQHEQG.....................SKGEL.DDQ.....SRSWTVMIECEE-.-...........--......GYPSLRI......................SKEWVGSEVFTAgest..............................ellpSNGAAGSVNWLEPPQTTrlthg.............................nhdpmALDSs...mLESSPP...NRRFVGKLEPALDVPILAASEIY.RQLG.MQLPQEFK-..................-.MITYDALLVS.ESSALTSpvs....................................spqiGRRKRRMSVHAV-..........--DSKGE..QYTKQHNYTF.Q.SF...ES.ITG.......................................C..--TIRDLPFSHPRQLADILPILRQYAVLANLIRKTF-h.......................................................................................................................................................................
R1EP95_BOTPV/155-591                 .........................................................................................................e-NIIATLKA...R-PGR....-VSREGMERLAKQLGLssEVMSD......................AHG....-----EQQLLLAH.TS.FMLEVTF.........-KD..N..VV.....D......NVTVQFGEL......-......SE.....SV..QKQ..................................................RTSAAKVLKDDLSpsp................gaasINLSLD.KFAKNLEKLARLDHLSIFkd.....gkPEVSC.FEAIAGVYNGLQKLFEHEKKTa.mHiFDVSKP..........................hVHEKAVREVLCKKSGRPRMN...VNSAVG........................LSLEYWMERRK..VFQKPEK..-TSS.....-DTGMDIDDG.....................DEVYD.ETM.....NRIFSLTIECESS.P...........AQ......LYPSIRV......................SDAWISDTVEKPsd..................................pnDIFGSPVIDWLDPPPTYsggsea...........................aqndpmALDG....nSIGKLP...NVRFVAKLNPPLVVPLNTAQNVL.ASVN.VQMNQESLK..................W.STSLEALVLK.PDEESATgla....................................tditKEYYNARNVFVV-..........--DKDGK..EQDRRHETTL.Y.VN...KA.EVA.......................................C..--ILDEIPFDHPRQLVQILPVLRQYAHLSTLLQSAF-q.......................................................................................................................................................................
A0A084QPS7_9HYPO/118-541             .........................................................................................................d-TILALLNK...K-RGL....-VSEAGLERLAQRLGL..EFLSE......................ENI...gPDGRKSRTLVIAG.SA.IALDIAL.........-DN..N..VV.....R......NISLAFHGS......-......PP.....SV..ARH..................................................ADAASQILLKDLQlap................sqspLTKTLD.QFAKNFEWLANLDKLSIS.........PGLDC.QEALAGIFASLERL-------...YkWDMTKLreep..................amagkSDAYISSTAMCNRHGYPAMH...CRGKLG........................LALQYWRELRH..VPASNS-..---S.....----------.....................-----.DQA.....DKVWSLLLGCAPI.N...........GL......GQPPVRV......................SENWISKDIVKAdp..................................taIGDKKEALDWQEPDNVIlppseen........................kdagmellQPDL.....STTRVP...RVMFTATFDPPVKLPQNEWMRLY.AYAQ.AEPPNLNALdf.............shrP.PPTFDSMVFP.IPPGTKQdp......................................seaRTITRVRQVRVF-..........--DEAKQ..PVQKTHHNKL.F.IY...KP.IYS.......................................Q..--EVKDLAFSHPRQLIDMLPLLRQYAFLSILLENSF-g.......................................................................................................................................................................
A0A0F4Z8C9_9PEZI/116-530             .........................................................................................................d-AVIDLLST...K-RGY....-VSEAGIERLVHRIGL..DCIWE......................GAA....---NKSRTLIIAG.QA.LNVDVVF.........-QN..N..LV.....Q......SVTLQFPET......-......AG.....IE..KEH..................................................TDRAAAIILQDLQlgk................yqspLTKTLD.RFAVNLERLAILDKLSVI.........PGLDC.QEALSGMAFSLEKVFAFDVAK...ArLDNTGVe.........................lTQEAVENMVMCTKHGYPIMH...TRDSVG........................LSLLYWKEKRL..VPVAAKL..----.....----------.....................-QKFV.EEY.....EIVWSILVTCAPA.Pi.........gTS......PFGLMRV......................SRDWISPNVIKAdslp..............................eetlNSVTGVVLDWLHPENTLlp..................................askE--Gnm.glSQPKYP...EVIFKAVLDPPVVLTHSAYMQVL.EITG.QAMPVQQV-..................-.SVTFDGLIFP.VPKDSNYva......................................sepRKIKSVRKIVRF-..........-ENSGRS..SVVCTYDTSL.F.IY...KP.VYG.......................................Q..--VLDEVPFSHPRQLIDILPMLRQYALLSTLLRNT--y.......................................................................................................................................................................
S3CAT7_OPHP1/128-566                 ........................................................................................................ri--VLDLLKA...S-KGR....-VSEAGLERLAKSLGL..ECLWE......................EAM....DKNSKARTLIIAG.SA.LALDIIV.........-EN..N..IV.....E......SVSVTFPES......-......RS.....IV..LRH..................................................IERANNILLHDLQlrp................despLNKSID.RFAANLEMLARLDKLSVD.........PGLNL.YEAVAGVYETLYRL-------...YeWDLQRLrsdp..................ansgkPDDVLAVTVQCARHGRPTMH...EHSNLG........................LGIDYWKQMHL..VRTAQPS.aDEED.....----KV--YG.....................KDD--.NAD.....DKTWSILVGCMPIgD...........SL......VYQPVRL......................SDKWLSDAIEKPngg...............................llsnNGISEPELDWLEPENTIlasnps..........................egdkpgeALTT....lAGAKLP...DVRFNAVLSPPVIIPLPVSQNIN.NFLG.SVMAAE---..................S.YVTFDSLCFP.VPAGTPHdpsep.................................rtiqcDKDVYYPTAPNEH.........gDGNADDT..EATKRHRRTL.F.IF...KP.VYG.......................................H..--VLRELPFSHPSQLVQILSTLRQYAFLSTLLKNGF-d.......................................................................................................................................................................
U3J0Z2_ANAPL/58-425                  .........................................................................................................v-SCLETLQKa.lKVSSL....PAMTDRLESIARQNGL..G-S--......................---....HLSANGTECYITS.DM.FYVEVQL.........DPT..G..LL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQHLR.......................-EKNFD.EFSKHLRGLVNLYKLPGDn.......kLKTKM.YLALQSLELDLSKMAGMYWQA...-.TN----...........................---------------ANPLDk.iLRGSVGyltpr..............sggllMNLKYYVSPYD..LFEDGT-..-GTP.....-----IILHE.....................NNVPR.SLG.....MNVSVTVEGTMAMyKl........piAPl...imGSHPVDS......................------------......................................----------KGTPSFS.......................................SITS.....ANSVDL...PACFFLKFPRPIPVSRAFIQKLQ.SCTG.IPLFDTPP-..................T.FVPLYELITQ.-------...........................................-------FELS--..........---KEAD..PVPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLISKIAFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
A0A0L0NWA6_9ASCO/6-410               .........................................................................................................h-ESLKLLYD...YLENF....NISLDLIQRLAQFLKL..DTFID......................SEVq.dpQTKQSVKRLSIAG.SL.LLVDIDF.........IDS..H..TV.....T......KVALALGNH......S......TS.....AV..SSAhseenavisttkvddttvv...........rvnfleanfvsflnirndndASVAENILKENLR.......................-GPKLG.KFPLNLKYLANLDRLSP-.........PEGDL.VLYLDNIAKYLEVV-------...HmQECKLR...........................PEDEDIRSGQSSIIGKLMYNd.tQSLELG........................VFLQFWKTKNR..TKSSQYN..---E....vIEHQTYVGRLsvie............segpnRDYLK.EAT.....KSLWEPRDQENA-.-...........SL......EYKITFD......................DEKHLP------......................................-----------------.......................................KGVS....vCGPNNK...QWELQFNLNHPVYLPREIIDYLG.FDK-.YEVANDTD-..................-.----------.-------...........................................-----LKEVFDKI.........iEFGSVDL..MS-ELKNLRV.Q.LD..lKG.FSD.......................................Y..-IPLTSVSLPSLNSIAKLLPSLRNHILLSTWI-----teia....................................................................................................................................................................
E1B7Q6_BOVIN/59-426                  .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAVMYWKA...-.TN----...........................--AGPLDKILHGSVGYLTPR...SGGHL-........................MNLKYYASPSD..LLDDKTT..--SP.....IILHEN--NV.....................PRS--.-LG.....MNASVTIEGTSAMyKl........piAPl...imGSHPV--......................DNKWTPS-----......................................---------------FS.......................................LVTS.....ANSVDL...PACFFLKFPQPLPVSRAFVQKIQ.NCTG.IPLFETQP-..................T.YVPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PLPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
G8C0M0_TETPH/12-442                  .........................................................................................................n-EIIELFQN...YKPGR....-INLDNITKLCQTLGL..ESFID......................DID....---TNISRLSTAS.KI.IVVDIDF.........DKS.lG..KV.....K......DVKLVLASN......F......D-.....-N..F-Nyftdkslllns............................vngtnntnlkeEQTENNILLNSLT.......................NYADLN.EFYQNLKYIYLLDTYSC-.........IDLDS.NQAKSKSSGNTTVINSGDIISttnYaV----Sat......................dnvSSLQISSTGNMKPNSSPNAN...ANLDVNnahtatspvpa..qnidkndckldL-FKYYTELAD..YVRNYFI.sNNSD....fTVITNLRDIFgiy...............iiwNDD--.-FK.....NPIARIYLEKSKEsKnr.......lfEF......VYLPG--......................DDKWSNEDFEKY......................................TIGVSLVMEIM------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------getenqtgkhnsiwfpkesisddlilqssftdiikenidsndnnmlnilfkniqsdnnlsindylifsgkcrlvndfttsliniskfdigndhldlmleilnwikwskmvltpvfe....................................................
A0A0N1NWC9_9EURO/133-369             .........................................................................................................q-QALDKLKC...KVIGR....NVTRDGIKRVAQLNGL..EAV-D......................IDD....------DNLVVAGeNV.VEMEITFd.......pVQR..N..DV.....K......DLCLKLNYD......D......QT.....HV..QT-..................................................--ESTAMLKAQVAa....................daSVDALT.NFAHNVEYLAQLEKID--.........VKPNC.FQLVNNLSACLQDVWKEEKKR..mH.WR----...........................--DELHHLRR-GAVGMPIMD...RSPRLG........................LGITYWQKEQA..SRAEQLE..----.....----------.....................-----.VSE.....SDQYRATVSCES-.-...........--......GLPTMIA......................FEKWLKDDILAE......................................AQPGQNVLDA-------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------kdhvfyp.................................................................................................................................................................
F7W429_SORMK/122-537                 ..........................................................................................................DEVISILSQ...I-RGY....-VSEAGLERLARKLGL..DCMWD......................EHI....-AGESKRTLIIAG.SA.LELLIGF.........-TD..N..IV.....Q......SLALAFPES......-......SD.....SV..NKH..................................................AEDAGKILLENLKlqp................gqspLTKQLD.KFSVNFERLAILDKLSIA.........SVLNL.YEAIAGVYDSLSRL-------...HqWELQKIreda..................slagrSDEYLRNIVLCTRSGTPAMN...ARGKVG........................MRIDYWKDKYL..QPPTNPQ..-M--.....----------.....................-ATYV.EKH.....EKIWGILIGCAPI.Nm........dlDV......NVHPVRV......................SSHWISESVERPhi..................................pgDLQTGPVVDWLEPQDTLvpp................................dpekAGDS....lLGPRLP...SVTFSATFDPPMPISLGLWEQLR.SMG-.IGIPPMEE-..................-.RKAFDLLVFP.MAPGGYYdp......................................selREIHCTKY-INY-..........QLPGSPA..WNSRKHANSL.Y.IY...KN.VYG.......................................K..--TLAEASFSHPQQLIAMLPYLRQYAFLSTLLENSFK........................................................................................................................................................................
G1N176_MELGA/53-420                  .........................................................................................................v-SCLETLQKa.lKVSSL....PAMTDRLESIARQNGL..G-S--......................---....HLSANGTECYITS.DM.FYVEVQL.........DPT..G..LL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQHLR.......................-EKNFD.EFSKHLRGLVNLYKLPGDn.......kLKTKM.YLALQSLELDLSKMAGMYWQA...-.TN----...........................---------------ANPLDk.iLHGSVGyltpr..............sggllMNLKYYVSPYD..LFEDGT-..----.....--GAPVILHE.....................SNVPR.SLG.....MNVSVTVEGTMAMyKl........piAPl...imGSHPVDS......................------------......................................----------KGTPSFS.......................................SITS.....ANSVDL...PACFFLKFPRPIPVSRAFIQKLQ.SCTG.IPLFDTAP-..................T.FVPLYELITQ.-------...........................................---------FEL-..........--SKEAD..PIPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLISKIAFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
G3R077_GORGO/59-193                  .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMA------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------imyhl...................................................................................................................................................................
T1HHG1_RHOPR/52-405                  ..........................................................................................................QKCLDTLQQn.iKVTTH....QAMIERLESVSRQLGL..KFV--......................---....-TGPSGLDLFISS.DM.FYLEVVL.........ESN..G..GV.....K......DVKIHHEGR......G......EQ.....QS..CEE..................................................-------LVACLT.......................-RRDFA.DFTAQLEGLASIYQLNAEk.......kVKCKA.FTALTSLETDLSTLASLQTYM...K.------...........................----------------DPLTv.vHNSPIGllekr..............rgghaMKLTYFVSPYD..LLDPSTR..-TSK.....------TLT-.....................-MEGV.TVG.....HSVSVCMESSTAH.K...........LQ......TAPLITI......................SRGSDGN-----......................................------------SWPVY......................................gNVTA.....TNSITV...AGTFVLNLNKPMPVCMSLINSIQ.AVTQ.AQCTDVTR-..................-.SHPLLSLITQ.-------...........................................-------HASGGLa........dSANSKGL..FVNVGDQHHC.Y.LM...SE.SRN.......................................L.eGVLVNSVPFTHPAHVPQIVTFLRQQALFNAIIASCVR........................................................................................................................................................................
A0A066WW31_COLSU/121-547             ........................................................................................................dg--VIEILGK...A-KGR....-VSEAGLERLTIRTGL..TSMWD......................EHR...sPDGRKTRMLVIAG.QA.LTIDIEL.........-NN..N..IV.....E......SVSLGFPES......-......GA.....IV..TRH..................................................KDRAGNILLKDLQlrp................dqspLTKTLE.KFSANLERLANLDKLSVI.........PGLDC.QEAIAGIFESLERL-------...HkWELSKLredp..................amsgkPDRFLETTVMCTRSGRPMMH...TRDMVG........................LSIEYWTERRH..VIPRTP-..ETA-.....----------.....................--RYC.EKM.....EKIWSILIGCKAI.D...........GD......MFPPVRV......................TENWISQKVEKAepgp..............................edilVAASGPALDWLEPEPTTlpqtddn........................kepgidvvQPDG.....TTHKYP...NVKFVATLIPSVIVPQSVWNTLH.TLTG.AQTQPMPL-..................P.TYTFDSISFP.IPEGSNHda......................................selRVISCTRRVQVP-..........--GDGDT..VLSRKHKNTL.L.IY...KP.VYG.......................................Q..--TVTDLSFSHPRQLVAMLPILRQYAFISTLLERSF-g.......................................................................................................................................................................
A6RBM2_AJECN/72-484                  ..........................................................................................................EEVIRLLRT...RVSGR....GICREGVERLGKFEGF..ECMWQ......................ENI....--------LSIAG.NL.VDLEIQF.........EDG.sE..NV.....K......DVSLKYTTP......-......SA.....VE..GER..................................................RVEASAVLKRDLMqtvg..............kneeiPWKSLD.AFHSNLHRLAKLDWLS--.........QEINC.FEAVEGLYKSLKRL-------...-.WEGELSr........................ypGRGHCEHVCT-SQVGHPGIH...QDGRIG........................LSLQYWVEQRQ..TLDSNRN.gRPNA.....MNIDQPTPDD.....................RKPAP.AKT.....HKTWRAAIECEE-.-...........--......GYPLLRV......................SKEWIAAELFTTmnngds..........................sltadgNDSEILLVNWIEPPATLvsnp..............................ndvplDSTA.....LGTTTP...NRRFVARLEPPIDMPIIAAAEVY.RLLG.MNMPVEPK-..................-.TVTYDGLVVP.LPNLTSTgdgqde...............................nslaapNGRIHEKVVYSF-..........--DDDCQ..PRKHRHIYTF.H.PF...EH.IVG.......................................R..--TIRDLPFSHPRQLADVLPV----------------e.......................................................................................................................................................................
A0A0R4IIM4_DANRE/243-412             ...................................................................alvtagstdsshrlqmeslissppqvdscgfpvfqplte---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------------.........-----.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....ACSLLL...PATFLLKLQPPLPVLTSFIEKMG.KITD.GVIAEKPL-..................Q.VEPLHKLLLK.-------...........................................-------TSRKY-..........-----NP..NTSCTDGLQF.L.VP...--.LPGsechsyvf......................pgaqwscenW.nGALMDAVPFSHPGHVPALLEILRHQSAISVLLESCF-s.......................................................................................................................................................................
H2RD94_PANTR/59-426                  .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAIMYWKA...-.TN----...........................--AGPLDKILHGSVGYLTPR...SGGHL-........................MNLKYYVSPSD..LLDDKT-..--AS....pIILHENNVS-.....................----R.SLG.....MNASVTIEGTSAVyKl........piAPl...imGSHPV--......................DNKWT-------......................................-------------PSFS.......................................SITS.....ANSVDL...PACFFLKFPQPIPVSRAFVQKLQ.NCTG.IPLFETQP-..................T.YAPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PIPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
E7QLV7_YEASZ/12-300                  ..........................................................................................................DSMIELFKD...YKPGS....-ITLENITRLCQTLGL..ESFTE......................ELS....---NELSRLSTAS.KI.IVIDVDY........nKKQ..D..RI.....Q......DVKLVLASN......FdnfdyfNQ.....RD..GEH..................................................--EKSNILLNSLT.......................KYPDLK.AFHNNLKFLYLLDAYSHI.........-----.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------esdstshnngssdksldssnasfnnqgkldlfkyftelshyirqcfqdnccdfkvrtnlndkfgiyiltqgingkevplakiyleenksdsqyrfyeyiysqetkswinesaenfsngislvmeivanakesnytdliwfpedfispeliidkvtcssnssssppii.
M3ZL94_XIPMA/59-429                  .........................................................................................................l-NCLETLQRa.lKVSSL....PSMTDRLESIARQNML..G-S--......................---....HLSPTKTECYITS.DM.FYVEVQL.........DTG..G..QL.....V......DVKVAHQGE......-......NP.....TS..CSE..................................................-------LIQHLS.......................-EKNFE.AFSKHLKGLVDLYRLPGDn.......kLKTKM.YIALQSLELDLTKMMTMFRLA...-.TN----...........................--ANTVETILHGSVGWLTPR...SGGNL-........................VSLQCYVSPYD..IFEV---..----.....ETGSQLSLTD.....................NNVPC.SLG.....VSVSVTIEGTSTVyKl........piAPl...itGSHPVDNkgtps............fstvsN-----------......................................-----------------.......................................----.....SNSVDL...PACFFLKMNRPMPFSLSFIQKLG.NATS.IPVFETPP-..................P.LSLLYQLIVQ.-------...........................................-------SQLQLL..........--EEGSA..IPATLNNMHF.Y.SI...--.LPDqhhcyflng....................dapvqdghslQ..GAMVSKIPFRHPAQVPLLLDIIRHQAAYNTLIGSCVK........................................................................................................................................................................
W3X4Q4_9PEZI/116-533                 .......................................................................................................nti---VAMVKA...VGTGR....-VSNEGLERLARSIGL..ECLWE......................DNI....AGGPKSKTLFIAG.TG.LTLEIVI.........-TN..H..IV.....E......NVHLTFPEC......-......AP.....GV..QEH..................................................VGRAADVLLRDLKlqp................gewaLTKTLE.KFSPNLERIAAPDRLSVL.........PTLNC.YDAIDGIYQSLLKI-------...FnWDVAKLkedp..................klqgrSDDYIKVAALCSRHGCPQMH...VRDRIG........................LSLDYWKEWRR..FPTTTI-..ETTE.....----------.....................-----.KEG.....PKTWSIMIECAPK.N...........NL......AFMPIRV......................SHQWISDSIEKData...............................edmvLSNGGPILDWQEPENILlpa................................gageKPEGs..igPEPRLP...DVIFMAVFDPPLIVSSGVAAQIY.NIAG.LQQPGVS--..................-.SSTFDALVFP.IPQGVAYd........................................ptESRIITHTQPIML.........sGTSKSGH..KI-RLHRNTL.N.TD...RA.VYG.......................................E..--LLTRVPFQHPRQLLEMLPLLRQYAFLSSLLNNSFK........................................................................................................................................................................
U7PJY3_SPOS1/132-585                 ..........................................................................................................QTVLQLLQA...S-KGH....-VSEAGLERLAKSMGL..ECLWE......................EAMggggGGGNDARTLVVAG.SA.LALEIAV.........-AN..N..IV.....E......SVSVTFPES......-......RS.....IV..LRH..................................................VERADKILLHNLQlqp................gespLTKTLD.RFAANLETLAVLDKLSVE.........PGLNL.YEAVAGIYETLDRLFQ-----...-.WDLQQLrndptls............thtqstarDEDALVTTVQCARHGRPTMH...EGGHLG........................LGVDYWKQMRH..VRPVRAA..AAAA.....-AADNVGVV-.....................AGTGA.GPD.....DTTWRILIGCAPT.S..........sAL......MYPPVRV......................SDKWLSDAIEKSdnml..............................lggnSNPAQPDLDWLEPENTIlpsrqqpdg.....................asktegdeeAPTT....lAGAKLP...DVRFHAVFHPPVVLPLALWHQIN.ELVG.LVPETDAQ-..................P.PATFDALLFP.VPPGTQHdp......................................sepRTIRRDKAVASR-..........-SDAGGT..IATTKHHHAL.F.IY...KP.VYG.......................................R..--LLSELPFSHPSQVVRMLPTLRQYAFLATVLQNAF-g.......................................................................................................................................................................
Q2GYD1_CHAGB/109-532                 .........................................................................................................d-SVIAVLGR...S-KGL....-VSEAGLERLAKKLEL..EFIWE......................NSM....-DSDDSKTLIVAG.SA.LELLIGF.........-RS..D..IV.....Q......SVNLAFPDS......-......AE.....IV..NKH..................................................AEAAGKILFKDLQlle................gqspLTKSLE.NFAANFERLAILDKLSIS.........PGLNM.YEAVAGIYESLCRL-------...HtWELQQVrgdp..................aaaakGEDHLESLVLCTRSGNPTMN...TRGRVG........................MALDYWKDRRL..QPPPTEP..E---.....----------.....................MIEWV.EEN.....EQVWSILIDCAPL.R...........EI......GVNPVRI......................SDKWIGPDVEKVpl.................................pdeLHTGGPIIDWLEPESTFvptpdq...........................tkadpmQPDAs...iLGPRLP...DAVFHATFDPPVHIPTTLWGQIQ.QLGC.MMDETPLK-..................Q.LATFDSLVLP.YPPGKEPeaa.....................................agsRTVTCNRQTAYA-..........-APGEEK..LTLKSHANTL.Y.VS...KP.IPS.......................................R..--TLTTMTFSHPQQLITILPYLRQYAFLATLLERS--lt......................................................................................................................................................................
B4IYT4_DROGR/80-458                  .........................................................................................................q-SALDKLQHy.iKVSSR....HGLVERLESLSRQLGL..KFM--......................---....---EDQQLLFIST.DM.FYVEILL.........DAS..G..NL.....N......DVKVHHECK......I......EQ.....QS..NSS..................................................--ASSRELLNCLK.......................-AGDFA.DFTVQLEGLSSIYQLNAEp.......kVKKKA.FVALQAMETDISNLYQQQLQK...Q.QQ----...........................---------LRGNSDSYYIM...NNSSLGlvmer..............rgghpMKLTYFCPPLQ..LIEKKVK..-AEK.....LATATASGTAsrd...............fsiEQVMK.SPN....gLSATLNLEGSSAN.K...........LQ......ILPIVSF......................TSESGLP-----......................................----------LEQPSYA.......................................PLTQ.....NNSMLM...PATYVLRLNKPMPVCIESLRALA.L-PG.LGSLGVSG-..................E.GTTVMNLIVQ.-------...........................................---TASRQLIKS-..........--TQKGL..YVNLPKETHC.Y.FF...TD.NRR.......................................L.qGTLISTLPFTEPAQVPRIIAFLKKQALFCTLLSSCVR........................................................................................................................................................................
A0A0B4H5J3_9HYPO/120-550             .........................................................................................................d-TILRLLSA...K-KGL....-VSEASLERLAQRIGL..ELLSE......................EQR...tPDGRKTRTLAIAG.SA.IALDIVL.........-DN..N..VV.....Q......SVSLAYHGS......-......AS.....SV..SKH..................................................MDAAGRILLKDLKllp................gqspLTKTLE.NFASNFERLASLDKLSIV.........PGLDC.HEALAGIYVSLERLYQWDLSNl.rEeQDMKAK...........................SDKHLSNMVMCSRHGRPVMH...DRDTVG........................LAIQYWRELRF..MPPVADG..----.....---TY-T---.....................---YN.YES.....GKVWSLLLGCAPL.D...........GM......GVPPVRV......................SENWISKEITKQd...................................amIDPTKTILDWQEPDNISlpqsedn........................kdagmdllQADL.....STTRVP...RVMFTVTFDPPVVLPQNDWARLY.MYAN.VNPPNIVNEpsqr..........ghppA.PPTFDSLLFP.FPYGMKVdp......................................sesRAITRQRLVRVL-..........--LSNRI..ESVVNHNNTL.Y.IY...KP.IYS.......................................Q..--TVSEMPFSHPRQLLDMLPLLRQYAFVSTLLENSF-g.......................................................................................................................................................................
M3WTC4_FELCA/59-426                  .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAVMYWKA...-.TN----...........................--AGPLDKILHGSVGYLTPR...SGGHL-........................MNLKYYASPSD..LLDDKTT..--SP.....IILHEN--NV.....................PRS--.-LG.....MNASVTIEGTSAMyKl........piAPl...imGSHPV--......................DNKWTPS-----......................................---------------FS.......................................LITS.....ANSVDL...PACFFLKFPQPIPVSRAFVQKLQ.NCTG.IPLFETQP-..................T.YVPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PIPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
W5LIK0_ASTMX/43-402                  .........................................................................................................m-RCQQKLNEa.lNVASV....NAMMTRLEMIAKQKGL..G-S--......................---....HRSPTETACYLTA.DL.FYLEVLL.........LPG..G..GV.....Q......DVKVAQHGE......-......AP.....ES..NSA..................................................-------LCQLLR.......................-MKKFK.EFSVKLDDLASLYNIPGDs.......dTKIKV.YASLQHLQKDLLKISNLPRRL...-.IE----...........................-SDV-----------HVDMV...LNGRIGnfvpc..............regnpMSIQYYIRPSD..VLMEMFC.pGEGS.....----------.....................-----.--R.....GQVAMVVVGASS-.-...........--......TTHMLQM......................ESHILTP-----......................................-----PQFDSLGFPVFR.......................................PMSE.....VKTESL...PAFFLLKLQPPVPTLNSFIQQMN.QITD.VTPEADLQ-..................-.VEPLFQLIKQ.-------...........................................-------LSLTE-..........---KTCE..SMCDEEDSHF.H.VT...--.LPDaelhsyvf......................ggaewkcdlW.kGALIHAVPFTHPAHVPALLELLRHQSVINALLASCI-t.......................................................................................................................................................................
A0A0N0RS68_9BASI/395-532             ...........................................................................laspaetswiptskielpmyarqplsafgqr---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------------.........-----.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....-NGLTR...PLAYVAEVEPPIMVPHRIARDVY.CACG.LAQHHLPLS.................sK.---------P.-------...........................................-----SPSTSGY-..........----LTH..ILGSSSHYCA.S.IQ...-D.EEA.......................................R..--IISSLPFQSLVQLYHALNILREQVVWNDLLRRA--ak......................................................................................................................................................................
A0A0D2XMT2_FUSO4/2-395               ...................................................................................................tafrrii---------...-----....----------------..----Q......................HPD....--GRKQRTLVIAG.SA.IQLEITL.........-HN..N..IV.....E......NISLAFPES......-......AR.....SV..TDH..................................................VTGASEILLRDLQllp................nqspLTKTLD.KFAVNLERLAVLDKLSII.........PGLDC.HEALAGIYVSLERL-------...HkWDVARLrdep..................gmggkPDSELSTMAMCTRHGYPVMH...SKDRVG........................LALQYWKALRL..VQPTNTK..-MAS.....----------.....................---FT.SSH.....EPVWSLLIGCAST.G...........GM......GHMPVRV......................SEDWISKDVVKAe...................................psMDPKRPNLDWQEPDNVVlphseen........................kdasmemlQPDL.....STARVP...QVMFVATFDPPVILPQNDWLRLH.SYAN.VNANPLFG-..................Y.SPTFDSLFFP.IPPGSAQdp......................................selRAISRSRDVRIY-..........--DKDQK..AIIKPHQNTL.Y.IY...KQ.IYS.......................................Q..--VVTEIPFSHPQQLIEMLPLLRQYAFVATLLENSF-g.......................................................................................................................................................................
B4KV49_DROMO/81-456                  .........................................................................................................q-SALDKLQHy.iKVTSR....HGLVERLESLSRQLGL..KFM--......................---....---EDQQTLFIST.DM.FYVEILL.........DAS..G..NL.....S......DVKVHHECK......I......EQ.....QS..SSS..................................................--ASSTELLNCLR.......................-AGDFA.DFTVQLEGLSSIYQLNAEp.......kVKKKA.FVALQAMETDIFSLYQHQLQL...Q.------...........................-------QQLSSSTDSYHIM...NNSSVGlvlqr..............rgghpVKLTYFCPPLH..LIEKKVK.gEKVAt...sSGTASRD--Ls...................iEQVIK.SPN....gLSVTLNLEASSAN.K...........LQ......ILPIVSI......................TNEAGLP-----......................................----------LEQPVYA.......................................PLTQ.....NNSMLM...PATYVLRLSKPMPVCIESLRALG.-LPG.LTSNANEE-..................-.TPTVMNLIVQ.-------...........................................---TASRQLIRN-..........--TQKGL..YVNLPKETHC.Y.FF...TD.NHR.......................................L.kGTMISSLPFTEPAQVPKIIAFLKKQALFYTLLSSCIR........................................................................................................................................................................
B3RQG3_TRIAD/121-480                 .........................................................................................niieslgvhssasdtdy---------...-----....---IPYLEIIARSANL..KFV--......................---....H---HGDNCFISS.DM.FYVEITL.........KNH..K..EV.....T......EVKVVHGED......-......-P.....KV..TP-..................................................------VMTDLLR.......................-KRQFQ.EFKKHLLGLSSLYQLFGTs.......tEKSLA.FMALQAVETDLSTLAAYQNLS..gQ.------...........................---------------NNPMEi.iNKGYVGhvter..............egglpMKLTFYISPKD..MFDNNT-..--SE.....----KINLE-.....................-DAII.KGRa..igFSASVLIEQGKK-.-...........-C......LLPKLPVv...................vlPTQV--------......................................----------TDVPSYK.......................................KLCN.....ENSAEL...PASFVLVFDDFIPVDASIMAKIY.KIVK.GQDKVYINS..................S.SATIEDLLAS.NFREEKA...........................................KNGFHRNRNSSF-..........---VVKL..PDQKQKYVFC.K.SL...DS.VPL.......................................G..TLNVKRIPFLNPQQVPRIITLLRQQIVFNELISSCV-c.......................................................................................................................................................................
W7LM77_GIBM7/118-539                 .........................................................................................................e-TIIATLDQ...K-KGL....-VSEAGLERLAQRIGL..DCLSE......................DHT...aPDGRKQRTLVIAG.SA.IQLEITL.........-HN..N..IV.....E......NISLAFPES......-......AR.....SV..TDH..................................................VTRASEILLRDLQllp................nqspLTKTLD.KFAANLERLAVLDKLSII.........PGLDC.HEALAGIYVSLERL-------...HrWDVARLrdep..................gmggkPDSELSTMAMCTRHGYPVMH...SKDRVG........................LALQYWKALRL..VQPTNTK..-LA-.....----------.....................--SFA.SSH.....EPVWSLLIGCAST.G...........GM......GHMPVRV......................SEDWISKDVVKAe...................................psMDPKRPNLDWQEPDNVVlphseen........................kdasmemlQPDL.....STARVP...QVMFVATFDPPVILPQNDWLRLH.SYAN.VNANPLFG-..................Y.SPTFDSLFFP.IPPGSAQdp......................................selRAISRSRDVRIY-..........--NKDQK..ATIKPHQNTL.Y.IY...KQ.IYS.......................................Q..--VVTEIPFSHPQQLIEMLPLLRQYAFVATLLENSF-g.......................................................................................................................................................................
D3ZRN2_RAT/44-411                    .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAIMYWKA...-.TN----...........................--ATPLDKILHGSVGYLTPR...SGGHL-........................MNMKYYASPSD..LLHDTT-..--AS....pITLHE--KNV.....................PRS--.-LG.....MNASVTIEGTSAMyKl........piAPl...imGSHPA--......................DNKWT-------......................................-------------PSFS.......................................AVTS.....ANSVDL...PACFFLKFPQPIPVSKAFVQKLQ.NCTG.IPLFETPP-..................T.YLPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PLPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgqslQ..GTLVSKITFQHPGRVPLILNMIRHQVAYNTLIGSCVK........................................................................................................................................................................
B6K2C3_SCHJY/313-369                 ..........................................................................................sscapldgnvdvtleg---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------------.........-----.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...HD.IPA.......................................R..--QVYRVPIAHPRQILPVLHILRQYLVLQLLLTNC--ag......................................................................................................................................................................
Q5B5M0_EMENI/134-555                 .........................................................................................................i-EVVQKLRE...RVAGR....GVSRKGIERLSHLERF..ESIWQ......................DDN....--------LNIAG.NF.VDLEIDF........yRGQ..N..VV.....R......DVSLKYATP......-......DT.....AD..GER..................................................REEATAILKRDLVqtpe..............dgargDWKSLD.NFHKNLQWLARHDKLS--.........EEVNC.FEAIEGLYESLKRL-------...-.WNEESSq........................rkFGGDYEHICS-GGIGRPSLH...RGSRVG........................LWLDYWVPRAR..VMDAKQR..KSAD....aMDIDQSENS-.....................ANGEL.SGG.....NGEWRIAVECEE-.-...........--......GYPSLRV......................SKDWLGSEVFTTahddae..........................asasdsATLEVRVINWAEPPPALngnqs.............................ssgnmDLDSn...mLGSSSP...NRRFVARLEPALDIPFLVATEVY.RHLG.IQMPQDFR-..................-.LSTYDGLLAP.GWSLGSEds.......................................hiDRKRSKISVQSF-..........--DEEGK..PCIKRHSYSF.Q.TF...EP.TSG.......................................K..--TLRNLPFSHPRQLADVLPTLRQYALLANMIQGTF-p.......................................................................................................................................................................
E3RJC8_PYRTT/88-537                  ........................................................................................................re--IIDLVGK...K-PGR....-VSEEGLLALCKRLGI..P--YE......................KHM....-DEAGTWSLLIG-.DE.ALCDITF.........-KN..D..EI.....A......SVNLQTGLD......D......SR.....PD..LNF..................................................GASGSEILVRSLKplp................gqskLNITLD.RFSESLEKLLTLDKLGSPq.......nGGVSC.YNAIAGVYTSLRKLFEHEKSV...ElAN---Rapd.....................erfRTYKAEREVLCKKSGRPRLN...GGSCLG........................LSLEYWMDRRK..VISKSTP..EPSD.....-KGKEKMGADskv..............stsyPEDVI.RSD.....NHLYSLTIECESS.P...........ST......LYTPIRI......................SNDWISDQVEKMtdhnda..........................nttldnMILNTSSINWLDPKPTYleape............................qsddamNLDS.....AAGRLP...NVRFVAKFNPPLVVPLAIYMQLH.QLVG.IEPRTDEF-..................R.PTTFVGLALR.PGTV--Dpgm....................................ssttGESTHVITSSQLV.........gTVDQAGK..YVEKWHKTSL.Y.VP...KL.EYS.......................................R..--TLESLPFSHPKQLVEILPILRQYAHATTLLRDSF-y.......................................................................................................................................................................
W5N216_LEPOC/57-411                  .........................................................................................................l-DCLERLHKa.lNATSF....TDMVTRLEIIAKHKGL..G-S--......................---....HLSPSEDVCYITS.DI.FYLEVLF.........QPA..G..EV.....A......DVKVAHHGE......-......AP.....VS..SEM..................................................-------LCNLLR.......................-LKNFE.EFGKELEGLSSLFNTSGDs.......eTNMKM.FSALQFVEKDLLKMFQIPRPV...-.------...........................------------SSGDPWLDn.vLHGRIGnvtpr..............nngypMSIEYYISPYD..LLEEKMK.pESRS.....----------.....................-----.--C....gNKVFVTAEVTNTI.Q...........RL......PSASVIA......................DSPQMTN-----......................................-----------EGFPVH......................................aTLDD.....LVSMEL...SACLFLKFPRPVPILSCFIEEFH.RLTG.ISVSEDLK-..................-.QVPFYELLMK.-------...........................................----TKMNVTTW-..........-------..---GSDSCCF.L.VT...--.LPGhhrqgyvi.......................sqqwwlkpW.eGALVHKIPFTHPGHVPSLLSLLRHQTAFSTLIASCV-t.......................................................................................................................................................................
MED1_AEDAE/118-471                   ..........................................................................................................QKTLDSMQYc.iKVTSR....QGLVERLDCLTRQLGL..KLS--......................---....---EDTSGLFISS.DM.FYLEIIL.........DPN..G..TV.....Q......DVKVHHECK......M......KQ.....QS..CSE..................................................-------LVSCLQ.......................-RGDFV.DFTTQLEGLASIYQLNAEk.......kIKVNA.FVALQALETDLYNLYTLSTQH...Y.-N----...........................---DIHSLLLKSPLGVVQKR...RG---Gh......................aMKLTYYIAPYD..LLDLEAR..KMKP.....LNTELISA--.....................-----.EKI....gYSVAVNLEASTAN.K...........-L......QIQPLLVq...................qgNSPVYSP-----......................................-----------------.......................................-IEK.....HNSTSL...PATFVLRLNKPMALNVAMLKQIK.HITG.DSSAVTIDPa................tS.NTCLMSLIVQ.-------...........................................-------HASNGT.........vNNIAKGL..FVTLPDQYHC.Y.YM...TE.NKN.......................................L.qGTIISSIPFTEPQHVSKILVFLRQQALFNQLLTSCIR........................................................................................................................................................................
M2RYT8_COCSN/92-540                  .........................................................................................................r-EIIDIVGK...K-PGR....-VSEEGLLALCDRIGI..S--YE......................KHM....-DDAGTWSLLIGD.E-.ALCDVTF.........-KN..D..EI.....V......SVNLQTGLD......D......SR.....PD..LNF..................................................GAAGSEILVRSLKplp................gqskFNVTLE.RFSENLEKLLALDKLGSSq.......nGGISC.YNAIAGIYTSLRKLFDHEKKL...E.--LAKRapd.....................eryRIYKAEREVLCKKSGRPRFN...GGSCLG........................LSLEYWMDSRW..VIPKSAP..EVQEk..gkEKMDANS--Qds................plyPEDDY.WSN.....NKMYSLTIECEAS.P...........SA......LYTPIRI......................SNEWISDQVEKSmdnnd...........................ashlenMLMNTSSIDWLEPKPTYlease............................qtddamNLDS.....AAGRLP...NVRFVAKFNPPLVVPYAVHMQLY.QTVG.IEPRNDDL-..................R.PTTFVGLALR.PGEI--Dpgmsg................................vtgestHEIRSSHLALSK-..........--DINGN..YEQHRHNMSL.Y.VP...KL.EYS.......................................R..--TLESLPFSHPKQLVEILPVLRQYAHVTTLLRKSF-y.......................................................................................................................................................................
G0RLU4_HYPJQ/124-558                 ..........................................................................................................DNILKLLNQ...K-KGF....-VSEAGLERLAQRLGL..ELLSE......................EHT...aADGRKKKTLAIAG.SA.IAVDIVL.........-DN..N..IV.....Q......NVSLTYHGS......-......AT.....SV..AAH..................................................MESASQILLADLKlgp................nqspLTKTLD.KFASNFGYIANLDKLSVI.........PGLDC.YEALAGIFTSLERL-------...HqWDLASLrkep..................elagkSDQYLFLTALCTRHGYPVMH...ARNKVG........................LALQYWKELRF..VPPSDDR.lA---.....----------.....................--SFS.EKE.....EKVWSLLIGCAPI.E...........SL......GMSPVRV......................SEDWISKEVVKQdlhq.............................qdqalNPTNIPILDWQEPENISlpssde..........................nknngmeVL-Q....lHLSTLP...QVAFTVTFDPPVILPQNDCMRLY.SYVN.STPPNPNPSndfs..........qrplP.PPTFDDLFFP.VAAGNRQdp......................................sepRTVTRLRDVLVF-..........--DQQGQ..SFTRSHHNTL.F.VY...KP.IYS.......................................Q..--EVTEMSFSHPRQLIDMLPLLRQYAFLSTLLNNSF-g.......................................................................................................................................................................
A0A0A8L2W1_9SACH/10-190              .........................................................................................................n-EMIQKLLN...YKPGS....-RTLSNVIKLCQTLGL..ESFVD......................QID....---STKSRLSIAS.NI.VVIDIDY.........ENE.mE..TI.....L......DVKLVLASN......-......FD.....KF..NYF..................................................NEKGENILLTSLS.......................DVQDLK.AFHHNLKFLVFLDSFSNIdie...sghTSLDL.FKYYSDLPKMLQEF-------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------lvdqklpfkvrtnenstfgisiydsdgvnrimsvglevt.................................................................................................................................
B0WMI0_CULQU/53-151                  ........................................................................lrskaksshyksfpemsktvrmsllvrsvksfvl---------...-----....----------------..-----......................---....KLSEDTSGLFISS.DM.FYLEIIL.........DQN..G..KV.....Q......DVKVHHECK......M......KQ.....QS..CSE..................................................-------LVSCLQ.......................-RGDFV.DFTTQLE-----------.........-----.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------a.......................................................................................................................................................................
I1GJ15_AMPQE/49-385                  .........................................................................................................r-EVIVRLQEe.iKDPSP....AGIQQRLQYTASKLGL..NYS--......................--N....QRSANGVSCYLNT.ES.FYVEVCV.........SDN..G..TV.....T......SANVVLGQE......-......T-.....Q-..-KN..................................................----TDILVKLLQ.......................-DCKYI.EFEKHIKSLVDMFSQATGq.......dTAVLL.LKAVFAIESILSSI---ENPN...Y.------...........................-SNPIDSILL-NHLGI-VTP...RKAGLP........................MKLTFFITPSE..GISAGLN.qESSS.....-SI-------.....................IEGEL.DVG.....ISAKVQVERSST-.-...........--......QFYRLPI......................DPNIFNS-----......................................-----------SQGAFA.......................................QLTE.....QNSVSV...PLTLILSLNEDIPICTGIAEKLQ.QTVY.LTTQT-LPS.................lI.APHVDQLIIS.EASKKVKl........................................lrQ-QLVYNTLLVSCl.......trKRRGTVP..ATKSLDDYSF.H.VS...TQ.PP-.......................................-..-------------------------------------eaiimat.................................................................................................................................................................
S8A0C2_DACHA/101-487                 ..........................................................................................................KKVLKVLKS...R-PGK....-ISEDGIKRVARRAGV..QYHTD......................SSG....-VVKGVHTLIISG.II.VVVDIDF.........-KD..G..AV.....S......RVALSFAET......-......SG.....PT..AEF..................................................SDRAAKILEKTLTpa..................gfsITSSLA.QFADNLERFARSDRLSHL.........PSLNC.FSAVTGLYVSMMKI-------...-.WE--KE...........................VASMGEVEAMCKGMGRPGMH...LRGKVG........................FCIDYWKERRL..ISSSEGK.gKGK-.....----------.....................---GD.DES.....GRYWRVVVDVDEL.P..........nES......YITPVRN......................SEDWVSDNVLKGad..................................glFGADTHEIDWIEPPLNNye...................................paT--Kp...eVLARLN...NTRFIAKLDPPVVISIQDEVEVL.NAAG.ASMMSHAL-..................-.PGPLETVLCP.KWKSTKE...........................................ALK-NERTVCTA-..........-----SK..DEKSDHTYNL.N.TL...RP.AYG.......................................R..--VLEEIPFSHPRHLAIIFQVLRKYACFTTVFHSAF-p.......................................................................................................................................................................
B8JM88_DANRE/4-235                   .................................................................................................tnantveti---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------------.........-----.---------------------...-.------...........................--------------------...LHGSVGlltsr..............sgghlVSLQCYVSPND..IFEEEKA..--AH.....LNTDVN---I.....................PH---.--Tl...gVSVSVTVEGTTSVyKl........piAPl...itGSHPVDNkgtps............fssitNSNCVDL-----......................................-----------------.......................................----.....------...PACFFLKMNCLMPFSLSYIKKMG.STTG.IPVFETAP-..................T.LSPLYDLIIK.-------...........................................-------SQLRE-..........---EGGA..SPPSAQSMRF.Y.AS...--.LPGqqhcyflng....................dapvqdgrslQ..GALVSKIPFRHPAQVPALLDIIRHQAAYNTLIGSCVK........................................................................................................................................................................
N1RGD1_FUSC4/118-532                 .........................................................................................................e-TIIATLDQ...K-KGL....-VSEAGLERLAQRIGL..DCLSE......................DHT...aPDGRKQRTLVIAG.SA.IQLEITL.........-HN..N..IV.....E......NISLAFPES......-......AR.....SV..TDH..................................................VTRASEILLRDLQllp................nqspLTKTLD.KFAVNLERLAVLDKLSII.........PGLDC.HEALAGIYVSLERL-------...HkWDVARLrdep..................gmggkPDSELSTMAMCTRHGYPVMH...SKDRVG........................LALQYWKALRL..VQPTNTK..-MAS.....----------.....................---FT.SSH.....EPVWSLLIGCAST.G...........GM......GHMPVRV......................SEDWISKDVVKAe...................................psMDPKRPNLDWQEPDNVVlphseen........................kdasmemlQPDL.....STARVP...QVMFVATFDPPVILPQNDWLRLH.SYAN.VNANPLFG-..................Y.SPTFDSLFFP.IPPGSAQdp......................................selRAISRSRDVRIY-..........--DKDQK..AIIKPHQNTL.Y.IY...KQ.IYS.......................................Q..--VVTEIPFSHPQQLIEMLPLLRQ-------------deladf..................................................................................................................................................................
W9CM24_9HELO/111-530                 ........................................................................................................mg--CVEILKP...N-KGR....-LSEAGLERLARRVGL..ECLWE......................DMM....GSASNGRTLIIAG.NA.LALDIDF.........-AN..N..IV.....Q......KVSLAFPDA......-......PE.....SV..TKH..................................................EKTASDILLKDLQfea................gespLTKMLD.RFAANLESLTMLDKLSII.........PGLNC.HEAIAGIFCSLHKL-------...RnWEVGRLrend...................mlgmEDEDIERAAMCIGSGTPVMH...SRQKLG........................LSLDYWQEKRR..IPTKGK-..----.....----------.....................-----.EHN.....RKTWSLLVGVAPL.P...........SLa...vgVYTPLRV......................SDKWISDDIQRAdlavi...........................dlfqaaQLREGPILDWLEPDNTFlpt................................tsdnKTDGl..dvGTPKFP...EAMFVAKFDPPIIVPYAIAMQIY.QST-.-QAPFDFT-..................E.ITTFDALMFP.LSAEEALrss....................................dtqsRTITTKRNNPVW-..........--DREGR..KTVKEHSNTL.F.IE...RI.DYG.......................................R..--RVEEVSFSHPRQLVEMLPCLRQFAFLSTVLRKTF-g.......................................................................................................................................................................
U3JRL3_FICAL/47-400                  ........................................................................................................ls--CMEKIERt.lNAKSV....FSVMNTLELLSRQKGL..T-V--......................---....HVSPSGTACYITS.MM.FYVEIQL.........EKD..G..DV.....M......DVKLAHFEE......-......AP.....VV..CDD..................................................-------LVQLLR.......................-MKNYD.AFGKILEDLSNMYQIPGNs.......eMKAKG.YLALQALEKDLYSMSLLDRTQ...D.LN----...........................----RVTEVL----------...-NGKIGhlvpr..............tggtpMNIEFYISPYQ..VLEAELN..HGSR.....----------.....................-----.--Vc...gTKTVVTVEGTDTL.H...........KL......PLSPLIV.....................dPQDGESN-----......................................------------SPTFL.......................................QLTD.....ELSMDL...PAFFVLKFHQPVPMSSSSIEEIQ.RLTG.IQISGLK--..................-.QAPLYELIVQ.-------...........................................-------STLKE-..........----KCS..ENLSTNEYCF.F.VS...--.LPDcpkhcyfi.......................nkgsakadL.aGALVSKVPFSHPKCVPGVIEILRHQMAYNTLIGSCV-s.......................................................................................................................................................................
G9MHW6_HYPVG/121-555                 ..........................................................................................................DNILKLLNQ...K-KGF....-VSEAGLERLAQRLGL..ELLSE......................ENT...aADGRKKKTLAIAG.SA.ISVDIVL.........-DN..N..IV.....Q......NVSLAYHGS......-......AT.....SV..SSQ..................................................MEAASQILLADLKlgp................nqspLTKTLD.KFAYNFSHIANLDKLSVI.........PGLDC.YEALAGIFTSLERL-------...HhWDISNLrkep..................emaskSDQYLTLAALCTRHGYPVMH...ARNKVG........................LALQYWKELRF..VPPSDNK.iSASS.....----------.....................-----.ESE.....EKVWSLLLDCAPI.E...........TL......GLSPVRV......................SEDWISKDVVKQdqeq.............................qnqalENINLPILDWQEPENISlpssde..........................nknpgmdELSM.....HLSTLP...QVTFTVTFDPPVILPQNDCIRLY.SYVN.ATPPNPSPSgdfg..........qrplP.PPTFDDLFFP.VLAGSKQdp......................................sesRTITRLRDVRVF-..........--DQQGK..SFIRSHHNTL.F.IY...KP.IYS.......................................Q..--EVTEMAFSHPRQLIEMLPLLRQFAFLSILLNNSF-g.......................................................................................................................................................................
M9PII7_DROME/74-431                  .........................................................................................................q-SALDKLQHy.iKVTSR....HGLVERLESLSRQLGL..KFM--......................---....---EDQQLLFIST.DM.FYVEILL.........DAA..G..SL.....S......DVKVHHECK......I......E-.....QQ..SSE..................................................-------LVACLK.......................-SGDFA.DFTVQLEGLSSIYQLNAEp.......kVKKKA.FVALQAMETDIQSLYQLHLQG...HsGD----...........................---------------SYSLM...TSSSVGlvlpr..............rgghpMRLTYFCPPLH..LPEGDPK.lASGD.....FTIDQVMRS-.....................-----.SYG.....LSATINLEGSSAN.K...........LQ......TLPTVTL......................VRDAQTG-----......................................----------LEVPTYA.......................................QLNQ.....NNSLLM...PATFVLRLNKPMPVCLESLKALG.-LPG.LDSVATPPG..................P.PTTVLNLIVQ.-------...........................................---TASKQAIKN-..........--TQRGL..YVNLPKETHC.Y.FF...TD.NRK.......................................L.qGTLVSSLPFTEPAQVPRIVAFLKKQALFYTLLASCVR........................................................................................................................................................................
A0A0F9ZH58_TRIHA/127-560             ..........................................................................................................DNILKLLNQ...K-KGF....-VSEAGLERLAQRLGL..ELLSE......................EHT...aADGRKTKTLAIAG.SA.IAVDIVL.........-DN..N..IV.....L......NVSLAYHGS......-......AA.....SV..STH..................................................MEAASQILLADLKlgp................nqspLTKTLD.KFAYNFGHIANLDKLSII.........PGLDC.YEALAGIFTSLERL-------...HhWDIANLrket..................emagkSDQYLSLAALCTRHGYPVMH...ARNKVG........................LALQYWKELRF..VPSSEDK..----.....------VL--.....................---AF.SEN.....EKVWSLLLDCAPI.E...........TL......GLSPVRV......................SEDWISKDVVKPeneq.............................qnqalQPHNLPILDWQEPENISlpssde..........................nknsgmdELSM.....HLPTLP...QVTFTVTFDPPVILPQNDCIRLY.SYVN.ATPPNPSPSadfg..........qrplP.PPTFDDLFFP.ISAGNKQdp......................................sesRTITRLRDVRVF-..........--DRQGK..SFTRSHHNTL.F.IY...KP.IYS.......................................Q..--EVTEMSFSHPRQLIDMLPLLRQFAFLSILLNNSF-g.......................................................................................................................................................................
MED1_DICDI/190-624                   .......................................................................................................lqe--MTNELNN...KYSTF....SVLDDLLGLLKSNTEI..DY---......................---....-NSDSYVSCNISS.ST.FLLDIDI.........YHN..G..EI.....K......EVKLVHILT......T......TG.....EV..EPA..................................................EQQFNDELTNSLK.......................--TDMK.EFIKKVQRICDLDLLFRK........yKHFDL.QKAFSILQSDFLNI-SINSNI..kY.ID----...........................-N---KEIEMNKGFGEIKL-...--DCCG........................VLIKYFQSYIE..KISKMN-..EPYS.....IMIEMESSAVtnn...............gslID---.---.....QSEYSRLSLKTLLqK...........QQ.....hTQPSAQTd....................ySEQQQQQSISTQ.....................................lTSIEFNEKDCLDCEPLS.......................................SMLE.....SDSIFS...PVRLVCKLNKPILITNQQLSKIL.NLSK.IHRSSQQPS..................Q.QQPSQQQQQQ.QQQQQQKklnsvdesmnen..................gdsniienineliK------------..........-------..----KYSIQN.L.--...--.LISssssssssndsnisvnvdnsfdcevygmkqryyytgefeL..GIEISRIPIYHPSQVYPTIQLLRQQIVFNILFKSCF-q.......................................................................................................................................................................
A0A0J9UV63_FUSO4/112-511             ........................................................................................................dk---------...-----....------------LKRL..ETIIA......................TLD...hPDGRKQRTLVIAG.SA.IQLEITL.........-HN..N..IV.....E......NISLAFPES......-......AR.....SV..TDH..................................................VTGASEILLRDLQllp................nqspLTKTLD.KFAVNLERLAVLDKLSII.........PGLDC.HEALAGIYVSLERL-------...HkWDVARLrdep..................gmggkPDSELSTMAMCTRHGYPVMH...SKDRVG........................LALQYWKALRL..VQPTNTK..-MAS.....----------.....................---FT.SSH.....EPVWSLLIGCAST.G...........GM......GHMPVRV......................SEDWISKDVVKAe...................................psMDPKRPNLDWQEPDNVVlphseen........................kdasmemlQPDL.....STARVP...QVMFVATFDPPVILPQNDWLRLH.SYAN.VNANPLFG-..................Y.SPTFDSLFFP.IPPGSAQdp......................................selRAISRSRDVRIY-..........--DKDQK..AIIKPHQNTL.Y.IY...KQ.IYS.......................................Q..--VVTEIPFSHPQQLIEMLPLLRQYAFVATLLENSF-g.......................................................................................................................................................................
M7SR78_EUTLA/120-550                 ..........................................................................................................DEVIKILGD...ADSAR....-VSNDSLERLAKQLGL..DNIWE......................DAL....GGDKNSKMLIMAG.SN.MSVEVGI.........-AD..H..IV.....N......HAALAFNES......-......IP.....IV..DKH..................................................VDKAAEILKKDLSlap................nqspLTKYLT.EFKANLKRLATLDKLSIS.........PGLNC.HEAVAGIYESLERL-------...HrWDVDKLredp..................slsakAEEKLKVYALCTRHGYPQMH...TRGQIG........................LSLDYWKESRK..LPSTTVD..----.....----------.....................----T.DDD.....RKTWAIKISCAPI.Nsv.......dyTPvs..nmAYTPVRV......................SERWIGPGIEKVnlt...............................neemISTTGPVLDWLEPDSIIlppsee..........................vkaeealD--Pgn.pmSGPKSP...EVIFLATFDPPIIVTQAVVMDIY.KLCA.TE--PHMS-..................-.SATFDVLLFP.IPEGSAYdp......................................sepRMVGHSRTLATFP.........rVTKGQIK..PDLKTHNNTL.H.IY...KP.VYG.......................................Q..--VLKELPFSHPKELVQMLPALRQYAFLSTLLFNSFK........................................................................................................................................................................
C4JRT0_UNCRE/136-554                 .........................................................................................................d-EAVQLLRT...RVAGR....GVSREGVERLGRLEGL..ECMWQ......................DND....--------LSIAG.NS.VDLEIGF.........EPG.qE..TV.....K......DVTLRYATH......D......A-.....PE..GER..................................................RVDASEVLKRNLQqapd..............eqqpqHWKSMT.GFHENLRRLARLDQLS--.........REINC.FEALEGIYECLQKV-------...-.WEEEKRq........................gmQAGQLDHICK-GWIGKPYMH...RGKHIG........................LELEYWVEQRR..ILEAKRG.pSEDA.....MELDDPAQE-.....................DDKGL.HAA.....GNFWGANIECET-.-...........--......GYPSLRV......................SKDWIESEVFTVisne..............................dgteHDHMIKVINWSEPPATLissln............................nnavalEPTM.....LSSTTP...NIRFVARLDPPVDMPIFAAAEIF.RILG.VNMMQEFK-..................-.SNTYDSLVVS.SQGDLLNyte.....................................pegKQLQHRKEISTF-..........--DADGK..SIKRQHTYTF.N.AF...EQ.VPG.......................................R..--TIRDLPFSHPRQLSEVVPILRQYAFLSSLLRRTF-a.......................................................................................................................................................................
W2RQQ0_9EURO/138-552                 .........................................................................................................q-QAIDSLRS...KVVGR....GITRDGIERVARLHGF..EALWD......................EDN....--------LVIAG.NV.VEIEITFd.......sVLR..D..NV.....K......DLSLKFNYN......E......EQ.....HV..QKE..................................................---GTAILKAQSGvrta...............edigQAKDLS.DFADNIQYLAQLDPID--.........VKPNP.FQLVSNLYQSFQDIWKEEKRR..mH.WR----...........................--SRLQHLRK-GALGISNMD...HAPELG........................LTLGFWHEPGA..ASDAGED..ETSD.....----------.....................SPPSL.GSE.....EGLWKGKISCEA-.-...........--......GLPSLYL......................SKDWIGSKILTEgqag.............................qnvldASDTSYRPDWTEFTNGLaiksgek........................edtdmeteKP-Q....dAMPQSL...NVHFTFNLRPEVLLPLAVMSRLN.SEI-.-SMVDIDPQ..................K.ASTYHRVLQR.ARSR--Klg.......................................rsEEAEVDTRWSRNL.........aCIDSQGQ..LSYQGHSYKL.Y.SA...AP.DSE.......................................L.wCYPISKLRFNHPRQIAEILPLLRQHVVVWSMLEKLV-t.......................................................................................................................................................................
H2UB71_TAKRU/42-397                  ........................................................................................................sa---LERLQEv.lNASST....DLIRHHLQRMARQQGM..DFHIS......................E--....------ATCCLTA.DL.FRLEVAL.........LPC..G..GV.....E......NVKLTPHAG......-......FP.....IH..CES..................................................-------LLQLLSp.....................qRAENFS.EFSAKLTDLLSQYNIPGDk.......eTKLRL.FESLQLLSQDLQCMSSLPRVQ...-.LD----...........................-SEAQIQLINDGLMGCLKAA...NADH-P........................LTIQFYSVPAP..GSNASD-..----.....----LYKFT-.....................-----.-VV.....QGAQVTIGASDA-.-...........--......-MHKLQL......................ASALIEP-----......................................-----AVTEDQRTPVFL.......................................PLSE.....VPHQSL...PGCFLLRLQPPMPLILSFITKIS.SITVgVLPDVDLQ-..................-.GEPLPKVLTS.G-YAKSH...........................................KEDEKKTDVRFCL..........-------..--DAGATQGF.I.LPgaaWD.VPA.......................................Q.rAAVVDHIPFTHPSHVPALLEILRHQSAINALLRSCV-a.......................................................................................................................................................................
MED1_CANGA/11-141                    ........................................................................................................dl---IGLLKD...YKPGT....-ITIENITKLCQSMGL..ESFID......................ELD....---NDISRLSTAS.KI.IVIDIDY........nKTQ..S..TV.....Q......DVKLVLASNfdnfdyS......NE.....QL..EEA..................................................GDKQSNILLNSLT.......................NYDSLK.QFHHNLEFLYLLDTYSS-.........-----.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------vesdnqiss...............................................................................................................................................................
H3AM65_LATCH/4-367                   .........................................................................................................l-SCLERLQKv.lSAASL....PSLFNHLESVAKQKGL..D----......................--T....HLSPTSTACYITS.DL.FYLEIQI.........EPD..G..HV.....I......DVIIAHHGE......-......TP.....ES..CEE..................................................-------LVQLLR.......................-MKNFD.DFAKSLEGLSNLYQVPGDr.......kIKTKV.YQVLKSLEMDLNTMADMYRFR...K.------...........................-----------SNADRVTTI...LQGPVGyfvpr..............nggnpTTLEYFISPYD..QLEKRLE..-PGT....iI-IF------.....................SSTAQ.ISG.....MKVFVTVEGISTScK...........LP......ITPLIQN......................SQQDIDR-----......................................------------GIPTF......................................aPLTE.....EVNNEL...PACFFLKFPEPFPMLIDLIQKIQ.NLTG.LSVMEQSA-..................-.SVSFYELLAK.-SEMKSP...........................................IDPNKILNLFQM-..........----HVI..LYNLHHSYVL.Y.MD...KE.KPL.......................................L..GTLVSKIPFTHPMQVSSILDILRHQAAYNLLVGSCI-s.......................................................................................................................................................................
A0A0L0N6W3_9HYPO/120-547             .........................................................................................................e-TILKLFSE...K-KGL....-VSEAGLDRLAQRLGL..ELLSE......................EQM...tPGGRKTRTLAIAG.SA.IALDIVL.........-DN..N..IV.....Q......STSLTYHGN......-......AE.....SV..SRH..................................................MDAAGRILLQDLQllp................dqspLTKTLD.GFASNFERLASLDKLSIV.........PGLDC.HEALAGIYVSLDRL-------...HqWDLSRLreeq..................gmagkSDTYLSNMAMCTRHGFPVMH...ARGKVG........................LALQYWKELRF..VPPSTDA..----.....----------.....................MAVFS.EKR.....EMVWSLLLGCAPI.D...........GL......GLPPVRV......................SENWISKDIIKEep.................................ssmESSGGVALDWLEPDNVSllqsedn........................kdagmdllHPDL.....STTRVP...RVMFTVAFDPPVVLPQNDWSRLY.MCAN.ANPPNIELSh...............rgS.PPTFDSLLFP.IPPGTKVdp......................................sepRAISRRRDVCVF-..........--DEARK..PAVKQHHSTL.F.IY...KP.IYS.......................................Q..--AVSEMPFSHPRQLIDMLPLLRQYAFLSTLLENSF-g.......................................................................................................................................................................
E3JQ96_PUCGT/215-387                 ................................................................................................iienlpadqr---------...----S....QTSLPLIEALAREIGL..ECFRD......................SDD....-----SNLLTIAG.KL.FVIDIEIdp....nhdQTH..G..QV.....N......RSKFSYTFA......-......-E.....EE..AKR..................................................DLSIDQELTHQLSdihhlfqsqpp.hsfcnlaqlelVQNSLQ.SFAGSLRQLKELDELMVNsn.....qsSSIDY.FMVFRKLISDYHQH-------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------qseqdqlgktde............................................................................................................................................................
Q0U1J3_PHANO/486-928                 ........................................................................................................qn--ILELVGG...K-PGR....-VSEEGLLALCKKLGV..S--AE......................KNP....-DIAHGWMLLIGD.EA.V-CDITF.........-NN..D..EI.....A......TVNLQTNLD......G......EQ.....ED..LQF..................................................GPTGSEILVRSLKplp................gqskINVTLE.RFAGNLEKLLTLDKLSSPq.......nGGVSC.YNAIAGVYTSLKKLFEHEKKMa.lAvMDANTP..........................yRSHKAEREVLCKKSGRPRLN...GGSCLG........................LSLEYWMDRRH..LISPKKK..APQS.....EKGKEKMDIDseh..............ippyPEDNE.PET.....NRMYSLTIECESS.P...........ST......LYNPIRI......................SNAWISDAIEKPtdvsda..........................nvtidnILDNAPSIDWQDPKPTYlept...............................aesmDINS.....TPGRLP...NIRFVARFNPPLVVPLAVHMQLY.QSVG.LSERPEDF-..................R.ATTFVGLALR.PGEI--Dpgmmg.................................aagstHEIRSTRSVLDS-..........------S..GKSRKHAMSL.Y.LP...KI.EYS.......................................R..--TLESLPFAHPKQLVAILPVLRQYAFTTSLLRDAF-a.......................................................................................................................................................................
T1J8I3_STRMM/62-424                  ..........................................................................................................QKCLDTLQKs.iKVTSL....QAMVERLESITRQLRK..RNF-D......................DCSl.kfTAGPNGTDCFISS.DM.FYVEVLL.........EMN..G..SV.....K......DVKIAHHGD......-......-P.....VS..CSE..................................................-------LTQVLR.......................-AGDFT.EFTSHLEGLTSIYQLNADk.......kQKSKA.YLALQALETDLSMLAQLQSSI...N.-E----...........................---------------PSNLV...HKSPVGilqlr..............kgghpMKLTYFISPYD..LLDMETK..SSIP.....LTVDTVV---.....................-----.ERQl...gQYVTVCIESSTSH.Kl.........qTQ......SLMSITR......................TNDGKSL-----......................................-------------PSFA.......................................APSN.....LNSTTL...PANFVLKLASPMPIATALVKKIQ.AVTC.IECADMSS-..................-.SQPLLSLITQ.LASKG-E...........................................MDCNNNKGLF---..........-------..-VVLPDQHHC.Y.FL...NG.AAD.......................................L.qGAMVSSIPFTHPTHVPQILVFLRQQMLFNVLISSCIR........................................................................................................................................................................
A2Q9R5_ASPNC/135-570                 ..........................................................................................................DDVVQLLRA...RVSGR....GVCREGIERLSDLEGF..ESIWQ......................EDS....--------LSIAG.NF.VDLEIDF.........HRG.yN..VV.....K......DVSLKYATP......D......A-.....QD..GEQ..................................................RDEATAVLKRDLIqspe..............egdrgAWESLR.GFHENLQWLAKHDRLS--.........QEVNC.FEAIEGLYESLKRVWEAEWNH...-.----RK...........................FAGVYDHLCS-GWVGQPCMH...KGSRIG........................LSLDYWVQQAR..VLDAKEK.qKTSSd...aMVVDAPNGQP.....................SDDDS.SSL.....EGKWSIVVECEE-.-...........--......GYPSLRV......................SKDWVGSEVLTGvnnndn.........................gpssseaHGSEAAVVNWVDPPATLtnnqg.............................hpdamALDSn...mLGSSAP...NRRFVAKLEPALDLPILAASDIY.RHLG.MQLPQEFK-..................-.MVTYDGLLAP.GWSPLSAagamglg.............................peeasqlERRRRRMSVQSV-..........--DSTGK..PCTKHHSYTF.Q.PF...ES.VAG.......................................R..--TMRDIPFAHPRQLADILPILRQYAFLANLIRSIF-s.......................................................................................................................................................................
A0A0F0I5N1_ASPPA/134-565             .........................................................................................................e-DVVQLLRT...RVAGR....GVCREGIERLGQLEGF..ESIWQ......................EDS....--------LSIAG.NF.VDLEIEF........yRAQ..N..TV.....K......DVSLNIATP......-......EA.....TD..GER..................................................-REATAVLKRDLIespe..............dggrsSWKTLT.KFHENLQWLAKHDRLS--.........QEVNC.FEAIEGLYESLKRI-------...-.WDEEGHh........................rkFSGIYDHLCS-GWVGQPCLH...QGGRIG........................LNLEYWVHQAR..VLDSKKK..KVSPd...dMAIDQPSESS.....................MDGES.GNH.....YGKWNIIIECEE-.-...........--......GYPSLRV......................SKEWVNSEVFTVvnnnan.........................epssnemGGSDVAVVNWADPPATLssqg..............................qqdamALDS....gMLGAAP...NRRFVARMEPPLELPILAASDIY.RHLG.IQMPQEFK-..................-.MVTYDGLLAP.GWSPLSAagamglg.............................peeasqlGRRRRRMAVRSV-..........--DQDGK..PCTKQHSYTF.Q.PF...ES.VAG.......................................R..--TMRDIPFAHPRQLADIIPTLRQYAFLANMIRNIF-s.......................................................................................................................................................................
G2XES2_VERDV/126-550                 ........................................................................................................da--IIDIIGN...A-KGR....-VSEAGLERLSQRTGL..NKIWE......................DHR...tPDGKVKKTLVIAG.HG.LQLDIIL.........-DN..N..IV.....E......GVTLAFPES......E......SP.....IV..AKH..................................................VDRAGQILLRDLQllp................dqspLTKKMD.EFAANLERLATLDKLSIF.........PGLDC.QEAVAGIFESLERL-------...YnWELARVkedp..................amagkPDVLLERTVQCSRSGRPAMH...ARDQVG........................LSLDYWAERRL..VPPKTPA..----.....----------.....................TETYC.ANA.....EQIWSIIVGCRPL.D...........GE......LYPPIRI......................SEDWISQKVEKTdpvp..............................tdllEPSNGPLLDWLEPAPTVlppasdn........................kavavevvQPDG.....TTQRYP...NVKFVATLNPPVIVPQAVCNALY.NLSG.AQPPPMML-..................P.SYTFDGISFP.IVDGQNHda......................................selRTISCERDVFVL-..........-----GA..PQRRRHENTL.F.VY...KP.VYG.......................................Q..--TISELPFSHPRQLVAMLPTLRQYAFISRLLARSF-g.......................................................................................................................................................................
N1PW81_DOTSN/150-572                 ......................................................................................................akmr----KVLKSi.gKSKGR....-ISEEAIARIARRVGL.sDNISDryak.............edaakD--....PQIVGNRDLALAG.QT.SSLDLTL.........-KD..H..VV.....Q......SVEASILGK......D......GQ.....PL..PEI..................................................SQTAGKLFLDDLSasn.................dtlLESNLN.RFAANLDRLARLDKLS--.........TCVSC.FEAINGLYRSLQKLYTLEQEQv.rS.-NQQGEs........................siSEQNAEAEVLRKRSGKPTLH...EHGQFG........................LALEYWSTETA..REEST--..----.....MDVDG-----.....................IDTWT.GPS.....SKIYSLRIEVEGA.S...........AA......MYTPLRC......................SNDWLPNDLTLP......................................EPESGNSIPWLDPPATLiqdst.............................gigdaM--Ai...dGGQRLP...DMRFVAKLDPPLVVPYQTATNIL.SHVG.MPPPQVDL-..................-.MLHYYALLLD.ILAHTMYtg.......................................tlADIEAEQTVLST-..........---KSGE..DVDVKHRYSL.D.IP...KP.DWG.......................................Y..--KLEKLPFTHPRQLVELLPHLRQWAHIGELLRSAF-g.......................................................................................................................................................................
A0A0A2VX31_BEABA/127-551             .........................................................................................................e-NIIKMLNQ...K-KGM....-VSEAGLERLAQRLGM..ELLSE......................EHS...tPGGHKTKTLAIAG.SA.VALDIVL.........-DN..N..IV.....Q......NATLSYHGN......-......AD.....CV..TKH..................................................IDAASQILLRDLQllp................gqspLTKTLE.RFAMNFERLAKLDKLSIV.........PGLDC.HEALASMYSSLERL-------...YeWDLEQLrrdp..................amagkPDSLIATAAMCTRHGKPVMH...ERGQVG........................LALQYWKETRF..IAPPAGR..----.....----------.....................---EA.SNK.....SKVWSMLLGCAGI.D...........GV......GLPPARV......................SENWISKDIVKHd...................................elGHTLTPLLDWLEPDHVSlpqsden........................kdasmdmlQADL.....STTRVP...RVMFTATFDPPVILPQTEWARLY.ALAG.VEPPNMNPSnd.............fnrQ.PPTFDALFFP.ITPGTRQdp......................................seaRTITRQHQVPMI-..........--NTYNE..PLIRTHQNSL.F.IY...KP.IYS.......................................Q..--ELSELPFGHPRQLVDMLPVLRQYAFLSTLLESSF-s.......................................................................................................................................................................
G4UE51_NEUT9/122-537                 ..........................................................................................................DEVISILSQ...N-RGY....-VSEAGLERLAQKLEL..DCMWD......................EHM....-AGESKRTLIIAG.SA.LELLIGF.........-TD..N..IV.....Q......SLTLAFPES......-......SE.....SV..NKH..................................................AEDAGKILLENLKlqp................gqspLTKQLD.KFSVNFERLAILDKLSIA.........SVLNL.YEAIAGVFDSLSRL-------...HqWELQKVreda..................slagrTDEYLRNIVLCNRSGTPAMN...ARGKVG........................MRIDYWKNKHL..QPPLNPQ.lA---.....----------.....................--AHA.EKH.....EKIWGILVGCAPInRn.........lDV......NVHPVRV......................SHHWISENVELPhi..................................pgDLQTSPMVHWLEPEDTIvpp................................dpekAGDS....lLGPRLP...SVTFSATFDPPIHISFGLWEQLR.SMG-.IGIPAMDV-..................-.SKSFDNLVFP.IAPGGYYdp......................................tepREIHHTKDITYQ-..........-LPGSPA..WLSRKHANSL.Y.IY...KP.VYG.......................................K..--TLTEASFSHPQHLIAMLPYLRQYAFLSTLLENSFK........................................................................................................................................................................
A0A0L1JFA6_ASPNO/130-562             .........................................................................................................e-DVVQVLRT...RVAGR....GVCREGIERLGQLEGF..ESIWQ......................EDS....--------LSIAG.NF.VDLEIEF........yRAQ..N..TV.....K......DVSLNIATP......-......EA.....TD..GER..................................................-REATAVLKRDLIespe..............drgrsSWKTLT.KFHENLQWLAKHDRLS--.........QEVNC.FEAIEGLYESLKRI-------...-.WDEEGDh........................rkFSGINDHLCS-GWVGKPCLH...QGGRIG........................LNLEYWVHQAR..VLDAKQK..KASPd...dMAIDQPPESS.....................MDGES.GNH.....NGKWNIIIECEE-.-...........--......GYPSLRV......................SKEWVNSEVFTVmnnntne........................psssneiGGSDVTVVNWADPPATLpsqd..............................qqdamALDS....gMLGAAP...NRRFVARMEPPLELPILAASDIY.RHLG.IQMPQEFK-..................-.MVTYDGLLAP.GWSPLSAagamglg.............................peeasqlGRRRRKMAVQTV-..........--DQDGK..PCTKQHSYTF.Q.PF...ES.VAG.......................................R..--TMRDIPFAHPRQLADILPTLRQYALLANMIRNIF-s.......................................................................................................................................................................
A0A0A1TB50_9HYPO/126-550             .........................................................................................................d-AILKMLNE...K-KGF....-VSDAGIERLAQRLGM..ELLSE......................EQT...tPDGRKTKTLTIAG.SA.VAMDIVL.........-EN..N..IV.....L......SATLSYHGN......-......AS.....SV..APY..................................................IEEASDILLRDLQlkk................dqspLTKTLD.DFAANFERLALLDKLSIV.........PGLDC.HEALVGIFSSLERL-------...HsWDIEQAkrap..................dnagkPDPVIDSLVMCQKNGKPVMN...ARGRVG........................LALQYWKHRRF..SNRPARK..----.....----------.....................----D.ETY.....GRIWSILLGCAAI.D...........GI......GLPPVRV......................SKDWISSDIILKqea................................tgaDGQQQNVLDWQEPDNVSlppseen........................kdagmellQADL.....STTRVP...RVMFTATFDHPLILPQNDWARLY.ALAG.VEPPPTTADf...............gqA.PPTFDALFFP.LPSGAKQdp......................................seaRTISQTANVNTY-..........--DEQGN..LIQRTHRNSL.Y.IY...KP.IYS.......................................Q..--EVTEMPFAHPRQLIDMLPLLRQYAFLSTLLQTSFK........................................................................................................................................................................
T5AMU8_OPHSC/120-545                 .........................................................................................................d-TILKLLSE...K-KGI....-VSEAGLERLAQRIGL..ELLSE......................EQT...tPDGRKTRTLAIAG.SA.IALDIVL.........-DN..N..IV.....Q......STSLTYHGN......-......AS.....SV..SRH..................................................MDAASRILLQDLQllp................nqspLTKSLA.SFASNFERLAVLDKLSIS.........PGLDC.HEALAGIYVSLKRL-------...HhWDLSRLrqda..................vtasgSDDYLNAAAMCVRHGVPVMH...ARGKIG........................LVLQYWKELRF..MPPPSDR..----.....----------.....................LARFA.EKH.....EKVWSMLVGCAPI.E...........NL......GLPPVRV......................SESWISKNIVKNd...................................vsIGPGIVALDWQGAENVSlpqsddn........................kdtgmdmlQPDL.....STTRVP...RVMFTVAFDPPVVLPQNDWSRLY.MYAN.VNPPNIELSh...............rgA.PPTYDGLLFP.IPFGVRVdp......................................sepRAISRRRRVRVY-..........--TEDRK..PVVSQHHNTL.F.IY...KP.IYS.......................................Q..--VVSETAFSHPRQLVDMLPLLRQYAFLSTLLENSF-g.......................................................................................................................................................................
U4U837_DENPD/58-412                  ..........................................................................................................QKCLDTLQHv.iKVTGL....QSMIERLESLTRQLGL..RFEIE......................KTG....--------VFIFS.DM.FYLEIIL.........EAT..G..VV.....K......DVKIHHEGK......V......EQ.....QS..CIE..................................................-------LVNCLS.......................-RGDFT.DFTTQLEGFVSIYQLNAEk.......kVKGKA.FTALESLEIDLCTLAQLQTFM...-.------...........................---------------KEPFNi.lHKSPVGvlekr..............rgghsMKLTYFISPYD..LLNVDKH..----.....-EIDAIS---.....................IDSII.SKGl...gYWVTVSIEGSVAH.K...........LQ......TTPLITI......................-NRSMNG-----......................................----------KSTPSYT.......................................PLTI.....QNSAVV...PACFSLKLNKPMPVCVSLVRKMQ.QIQQ.-WVEVETR-..................A.PQPLLNMIVN.-------...........................................-------QCSGGKm........sCNNNKGL..FVSLPDQTHC.Y.CM...TE.NRN.......................................M.nGIFVSSIPFSHPAHVSKILMILREQALFNNIIESCVR........................................................................................................................................................................
A0A066VWL0_9BASI/225-421             ......................................................................................................rlss---------...-----....-----ALSSLGTELKL..EHLEDrhdv.............epeaqE--....ATQVQTHTLTIAG.KI.LVLDFEFl.......lSVA..Q..KV.....W......SPSIRIRIS......Y......AT.....SS..GETngnaheglsnevmdvqhn.............nsekaryfeqsldvllqndVQKISEVLFN-LEttshpsr.........aaelqdkLEAHYA.RFSANLETLVRLDRSKVQ........eGCSDP.FSSMARVCKQLQQAF------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------repndrsicta.............................................................................................................................................................
A0A074XKZ9_AURPU/154-603             ................................................................................................kllgrqdkrr---------...--FGR....-VSEEGVRRVGRWAGL..DVEVE......................AKRe..aRKFEGNRPVAVAGkNN.VLIDFQF.........-KD..N..LP.....T......HIDLSFSSQ......-......DQ.....AV..TSH..................................................QPAAARVLLEDLTppp................gisaINTKLD.RFAANLETLARLDKLSVY.........DQLNC.FEAITGVYESLKKLYEHEKQAa.lT.-IVQSKr........................gnTELRAERHVLCKRSGRPQMH...TRRKIG........................LSLDYWMEKSN..IYLSPSNatKDES....aMDLDSKPSTT.....................PTN--.DAD.....EPVFALDITAEA-.S...........SP.....dMYPSIRV......................SSSWIADRILKSaeet.............................tdptdLLSGNQSIDWQDPPPTYlsdnnqna.......................gdamaidsNPNS.....GAQKPP...AVRFVARLNPPLTMPWTAANAIL.QSVGaANLMSDLPD..................I.QHTYEGSLLQ.KPSEIPIlnkpm.................................iqssgP---AASETTDV-..........-LTPDGG..RV--QHKNAL.Y.VP...KQ.DFG.......................................Y..--VLSSIPFAHPRQVITLLPVLRQWACLGSLLRTIF-l.......................................................................................................................................................................
G3NRM9_GASAC/59-429                  .........................................................................................................l-TCLETLQRa.lKVSSL....PSMTDRLESIARQNLL..G-S--......................---....HLSPSGTECYITS.DM.FYVEVQL.........DTN..G..QL.....V......DVKVAHQGE......-......NP.....TS..CPE..................................................-------LIQHLR.......................-EKNFE.EFSKHLKGLVELYKLPGDn.......kLKTKM.YIALQSLELDLTKMMHMFRLA...T.-N----...........................--ANAVETILHGSVGLLTAR...SGGHL-........................VSLQCYVSPYD..LFDEGLT..----.....TQLNLPDGNV.....................PRS--.-LG.....VSVFVTIEGTSAVyKl........piAPl...itGSHPVDNkgsps............fstvtNSNCVDL-----......................................-----------------.......................................----.....------...PACFFLKLNRPMPFSRSFIQRLG.NATS.IPVFESSP-..................S.LSPLYQLIVH.-------...........................................----SQHQLSE--..........---EGSK..TPLPSHNMHF.Y.SV...--.LPDqqhcyflng....................dapvqdgrclQ..GALVSKIPFRHPAQVPLLLDIIRHQAAYNNLVSSCVK........................................................................................................................................................................
G2Y8B3_BOTF4/111-530                 ........................................................................................................mg--CVEILKP...N-KGR....-LSEAGLERLARRVGL..ECLWE......................DMM....GSASNGRTLIIAG.NA.LALDIDF.........-AN..N..IV.....Q......KVSLSFPDA......-......PE.....SV..TKH..................................................EKTASDILLRDLQfea................gespLTKMLD.RFAANLERLTMLDKLSVI.........PGLNC.HEAVAGIFCSLHKL-------...HsWEVGRLkene...................mlgmGDEDVVRAAMCTRSGIPIMH...SRERLG........................LSIDYWQEKRR..IPTKGKK..----.....----------.....................-----.-QN.....RKTWSLLVEVAPL.P...........SMg...vgVYTPLRV......................SDKWISDDVQQAnpavd...........................dlfraaQLQEGPILNWLEPDNTLlpt................................spdiKSNDl..nvGTQKFP...EAMFVAKFDPPVVVPYAIAMQIY.QST-.-QTPFDFS-..................E.ITTFDGLMFP.LSAEEALktn....................................etqaRTINVEKNVSVW-..........--DREGK..KEAKQHFNTL.Y.IE...KI.DYG.......................................R..--KVEEVSFSHPRQLVEMLPCLRQFALLSTVLRKSF-e.......................................................................................................................................................................
M7BXJ8_CHEMY/176-276                 .........................................................................................sllyrlprvlidglkva---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------------.........-----.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.--SLHALIVQ.-------...........................................---------FTL-..........--NDEYK..EDLSMNNSCF.F.VS...--.LPDcpkhgy..........................finkgteK.sGALVSKIPFTHPKCVPAIIEILRHQVTYNTLIGSCV-s.......................................................................................................................................................................
A0A0F2LZ96_SPOSC/132-585             ..........................................................................................................QTVLQLLQA...S-KGH....-VSEAGLERLAKSMGL..ECLWE......................EAMggggGGGNDARTLVVAG.SA.LALEIAV.........-AN..N..IV.....E......SVSVTFPES......-......RS.....IV..LRH..................................................VERADKILLHNLQlqp................gespLTKTLD.RFAANLETLAVLDKLSVE.........PGLNL.YEAVAGIYETLDRLFQ-----...-.WDLQQLrndptls............thtqstarDEDALVTTVQCARHGRPTMH...EGGHLG........................LGVDYWKQMRH..VRPVRAA..AAAA.....-AADNVGVV-.....................AGTGA.GPD.....DTTWRILIGCAPT.S..........sAL......MYPPVRV......................SDKWLSDAIEKSdnml..............................lggnSNPAQPDLDWLEPENTIlpstqqpdg.....................asktegdeeAPTT....lAGAKLP...DVRFHAVFHPPVVLPLALWHQIN.ELVG.LVPETDAQ-..................P.PATFDALLFP.VPPGTQHdp......................................sepRTIRRDKAVASR-..........-SDAGGT..IATTKHHHAL.F.IY...KP.VYG.......................................H..--LLSELPFSHPSQVVRMLPTLRQYAFLATVLQNAF-g.......................................................................................................................................................................
L2FW69_COLGN/119-518                 ..........................................................................................................DSVIDILGK...A-KGR....-VSEAGLERLTLRTGL..TSIWD......................EHR...sPDGRKTKMLVIAG.QA.LTVDIVL.........-NN..N..VV.....E......NVSLTFPES......-......AP.....IV..TRH..................................................KDQAAKILLEDLQlrp................dqspLTKTLD.KFSENLERLANLDKLSVI.........PGLDC.QEALAGIFECLERL-------...FrWELSKLqeda..................amggkPARFLQTTVMCMKSGRPMMH...ARDMVG........................LSVEYWTERRH..VIPKTET..----.....----------.....................-VRYC.EKQ.....EKVWSILIGCKAL.D..........dGE......LFPPT--......................----TSL-----......................................-------LAWQEPEATSlpqtddn........................kdkgmdmvGPDG.....STERLP...KVKFIATLAPPVIVPQSVWNNLH.SLTG.AASQPMLV-..................P.IHTFDSISFP.IPDGTNHda......................................selRVISCRRAIQV--..........--PGDGN..TISRRHKNTL.L.IY...KP.VYG.......................................Q..--TVTELSFSHPRQLVAMLPILRQYALISTLLERSF-g.......................................................................................................................................................................
D3BU93_POLPA/167-536                 ............................................................................dldnrygsysdlheltalaktdpaeispdq---------...-----....----------------..-----......................---....-----VYSCNISS.ST.FLLDIFI.........NGD..G..TV.....K......EVKLVHISM......A......TG.....ED..KET..................................................DESINNELTTALR.......................--NNIK.EFDAKIRRICQQDLLFRK........fQHVNL.QQALQVLQDDFLSI----GKK...H.QEQQQQ...........................QAIDIGDELELFNSGYGKIS...L-DICG........................VKSVYYTTLQQ..RLSHEG-..----.....----QYSLTLd...................iE---E.GSR.....TSMYQLTLTSQLS.E..........dGL......SFIPHQQ......................QQQQIQN-----......................................-----------------.......................................EQQD....vNSLINS...NVRLVVKLDPPINITIGTMTELL.QCVG.VKSNPTASSst..............npN.AMLENQLVVS.NCSNGKNsss....................................ssntQ--NNNNNNNS--..........NTLEQND..ITVLGDRQRY.F.YT...GG.EYH.......................................P..GIEVSRIPIEHCSQLLPVLQILRQQIVFNLLFKSCF-t.......................................................................................................................................................................
L7N327_XENTR/44-412                  .........................................................................................................v-SCLETLQKa.lKVSSL....SAMTDRLESIARQNGL..T-S--......................---....HLSPNGTECYITT.DM.FYLEVLL.........DTE..G..QL.....C......DVKVAHHRE......-......NP.....VS..CPE..................................................-------LVEQLR.......................-EKNFE.DFSQHLKGLVNLYKVPGDn.......kLETKM.YLALQSLELDLTKMAAMYWQA...-.TN----...........................--ASVLEKILHGTVGYLTPR...SGGQV-........................MSLKYYVSPYD..LFDDTT-..----.....--GASISLSEgh.................avPRS--.-LG.....MNVSVTIEATSAM.Y...........KL......PIAPLIM......................GSHPIDN-----......................................----------KGTPSFT.......................................SITN.....ANSVDL...PACFFLKFPQPIPVSRAFIQKIQ.HCTG.ISLIDGSH-..................T.FLPHYELVTQ.-------...........................................-------FEL---..........--AKEKE..PGTLNHNMRF.Y.AS...--.LPGqqhcyfvnk....................daplpdgrslQ..GTLLSKIPFQHPGRVPIILSLIRHQVACNTLIGSCVK........................................................................................................................................................................
B4MKH6_DROWI/80-463                  .........................................................................................................q-AALDKLQHy.iKVTSR....HGLVERLESLSRQLGL..KFM--......................---....---EDQQLLFIST.DM.FYVEILL.........DSS..G..NL.....S......DVKVHHECK......I......E-.....QQ..SSE..................................................-------LVNCLK.......................-SGDFA.DFTVQLEGLSSIYQLNAEp.......kVKKKA.FVALQAMETDIYNLYQMQNHK..gD.------...........................---D-----------SYEIM...NQSSVGlvlqr..............rgghpMKLTYFCPPIH..LPECKAG..GASP.....THTNEVNSLNy..................tiDQVMK.SSH....gLSATVNLEGSSAN.K...........LQ......IMPIVTF......................QRDAQSG-----......................................----------IEVPTYA.......................................QLNQ.....NNSMLM...PATYVLRLNKPLPVCYESLRALG.-LPG.VDGMANISTsaststtgfssststpqgP.ATTVLNLIVQ.-------...........................................---TASKQAIRN-..........--TQRGL..YVNLPKETHC.Y.FF...TD.NRK.......................................L.qGTLVSSLPFTEPAQVPKIMAFLKKQALFYTLLSSCVR........................................................................................................................................................................
G5BRW6_HETGA/44-411                  .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAIMYWKA...-.TN----...........................--AGPLDKILHGSVGYLTPR...SGGHL-........................MNLKYYASPSD..LLDDKT-..--AS....pIILHEN--NV.....................PRS--.-LG.....MNASVTIEGTSAMyKl........piAPl...imGSHPA--......................DSKWT-------......................................-------------PSFS.......................................SITS.....ANSVDL...PACFFLKFPQPIPVSRAFVQKLQ.NCTG.IPLFESQP-..................T.YVPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PIPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLISKITFQHPGRVPLILNMIRHQVAYNTLIGSCVK........................................................................................................................................................................
G0V879_NAUCC/11-296                  .........................................................................................................g-EMIVLFKG...YKPGL....-ITIDNITKLCQTLGL..ESFID......................DID....---STTSRLSTAS.KI.IVIDIDF........dKKK..G..IV.....K......DVKLVLASN......F......DNfnyfnDE..EKS..................................................NPGSSNILLNSLT.......................KYPDLK.VFHHDLQYLYLLDTYSQId.......sDPTTL.NNSGLASTTSDSNI-------...-.------...........................----------SGSTQANIVP...NNGKLD........................L-FKYFTELSQ..YIQQYFI.dNQLN.....-------LK-.....................---VE.TNL.....DNKFGIYIKSKDR.Sdl......pliK-......------Vyfeksmdpsq..rlyeylyssgTKNWINESSENY......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------icgvrlameiipvegqsiwfpdefipdeliitsqendenqvkpv............................................................................................................................
F7E5Q9_MACMU/1-356                   ..........................................................................................................---------...-VTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAIMYWFS...T.-M----...........................-AAIFHKLFW-----SLTLH..iFFFFIGh......................lMNLKYYVSPSD..LLDDKT-..--AS....pIILHENNVS-.....................----R.SLG.....MNASVTIEGTSAMyKl........piAPl...imGSHPV--......................DNKWT-------......................................-------------PSFS.......................................SITS.....ANSVDL...PACFFLKFPQPIPVSRAFVQKLQ.SCTG.IPLFETQP-..................T.YAPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PIPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GALVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
B4IAT3_DROSE/74-431                  .........................................................................................................q-SALDKLQHy.iKVTSR....HGLVERLESLSRQLGL..KFM--......................---....---EDQQLLFIST.DM.FYVEILL.........DAA..G..SL.....S......DVKVHHECK......I......E-.....QQ..SSE..................................................-------LVACLK.......................-SGDFA.DFTVQLEGLSSIYQLNAEp.......kVKKKA.FVALQAMETDIQSLYQLHLQS...HsGD----...........................---------------SYSLM...TSSSVGlvlpr..............rgghpMKLTYFCPPLH..LPEGDPK.lASGD.....FTIDQVMRS-.....................-----.SYG.....LSATINLEGSSAN.K...........LQ......TLPTVTL......................VRDSQTG-----......................................----------LEVPTYA.......................................QLNQ.....NNSLLM...PATYVLRLNKPMPVCLESLKALG.-LPG.LDSVATPPS..................P.PTTVLNLIVQ.-------...........................................---TASKQAIKN-..........--TQRGL..YVNLPKETHC.Y.FF...TD.NRK.......................................L.qGTLVSSLPFTEPAQVPRIVAFLKKQALFYTLLASCVR........................................................................................................................................................................
A0A0F7VDB9_9EURO/133-548             ..........................................................................................................QEVVQCLRA...RVAGR....GVSREGIERLSRLEGF..ESIWQ......................DND....--------INIAG.NF.VDLEIEF.........YPG.yD..VV.....K......NVSLRYATP......-......EF.....TE..GER..................................................RDEASAVLKRNLVqple..............dvehgRWRCLQ.GFQENLHWLAKLDKLS--.........QEVNC.FEALEGLEENLNRV-------...-.WAEEGKr........................gkYDGEYEHLCN-GVIGRPSMH...KGSRIG........................LGLEYWVEQAK..VLDAKRQ..KISPd...aMVVDQD----.....................QNNEL.DGQ.....QKLWTVMIECEE-.-...........--......GYPSLRI......................SKEWVGIEIFTTgqns..............................esapSGGPTETVNWLEPPQTMrlshg.............................dhdpmALDSs...mLESTPP...NRRFVAKLDPPLELPILAASEIY.RHLG.MQLPQEFK-..................-.MVTYDNLLIS.EGSQ--Ldvt.....................................pqpSRRKRRMSVQGF-..........--DSTGA..ACTNHHNYTF.Q.AF...ES.VAG.......................................R..--TIRDLPFSHPRQLADILPVFRQYALLANLIRNI--tg......................................................................................................................................................................
F6XFN5_HORSE/59-426                  .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAVMYWKA...-.TN----...........................--AGPLDKILHGSVGYLTPR...SGGHL-........................MNLKYYASPSD..LLDDKT-..--SS....pIILHEN--NV.....................PRS--.-LG.....MNASVTIEGTSAMyKl........piAPl...imGSHPV--......................DNKWT-------......................................-------------PSFS.......................................SITS.....ANSVDL...PACFFLKFPQPIPVSRAFVQKLQ.TCTG.IPLFETQP-..................T.YVPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PIPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
A0A093BDD4_CHAPE/51-418              .........................................................................................................v-SCLETLQKa.lKVSSL....PAMTDRLESIARQNGL..G-S--......................---....HLSANGTECYITS.DM.FYVEVQL.........DPT..G..LL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQHLR.......................-EKNFD.EFSKHLRGLVNLYKLPGDn.......kLKTKM.YLALQSLELDLSKMAGMYWQA...-.TN----...........................---------------ANPLDk.iLHGSVGyltpr..............sggllMNLKYYVSPYD..LFEDGT-..-GAP.....-----VILHE.....................NNVPR.ALG.....MNVSVTVEGTMAMyKl........piAPl...imGSHPVDS......................------------......................................----------KGTPSFS.......................................SITS.....ANSVDL...PACFFLKFPRPIPVSRAFIQKLQ.SCTG.IPLFDTPP-..................T.FVPLYELITQ.-------...........................................-------FELS--..........---KEAD..PLPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLISKIAFQHPGRVPLILSLIRHQVAYNTLIGSCVK........................................................................................................................................................................
H2QCU3_PANTR/59-426                  .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAIMYWKA...-.TN----...........................--AGPLDKILHGSVGYLTPR...SGGHL-........................MNLKYYVSPSD..LLDDKT-..--AS....pIILHENNVS-.....................----R.SLG.....MNASVTIEGTSAVyKl........piAPl...imGSHPV--......................DNKWT-------......................................-------------PSFS.......................................SITS.....ANSVDL...PACFFLKFPQPIPVSRAFVQKLQ.NCTG.IPLFETQP-..................T.YAPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PIPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
M1W731_CLAP2/124-554                 .........................................................................................................d-TIINILST...T-KGL....-VSEASLERLAQRIGL..ELLSE......................EQT...tAGGRKTRTLAIAG.SV.IALDIVL.........-DN..N..IV.....Q......SASLSYHGS......-......AT.....SV..AEH..................................................MDAAGQILLRNLTllp................gqspLTKTLD.SFASNFERLAGLDKLSIV.........PGLDC.HEALAGIYSSLSRL-------...HeWDLSNLrged..................atkgrSEAYLTNVAMCCRHGRPAMH...ERDRVG........................LAWQYWKQHRH..VIPSADD.aD---.....----------.....................MSSWG.AKQ.....DKVWSLLLGCDAL.D...........GM......GVSPVRV......................SDTWISEAITREd...................................msFSPPRTMLDWQEPPYVSlpqsddn........................kdagmdllQPDL.....STTRVP...RVMFTVSFDPPVVLPQNDWARLY.MCAN.IDPPNIQNEmiqr..........glppS.PPTFDSLLFP.FPPGIKVdp......................................sepRAISRRRQLLHI-..........--GSDDK..TM--HHHNTL.F.IY...KP.IYS.......................................Q..--TVTEMPFSHPRQLLDMLPLLRQYAFLSTLLENSF-g.......................................................................................................................................................................
K7J0T4_NASVI/19-378                  ..........................................................................................................QKSLDALQHs.iRVTSL....QSMIERLESLSRQLGL..KFVMS......................--G....PPTTTNTELFISS.DM.FFLEVLL.........EPS..G..AV.....K......DVKIHHDGK......-......NE.....QQ..SEE..................................................-------LVACLS.......................-RGDFV.DFTTQLEGLASIYQLNADk.......kVKGKA.FSALQSLETDLGILAELQKFM...-.------...........................---------------KEPFNv.vHKSPVGilerr..............kgghaMKLTYFVSPYD..LIDQENK..SCEA.....LSLEA-----.....................--V-I.SKKv...gHSVTVCLEGSTAH.K...........LP......TSSIITV......................TRTPTGK-----......................................-----------STPSYA.......................................SLTS.....ANSSML...PACFVLKLAKKMPMCLELIRKIQ.KVTD.LECTDISV-..................-.PYPLLSMIVQ.-------...........................................-------HTSDKQl........dCQNNRGL..TVSLPDQQHC.Y.FM...TE.NRN.......................................M.eGVLVGSIPFTHPAHVPQILNVLRQQALFNTLISSCVR........................................................................................................................................................................
E9ES81_METRA/120-550                 .........................................................................................................d-TILTLLSA...K-KGL....-VSEASLERLAQRIGL..ELLSE......................EQR...tPDGRKTRTLAIAG.SA.IALDIVL.........-DN..N..VV.....Q......SVSLAYHGS......-......AS.....SV..SKH..................................................MDAAGRILLKDLKllp................gqspLTKTLE.NFASNFERLASLDKLSIV.........PGLDC.HEALAGIYVSLERLYQWDLSNl.rEeQDMKAK...........................SDKHLSNMVMCSRHGRPVMH...DRDTVG........................LAIQYWRELRF..MPPVADG..----.....---TY-T---.....................---YN.YES.....GKVWSLLLGCAPL.D...........GM......GVPPVRV......................SENWISKEITKQd...................................amIDPTKTILDWQEPDNISlpqsedn........................kdagmdllQADL.....STTRVP...RVMFTVTFDPPVVLPQNDWARLY.MYAN.VNPPNIINEpsqr..........ghppA.PPTFDSLLFP.FPYGMKVdp......................................sesRAITRQRLVRVL-..........--LSNRI..ESVVNHNNTL.Y.IY...KP.IYS.......................................Q..--TVSEMPFSHPRQLLDMLPLLRQYAFVSTLLENSF-g.......................................................................................................................................................................
E0W419_PEDHC/45-396                  ..........................................................................................................QKCLDTLQQs.mKVTTM....QGIVERLESISRQLSL..KLM--......................---....-PGPTGLELFISS.DM.FYLEVSL.........EST..G..NV.....K......DVKIHHEGK......L......EQ.....QS..CEE..................................................-------LVKSLS.......................-KGDFE.DFTIQLQGLISIYQLNAEk.......kVKCKA.FSALCALEADLDAHWSLQSNT...-.------...........................---------------KNVLTl.lNKSPVGvllkr..............rgghpMRLTYFVSPYE..VLETKKE..----.....LSLDLI----.....................---YK.SNI....gCSVTICLEGSAAH.K...........LQ......TAPLVSI......................NKNSNKS-----......................................--------------SVL......................................yAPMT....pSNSATL...PAYFTLKLNKPQPICLELVKQIN.ALSE.LECCDSSN-..................-.PHPLFSLITQ.-------...........................................-------FASNGKm........dSSSNKGL..FVNLPDQVHC.Y.FM...TE.CRG.......................................L.dGVMLSSIPFTHPSQVPLILSILRQQAVFNGLVSSII-r.......................................................................................................................................................................
H2MBH8_ORYLA/1-35                    .........................................................................................................v---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------------.........-----.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..---VEAVSFTHPAQVPALLQLLRHQCAVNALLRSC--wa......................................................................................................................................................................
A0A0F4GFL4_9PEZI/165-600             .....................................................................................................ermrr-----VLRSi.gRAKGR....-LSEDGIVRIAKRIGL..DNDIDkap................ltaEER....ARVVGNRTIALAG.AT.SIIEVKL.........-KN..H..RA.....E......GVEVTFAMG......E......KE.....WE..TRG..................................................AKRVGKVLLEDLRagdd..............ddgalVKSRLD.AFAANLVRLARIDQISDGt.......gQGVNC.FEAIDGMHVCLSKL-------...-.FEKEKEav.......................ggEGRKAERDTMCKRSGRPALH...ENGRIG........................MSLDYWTSSPL..PPSAADN..-DDS....rMDVDGQEGSD.....................SHS-E.GPK.....PKLWSLRIDAEVC.S...........AA......MFPSLRV......................SEDWLPSDLSLP.....................................sSSDLDQSLPWQDPPPTYitvkpn...........................adsqsaD--Sma.ldGSQKLP...DLRFVARLDPPLVVPYQTATNIL.ASLG.LSPPQTLL-..................-.FQHFHALLLD.LPTNALQag.......................................faDTIEADQSVFVL-..........--NGEDS..ESEIRHQYLL.D.VA...KP.EWG.......................................L..--KLEELPFSHPRQLVDLLPTFRQWARVADLMNGCF-g.......................................................................................................................................................................
G3NMI9_GASAC/38-402                  ........................................................................................................vr--SLERLQDv.fNVSSM....KTMRSRLEMIAKQQGM..G-F--......................---....HL--TEATCYLTA.DL.FYLEVVL.........LPY..G..GV.....A......EVKVAPHGK......-......AP.....VA..GSL..................................................-------LAFRRR.......................RSKEFA.EFSVKLAGLFTQYDIPGDs.......eTRLKL.FSSMQWLWKDLQQISQLPSVP...K.-D----...........................-SDPRVDVM-----------...NHGRSGcliae..............kedfpMTIQFYAPPTD..GMKTS--..-DRP.....L------LFE.....................ETAAT.EPP.....VQAARVTVGVSD-.-...........--......AAHRLQM......................--ASL-------......................................-LPQPPQLDPQGHPVFL.......................................SSAE.....APHETL...PACFLLKLQPAVPMTLSFVDKLR.HITD.IPIPDVDL-..................Q.WAPLPKLLTG.RSNGP--...........................................------GELPDEQ.........dTIFTVPL..PDGALHRYVL.L.AA...--.AWGea...................................paQ.rAAAVDSIPFTHPAHVPALLQLLRHQSAINTLLRSCI-g.......................................................................................................................................................................
MED1_SCHPO/29-217                    ...............................................................................................idclssvpwnd---------...-----....-ISVTGFEYLAKKYGL..EVFQD......................SSK....---PNEVVLSLAG.KI.ILIDITVp.......iNAS..P..KD.....I......NVVLAFANA......-......-S.....GE..QYN..................................................NPVAEKLLKDAIY.......................-NCNTP.LFEKNVKWLATFDHSSPS.........VQQSC.FQYLDSLSSSLNAIYEAELSL..lA.Q-----...........................-----EENVIMHGNGKPLSN...YEGQLG........................LRIVYWK----..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------lldktystqifmdnlshes.....................................................................................................................................................
E5R2V9_ARTGP/433-539                 ........................................................................................................qh---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------------.........-----.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.-----ETR-..................P.PAAYDALVVP.VERRAPR..........................................sGKGEHVRMVPIFGqtekktgtgeEEKGADE..VTRKKHVYSF.H.AL...EH.VPG.......................................Y..--TVRELPFSHPRQIEEAIPLLRQYALLGKLL-SV--fp......................................................................................................................................................................
C4R1P3_PICPG/13-166                  ..........................................................................................................DEVSQILLK...R-PGA....-VGIKGIKRLSNLYGF..ETFTDiidpvnkas...aiqspgplgmN-E....KELSTIERLTIAG.KI.ILIDIDF.........-QE..Q..KV.....S......DVSLSLAIV......T......KL.....IS..GKDkgkln.......................................fidkacEPNIEKLLLQNLN.......................-ESTLD.DFNRNLRLLSLLDKLSNS.........VSL--.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------ndqln...................................................................................................................................................................
C3YW57_BRAFL/52-416                  .........................................................................................................r-KCINALQKa.lKVTTL....PSMVERLDSVARQVGL..N-F--......................---....KVSSSGHECCISS.EL.FYVEIRL.........DTS..G..GV.....Q......DVRVAHHGS......-......ES.....QG..CLE..................................................-------MLRVLR.......................-NGDFK.EFVGHLKGLLNIYRIPGDs.......kIKMRT.YQTLLCMESDLTKMADAYK--...-.------...........................---------MSGGRGDPMTQ..iQKGIVGyvipr..............qgghpMQLKCFISPYD..MLNVERE..KSET.....-----IHDNV.....................PRD--.-VG.....QSVNVVLEGSTSH.Kl........qtQPl...faGINPPQH......................--DSKGS-----......................................-------------PAFA.......................................GINN.....NNMMLL...PACFSLVPPSPIPLSISTIKRIH.SATG.ILCGDESK-..................-.AVPMNRLVTQ.NVMEAKGia.......................................dmDNNNGRNKLFHV-..........-------..TLPDQHH-SY.Y.IN...-D.APD.......................................L.kGVLVSKIPFTHPACVPRVLEALRQQTVYNTLITSCVR........................................................................................................................................................................
G3S6F8_GORGO/59-426                  .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAIMYCPI...T.------...........................RQNHYDSIIR-LWAGRGGSR...S---LGh......................lMNLKYYVSPSD..LLDDKT-..--AS....pIILHENNVS-.....................----R.SLG.....MNASVTIEGTSAVyKl........piAPl...imGSHPV--......................DNKWT-------......................................-------------PSFS.......................................SITS.....ANSVDL...PACFFLKFPQPIPVSRAFVQKLQ.NCTG.IPLFETQP-..................T.YAPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PIPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
A0A068XRR4_HYMMI/114-440             .............................................................................................vsvaavhfefnqd---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......KP.....TE..CSV..................................................-------LADDIR.......................-KRIYY.SLWKHIKNLIALYNLPGEt.......aQRCRA.YLCLQALEQDLIALTTAVSNHf.pHpA----Tpmslelt.............ggssmkvA-----NTAR--DVECLAQS..iNGSAVGqvvpr..............tggcfSCLTYYIPPAR..KLKVLEQ.iHSQP....pT-------GL.....................KEGSE.SGM.....LDGYCASVGLRATaN..........gAQ.....ySLPLVSL......................-VNLTKD-----......................................----------ADGYNVAq....................................ftTADN.....ITRVTL...AAEFFLKLNPPLLFDLDSIAEVE.AITK.IPMDSLRQQ..................D.PQPLRYILLC.-------...........................................--QHDQEGLIAV-..........-DPHYLL..PNKSQHTYHV.L.P-...NN.VRG.......................................Y..--LVNEIAFTCPSQLPPLIQLLRQRA-----------swlsfvet................................................................................................................................................................
M3Z9F8_NOMLE/16-383                  .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAIMYWKA...-.TN----...........................--AGPLDKILHGSVGYLTPR...SGGHL-........................MNLKYYVSPSD..LLDDKT-..--AS....pIILHENNVS-.....................----R.SLG.....MNASVTIEGTSAMyKl........piAPl...imGSHPV--......................DNKWT-------......................................-------------PSFS.......................................SITS.....ANSVDL...PACFFLKFPQPIPVSRAFVQKLQ.NCTG.IPLFETQP-..................T.YAPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PIPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLVSKITFQHPGRIPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
B2B7Y2_PODAN/107-526                 .......................................................................................................era---------...KRKGL....-VSEAGLERLAKRLGL..EVFWD......................APV....-GNEKKKSLIIAG.AA.LELSIDF.........-QK..D..IV.....L......SLSLNFPES......-......AD.....IV..SKH..................................................AAAAGEILLKDLQled................gqlpLTKSLA.GFADNFERLAMLDKLSLN.........PGLNL.YEAVAGVYESLLRL-------...HhWEMQKLreep..................afagkRDFEIECLALCTRSGRPTMN...SRRKTG........................LSLDYWKQGRN..FKSETPE..QTAE.....----------.....................----M.IDN.....SKTWSLLIGCTSL.N..........pNN......PVSPVRI......................SDKWISVDVERMp....................................lPDELGPVVDWLDPPPTYlpt................................pedeKSDPgv.llHAPRLP...EAVFQAIFDPPIHISADLWDKIR.QLG-.VGVVDSAPE..................K.LTTFDNLVLP.QAPNTGNlkssd................................qanaeaRTTVCHKKIPNFPh........pN--ESEE..VQIMNHTNTL.Y.VY...EP.VYG.......................................K..--TLTELTFSHPQHLVMMLPHLRQYVFLSILLENSF-e.......................................................................................................................................................................
A0A0K8L5F2_9EURO/136-567             .........................................................................................................e-DVVQLLRT...RIFGR....AVCREGIERLVQLEGF..ESIWQ......................EDN....--------LNIAG.NF.VDLEIEF........hRGQ..N..VV.....K......DVSLSYATP......D......A-.....TD..GER..................................................REEATAVLKRDLVqnpk..............dgergSWKSLT.GFHGNLQWLSKHDRLS--.........QEVNC.FEAIEGLYQSLKRI-------...-.WDEEQKl........................pkFSGVYEHLCA-GSIGRPSLH...KGSRLG........................LSLDYWIHQAH..VLDAKHA..NSSPd...dMDIDGPANRA.....................LSEVA.EPQ.....NGKWFVMIECEE-.-...........--......GYPSLRV......................SKEWLDSDVLTVvnnaan..........................gssnetAASDIAVVNWADPPPTLsssg...............................sdamALDSn...mLGSSAL...NRRFVARMEPPLDVPILAASDIY.RHLG.IQLPHEFR-..................-.MVTYDGLLVP.GWSPLSAtgavglg.............................tediaqpGRKRRRTSVQGF-..........--DQEGN..TCTKHHSYTF.Q.AF...ES.VAG.......................................R..--TMRDIPFSHPRQLADVFPILRQYALLANLIHKIFR........................................................................................................................................................................
B6HPQ5_PENRW/133-555                 ..........................................................................................................EEVVQLLRA...RVSGR....GVSRESVERLSRLEGF..ESIWQ......................DDN....--------LNIAG.NF.VDLEIDF........yAGQ..D..VV.....K......DVSLRYATP......-......EY.....TE..GVR..................................................REEATAVLKRTLAqspe..............daecgKWRSLQ.EFHENLQWLAKLDKLS--.........QEVNC.FEALENLEENFRRI-------...-.WAEESKd........................gkHGGEYQHLCA-GVIGRPTMH...KGSRIG........................LGLEYWVEQAK..VLDAKQS.lPSSD....aMEIDAQHDEG.....................SKDEL.DGQ.....GRSWTVMIECEE-.-...........--......GYPSLRI......................SKEWVGSEVFTAgest..............................ellpSTGAAGSVNWIDPPQTTrlthg.............................nhdpmALDSs...mLESSPP...NRRFVGKLEPALDVPILAASEIY.RQLG.MQLPQEFK-..................-.MITYDALLVS.ESSSLTSpvs....................................spqiGRRKRRMPVHAF-..........--DSEGK..QYTKQHNYTF.Q.SF...ES.ITG.......................................C..--TIRDLPFSHPRQLADILPILRQYAVLANLIRKTF-h.......................................................................................................................................................................
M7BPB7_CHEMY/132-361                 ...................................................................................................aspldki---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------------.........-----.---------------------...-.------...........................--------------------...LHGSVGyltpr..............sgghlMNLKYYVSPYD..LFEEGT-..-GAPi...iLHENNV----.....................PRS--.-LG.....MNASITIEGTLAMyKl........piAPl...imGSHPVDNkgtps............fssvtSANSVD------......................................-----------------.......................................----.....-----L...PACFFLKFPRPIPVSRAFIQKLQ.SCTG.IPLFDTPP-..................T.FVPLYELITQ.-------...........................................-------FELSK-..........----ETD..SVPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLISKITFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
A0A0C4ETX8_PUCT1/180-333             ...............................................................................................sllienlppdq---------...--RSR....-TSVPLIEALARDIGL..ECIRD......................SDD....-----SNLLTIAG.KL.FVIDIEIdp....nhdQTH..G..QV.....N......RSKFSYTFA......E......--.....EE..AKR..................................................DLSIDHELTHQLSnihhlfqaqpp.hsfckltqlqlVQNSLQ.SFARSLRQIKELDELMINq.......sSSIDY.F--------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------mvflrt..................................................................................................................................................................
G7DWX3_MIXOS/166-310                 ..................................................................................................tcsqqdgl---------...-----....ARTLHILEQLAAQEGL..DTYKE......................TQT....-SSHVADTITLAG.KL.VIVDIDV.........DVS..G..KI.....D......KVRLTYGPD......-......AK.....PD..SKL..................................................----SAVLYTPLSrlhll............paeragVEKDLQ.AWRAALQQIILLDHALHA........gESLDL.FDKLHELYSGLA---------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------glphdfs.................................................................................................................................................................
M9LJL3_PSEA3/206-413                 ...................................................................................................dalqtle---------...-----....-ALCSTLEHTARKLGL..ETFSDpapea............ageptT-P...gPTGVLTRTLTLGA.KI.LVIDVEFlleg.sssdASL..R..PR.....I......KLKLSYATD......S......AD.....SQ..HVR..................................................DSRLGLVLETDIQtiadklfrkd..elgaidqdrstVAQALA.NWTANLTDLLALDALEARateasadqaRSTDL.FAAMQDLCSAAARVSEAESLS...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------snpdavldrghglhqlhaakp...................................................................................................................................................
M7BPB7_CHEMY/10-134                  .........................................................................................................v-SCLETLQKa.lKVSSL....PAMTDRLESIARQNGN..FCFVL......................YVSl.gsHLSANGTECYITS.DM.FYVEVQL.........DPT..G..LL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYKLPGD........kQATN-.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------asp.....................................................................................................................................................................
X0C9I0_FUSOX/118-539                 .........................................................................................................e-TIIATLDQ...K-KGL....-VSEAGLERLAQRIGL..DCLSE......................DHT...aSDGRKQRTLVIAG.SA.IQLEITL.........-HN..N..IV.....E......NISLAFPES......-......AR.....SV..TDH..................................................VTRASEILLRDLQllp................nqspLTKTLD.KFAVNLERLAVLDKLSII.........PGLDC.HEALAGIYVSLERL-------...HkWDVARLrdep..................gmggkPDSELSTMAMCTRHGYPVMH...SKDRVG........................LALQYWKALRL..VQPTNTK..-MAS.....----------.....................---FT.SSH.....EPVWSLLIGCAST.G...........GM......GHMPVRV......................SEDWISKDVVKAe...................................psMDPKRPNLDWQEPDNVVlphseen........................kdasmemlQPDL.....STARVP...QVMFVATFDPPVILPQNDWLRLH.SYAN.VNANPLFG-..................Y.SPTFDSLFFP.IPPGSAQdp......................................selRAISRSRDVRIY-..........--DKDQT..AIIKPHQNTL.Y.IY...KQ.IYS.......................................Q..--VVTEIPFSHPQQLIEMLPLLRQYAFVATLLENSF-g.......................................................................................................................................................................
I2H7T8_TETBL/11-521                  ..........................................................................................................KKMIEKFQE...YKPGS....-VTLDNITKLCQTLGL..ESFID......................DIG....---NGVSRLSTAS.KI.IVIDIDF........dKIE..G..KV.....K......DVKLVLASN......F......DN.....FN..--Yyntniehkamd...........................sttnnnsandndDDKSKNILFNSLS.......................EYSTLH.EFHHNLQYLYLLDSFSQIe.......vDPLNS.SSVGTGSNTAGTSTNNTNGNSn.gHnHNNHVNnhnsn................nssnntNNDGISSVGNMSSGGTSMIS...SQGKLD........................L-FKYYTELSQ..FIDEYFV.aNNAP.....FS--------.....................---IA.TNL.....NNMFGIYISISGE.-...........--......SKPLARIyleksrdpqq..yfyeytfsqsSNYWINEHSDSY......................................TMGISLVLEIIDDSSCIfpldliprdliielgdnlsnshntsntnshsnntnsnyiQTSSs...tTNSSSS...SSGFSRSSSNQIE-SNSLFTKMN.SMTN.LNQHAHKLSnsnsn........snsncP.TVTSSNSNTN.Q-----Nqssknn...............................snninsYNKNANTQALSVLd.......ngSIRSVIN..IPSYSRKSKF.Q.IM...ND.FTT.......................................K..MINIKKFDISN-DNLSLILEFLRWVRWSKIILNPVIK........................................................................................................................................................................
A0A015K2E6_9GLOM/130-539             .....................................................................................................aldac-------HD...NSTAF....KFIIQQIESLGKQLGL..LIYHD......................TG-....--EPGETVLTMSG.AI.IVLDIKY........dEIL..N..RI.....I......KVVVSYATD......-......AR.....QN..DK-..................................................DDRVNNLLTQQLS.......................DFKQFN.LFKKNLETLKTLETMSKL........iQPVDC.FHCIKCISNDIKTIYEKEFAI...-.------...........................TNGDV-QKILTEGHGIP-LF...NVDRVG........................PSIAYWAPKHQ..IMEIDWK.fIKDI....iIQGE------.....................MHESF.RSL.....HRMWISMEKSRT-.P...........HL......FLPPGRN......................-QYLLNDELENEielm..............................enyyI---------------Spelpevqfsl...................lqaplkflhpKEDS.....TIFASA...LIEFVVWLDPPVYVSDNVARHIG.SYAG.IVNRGYFVSsafq..........kkdpQ.TLSLEQLLIE.GIIPPIKh.........................................sSTSRAPKIIHQW-..........-----EK..KF--DDSLYL.Q.VF...NL.DSKcn..................................tkaR..--RIDRIPFSNLFQVYGLIKILRQQLLFNKLYQSCF-n.......................................................................................................................................................................
W5JUJ1_ANODA/116-486                 ..........................................................................................................QKTLDSMQYc.iKVTTR....QGLVERLDCLTRQLGL..KLS--......................---....---EDTSGLFISS.DM.FYLEIIL.........DPL.lG..TV.....Q......DVKVHHECK......M......KQ.....QS..CSE..................................................-------LVACLQ.......................-RGDFA.DFTTQLEGLASIYQLNAEk.......kIKVNA.FVALQALETDLHTLYTLTANR...Y.TE----...........................----IHSLLL-----QSPLG..vLQKRRGg.....................hpMRLTYFVPPYE..LLDSATR..----.....---TMNVLSAe..................liARE--.--Ri...gCSVTVVLEAASAN.-...........KL......QIQPLLI......................PGAGAGS----Tgg..................................ggTGTGS--------TPTY......................................aAIEK.....HNSTSL...PATFVLRLSKPIPIDGAMMSAIR.TVVG.RSEGSDESSta.............agtR.NTSLMGLIAQ.HASGG--...........................................-------TVQD--..........--LSRGL..PVTLPDQYHC.Y.YL...TD.NPS.......................................L.rGVMVGSIPFTEPQHVPKLLVYLRRAAVFNQLLASCIR........................................................................................................................................................................
H2Y2G5_CIOIN/5-153                   ..........................................................................iglevyetpcklpitpliannhptdetskprf---------...-----....----------------..-----......................---....-------------.--.-------.........---..-..--.....-......---------......-......--.....--..---..................................................-------------.......................------.------------------.........-----.---------------------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................----------------A.......................................EINQ.....HNSVPL...PACYSLKLHPPVPILDHIVKQIE.QETK.LPVLYKDK-..................-.STSYLSLIQK.-------...........................................-DDECCKVTFG--..........-------..SVTHRHH--L.D.FS...-H.VEG.......................................L..--LVHQVRFTSPEHVVAVINLLRKQCYLNTVLTSCM-r.......................................................................................................................................................................
F2T2C4_AJEDA/132-559                 ..........................................................................................................EEVIRLLRT...RVSGR....GVCREGMERLGRFEGF..ECLWQ......................END....--------LSIAG.NF.VDLEIQF.........EDG.aE..NV.....K......DVSLKYTTP......-......ST.....VE..GER..................................................RVEATAVLKQDLMqstg..............ehdemPWKSLD.AFHSNLHRLAKLDQLS--.........RDVNC.FEAVTGLYESLKRV-------...-.WEGELSr........................hpEKSHWEHVCT-SQVGQPGLH...QNKRIG........................LSLQYWVEQRR..NLDSNHK.vIPNA.....MSIDQPTPDD.....................QNSTP.VNK.....HKIWSAAIECEE-.-...........--......GYPSLRV......................SNEWVAAEPFTTmntggs..........................ssaangNDSEILLINWLDPPATLvts................................pndvTLDSt...aLGTTTP...NRRFVARLEPPIHIPIIAAAEVY.RVLG.LNMPPEPK-..................-.TVTYDGLVVP.LPNVVSTgdgqde...............................nssspsNGRVQERVVYSF-..........--DDDNQ..PKQHRHIYTF.H.PF...EH.IVG.......................................R..--TIRDLPFSHPRQLADILPILRQYALLSSLLDRVF-a.......................................................................................................................................................................
B1AQH6_MOUSE/59-426                  .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQQLR.......................-EKNFE.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAIMYWKA...-.TN----...........................--AAPLDKILHGSVGYLTPR...SGGHL-........................MNMKYYASPSD..LLDDKT-..--AS....pIILHEK--NV.....................PRS--.-LG.....MNASVTIEGTSAMyKl........piAPl...imGSHPA--......................DNKWT-------......................................-------------PSFS.......................................AVTS.....ANSVDL...PACFFLKFPQPIPVSKAFVQKLQ.NCTG.IPLFETPP-..................T.YLPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PLPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgqslQ..GTLVSKITFQHPGRVPLILNMIRHQVAYNTLIGSCVK........................................................................................................................................................................
B8NT01_ASPFN/108-539                 .........................................................................................................e-DVVQLLRT...RVAGR....GVCREGIERLGQLEGF..ESIWQ......................EDS....--------LSIAG.NF.VDLEIEF........yRAQ..N..TV.....K......DVSLNIATP......-......EA.....TD..GER..................................................-REATAVLKRDLIespe..............dggrsSWKTLT.KFHENLQWLAKHDRLS--.........QEVNC.FEAIEGLYESLKRI-------...-.WDEEGHh........................rkFSGIHDHLCS-GWVGQPCLH...QGGRVG........................LNLEYWVHQAR..VLDSKQK..KVSPd...dMAIDQPSVSS.....................MGGES.GNH.....NGKWNIIIECEE-.-...........--......GYPSLRV......................SKEWVNSEVFTVvnnnan.........................epssnemGGSDVAVVNWADPPATLssqg..............................qqdamALDS....gMLGTAP...NRRFVARMEPPLELPILAASDIY.RHLG.IQMPQEFK-..................-.MVTYDGLLAP.GWSPLSAagamglg.............................peeasqlGRRRRRMAVQSV-..........--DQDGK..PCTKQHSYTF.Q.PF...ES.VAG.......................................R..--TMRDIPFAHPRQLADILPTLRQYAFLANMIRNIF-s.......................................................................................................................................................................
C9S5N0_VERA1/126-525                 ........................................................................................................dt--IIDIIGN...A-KGR....-VSEAGLERLSQRTGL..NKIWE......................DHR...tPDGKVKKTLVIAG.HG.LQLDIIL.........-DN..N..IV.....E......GVTLAFPES......E......SP.....IV..AKH..................................................VDSAGQILLRDLQllp................dqspLTKKID.EFAANLERLATLDKLSIF.........PGLDC.QEAVAGIFESLERLYNWELAR...-.-----Vkeda..................amtgkPDVLLERTVQCSRSGRPAMH...ARDQVG........................LSLDYWAERHL..VPPKIPA..----.....----------.....................TETYC.ANA.....EQIWSIIVGCRPL.D...........GE......LYPPIRI......................SEDWISQKIEKTdpvp..............................tdllEPSNGPLLDWLEPAPTVlppasdn........................kavavevvQPDG.....TTQRYP...NVKFVATLNPPVIVPQAVCNALY.NLSG.AQPPPMML-..................P.SYTFDGISFP.IVDGQNHda......................................selRTISCERDVFVS-..........-----GA..PQRRRHENTL.F.VY...KP.VYG.......................................Q..--TIKA-------------------------------gqiyhh..................................................................................................................................................................
G8JS27_ERECY/10-185                  .........................................................................................................g-KMITRFVN...YKPGS....-ITLENITRLCQTMGL..ESFVD......................QVD....---TNISRLSIAS.KI.IVIDIDY........eTTD..G..KV.....I......DVKLVLASN......F......DK.....FD..YF-..................................................-NGNANILYRSLT.......................AYSDLH.EFHHNLKFLTLLDAYSSIdie...sttSQFDL.FEYYSVLPRYLQNY--LDDNN...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------tnlnvktnlndrfgiylvdpngdeigkltf..........................................................................................................................................
A0A093ZSP2_9PEZI/125-543             ........................................................................................................mq--IVDTLKG...V-KGR....-VSEDGIERLARSVGL..ECLWE......................TGM....GRGGKSKTLIIAG.TG.LSIDIEF.........-TD..N..IV.....E......TVTLGFPES......-......PE.....SV..TRH..................................................ADQAGKILLDDLKpgk................getvLTKRVD.RFADNLDRMARLDKLSVM.........PQLNC.HEAVAGIYDSLERL-------...HkWEVTKLteee..................amsgkTQDQIVRAALLKKSGRPAMN...AHGSVG........................LCLEYWQERHA..TSKGE--..----.....----------.....................-----.--D.....YKTWSLLLECDQS.S...........SM......VYPPVRV......................SSEWISPSVAKTnpta..............................ddllLSASDVVLDWQDPPNILlpsdpeqk......................ddsgmegieQSGQ....lPNQKFP...DVRFVAKFSPPLTLPYSAAMQIY.DSTG.AHLEPDA--..................-.LVAFDALVFP.PQTAEPSepd.....................................gahRRIRKEQLVSVY-..........--NHAGE..HEKQHHANTL.T.IP...KM.EYA.......................................L..--TLKEVPFSHPRELVQMLPILRQYARLSTLLERSF-g.......................................................................................................................................................................
S9W278_SCHCR/38-231                  ........................................................................................................nd---------...-----....-ISATGFEYLAKKYRL..DVFSD......................TSN....---SNEVVLSLAG.KI.ILIDVII.........PTN..G..SH.....K......DIKIALAFA......D......AT.....GE..QYK..................................................NTAAEDILQSAIH.......................-ENNTI.LLERNVALLAALDRCSPS.........VQQSC.FQYLEALKSAFNLIYASRLRS...-.------...........................QASSDETEIIMSAEGKPLND...NNGNLG........................LQLAFWKYQDS..LYTAKIS..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------mnelpsnslpsafyganlvs....................................................................................................................................................
A0A0L7LV46_9NEOP/69-219              ..........................................................................................................QKCLDSLQHc.iKVGSL....QSLIERLECLSRQLGL..KFV--......................---....-VGTSGVNLFISS.DM.FYLEIII.........E--..-..--.....-......---------......-......-Q.....QS..CEE..................................................-------LVQCIS.......................-QGDFA.DFTSQLEGLTAVYQLNAEk.......kVKCKA.FSALQSLEEDLCTMRQIQSFI..kDpWA----...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------qgllpltvdlltlgkpqassglaslv..............................................................................................................................................
L5JRK8_PTEAL/59-426                  .........................................................................................................v-SCLETLQKa.lKVTSL....PAMTDRLESIARQNGL..G-S--......................---....HLSASGTECYITS.DM.FYVEVQL.........DPA..G..QL.....C......DVKVAHHGE......-......NP.....VS..CPE..................................................-------LVQQLR.......................-EKNFD.EFSKHLKGLVNLYNLPGDn.......kLKTKM.YLALQSLEQDLSKMAVMYWKA...-.TN----...........................--AGPLDKILHGSVGYLTPR...SGGHL-........................MNLKYYASPSD..LLDDKTT..--SP.....IILHEN--NV.....................PRS--.-LG.....MNASVTIEGTSAMyKl........piAPl...imGSHPV--......................DNKWT-------......................................-------------PSFS.......................................SVTS.....ANSVDL...PACFFLKFPQPIPVSRAFVQKLQ.NCTG.IPLFETQP-..................T.YVPLYELITQ.-------...........................................---------FEL-..........--SKDPD..PIPLNHNMRF.Y.AA...--.LPGqqhcyflnk....................daplpdgrslQ..GTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVK........................................................................................................................................................................
F0ZLF9_DICPU/172-555                 ...............................................................................................qemtnelnqky---------...--STF....CVLEDLLSLLKENDSS..E-F--......................---....-NPESVYSCNISS.ST.FLLDIFI.........YGN..A..EI.....K......EVKLVHISL......L......SG.....ED..IPA..................................................EQEFNDQLTKSLS.......................--TDMK.DFIERVKRICELDLLFRK........yKTFDL.QKAFSIFQNDFLTISNLSKEK...Y.LNKELNl.........................iDKDKLLKNGF----GEIEL-...--DNCG........................VLIKYFNPYID..QLSK---..----.....----------.....................-----.--Q.....NQVYSLMIEMESG.A...........AI......SSAPN-D......................KSEYSKLSLKSQ......................................LSQGLTAESFNELLNCF.......................................DSNQs..epSETIVS...PVRLVCKLSQPLLITVDHLLKIL.NLTK.LSNNDQQQL.................iNlINSYN----S.SSNGNQDidiq..................................dnsnnNEYSIQTQLSNTNn........lESKHFDI..ELF-------.-.--...--.--Sktqryy...........................ytgnhnL..GLKINRIPITHPIQIFPIIQLLRQQHTFNILLKSCF-i.......................................................................................................................................................................
R9AIN4_WALI9/90-251                  .......................................................................................................vhs-----SLED...QSPSS....--LMTRIESAAKELGL..EAFQD......................HST....HAQFTVHTVTIAG.TI.LVIDVDLts.....spNQQ..P..SL.....T......RLQTSYATN......S......NS.....AL..EP-..................................................---IDKLLINDLNdfvapksdl.....sstestplrSERAFQ.RFKRNLHQLVLLDKLSQKl.......gNENDL.FVSFEALIKAFVDL-------...-.------...........................--------------------...------........................-----------..-------..----.....----------.....................-----.---.....-------------.-...........--......-------......................------------......................................-----------------.......................................----.....------...-----------------------.----.---------..................-.----------.-------...........................................-------------..........-------..----------.-.--...--.---.......................................-..-------------------------------------csaens..................................................................................................................................................................
#=GC seq_cons                        ...........................................................................................................thlphLpp...p.puh.....s.hptlEplupp.GL..p.h...................................ttpplhIuu.sh.hhl-lph..........ss..s...l.....p......cVplsatsp.............s.......s..stc.........................................................LhpsLp........................ppshs.cFstpLctLspL.pLsh...........phph.atAlpul.psLpcl.............p.....................................p.hh.tt.Gh.shp...ttsplG........................hsLpYahp.tp..lhptpt...................................................t......pshshh.tsps......................sh.sl........................spphhs..........................................................sh........................................t.st......ssh.....sspFhhchs.Pl.lshthhtpl..phss.h.h.tt.........................sh.tLlh............................................................h..h..............ttst.....ht+p.ph.h.h.......h.u............................................hlpclsFsHPtplstlLshLRp.shhssLltssh.........................................................................................................................................................................
//
DBGET integrated database retrieval system