#=GF ID   Microvir_lysis
#=GF AC   PF04517.11
#=GF DE   Microvirus lysis protein (E), C terminus
#=GF AU   Kerrison ND
#=GF SE   DOMO:DM04358;
#=GF GA   25.00 25.00;
#=GF TC   70.20 69.70;
#=GF NC   24.80 18.50;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 26740544 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   12100551
#=GF RT   The Escherichia coli FKBP-type PPIase SlyD is required for the
#=GF RT   stabilization of the E lysis protein of bacteriophage phiX174. 
#=GF RA   Bernhardt TG, Roof WD, Young R; 
#=GF RL   Mol Microbiol 2002;45:99-108.
#=GF DR   INTERPRO; IPR007605;
#=GF CC   E protein causes host cell lysis by inhibiting MraY, a
#=GF CC   peptidoglycan biosynthesis enzyme.  This leads to cell wall
#=GF CC   failure at septation [1]. The N terminal transmembrane region
#=GF CC   matches the signal peptide model and must be omitted from the
#=GF CC   family.
#=GF SQ   3
#=GS W9B137_9MYCO/1-26      AC W9B137.1
#=GS E_BPPHS/34-75          AC P03639.2
#=GS A0A0W1NG10_9ACTN/1-26  AC A0A0W1NG10.1
W9B137_9MYCO/1-26                 ----------------MASSVRLKPLNCSRLPCVYAQETLTF
E_BPPHS/34-75                     RPVSSWKALNLRKTLLMASSVRLKPLNCSRLPCVYAQETLTF
A0A0W1NG10_9ACTN/1-26             ----------------MASSVRLKPLNCSRLPCVYAQETLTF
#=GC seq_cons                     ................MASSVRLKPLNCSRLPCVYAQETLTF
//