GenomeNet

Database: Pfam
Entry: MotCF
LinkDB: MotCF
Original site: MotCF 
#=GF ID   MotCF
#=GF AC   PF09158.7
#=GF DE   Bacteriophage T4 MotA, C-terminal
#=GF AU   Sammut SJ
#=GF SE   pdb_1kaf
#=GF GA   25.00 25.00;
#=GF TC   29.40 229.80;
#=GF NC   19.60 18.50;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 11927849 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   11918797
#=GF RT   The MotA transcription factor from bacteriophage T4 contains a
#=GF RT   novel DNA-binding domain: the 'double wing' motif. 
#=GF RA   Li N, Sickmier EA, Zhang R, Joachimiak A, White SW; 
#=GF RL   Mol Microbiol. 2002;43:1079-1088.
#=GF DR   INTERPRO; IPR015241;
#=GF DR   SCOP; 1kaf; fa;
#=GF CC   Members of this family adopt a compact alpha/beta structure
#=GF CC   comprising three alpha-helices and six beta-strands in the
#=GF CC   order: alpha1-beta1-beta2-beta3-beta4-alpha2-beta5-beta6-alpha3.
#=GF CC   The beta-strands form a single anti-parallel beta-sheet and the
#=GF CC   three alpha-helices pack side-by-side onto one surface of the
#=GF CC   beta-sheet. In this architecture, the domain's hydrophobic core
#=GF CC   is at the sheet-helix interface, and the second surface of the
#=GF CC   beta-sheet is completely exposed. The domain is a DNA-binding
#=GF CC   motif, with a consensus sequence containing nine base pairs
#=GF CC   (5'-TTTGCTTTA-3'), that appears to bind to various mot boxes,
#=GF CC   allowing access to the minor groove towards the 5'-end of this
#=GF CC   sequence and the major groove towards the 3'-end [1].
#=GF SQ   1
#=GS MOTA_BPT4/106-208  AC P22915.1
#=GS MOTA_BPT4/106-208  DR PDB; 1KAF B; 106-208;
#=GS MOTA_BPT4/106-208  DR PDB; 1KAF E; 106-208;
#=GS MOTA_BPT4/106-208  DR PDB; 1KAF F; 106-208;
#=GS MOTA_BPT4/106-208  DR PDB; 1KAF A; 106-208;
#=GS MOTA_BPT4/106-208  DR PDB; 1KAF D; 106-208;
#=GS MOTA_BPT4/106-208  DR PDB; 1KAF C; 106-208;
MOTA_BPT4/106-208             ITSDMEEDKDLMLKLLDKNGFVLKKVEIYRSNYLAILEKRTNGIRNFEINNNGNMRIFGYKMMEHHIQKFTDIGMSCKIAKNGNVYLDIKRSAENIEAVITVA
#=GR MOTA_BPT4/106-208  SS    --HHHHHHHHHHHHHHHHTT--EEEEEEETTEEEEEEEEEETTEEEEEEETTSEEEEEEES--HHHHHHHHHTT-EEEE-TTSEEEEEEE--HHHHHHHHHHH
#=GC SS_cons                  --HHHHHHHHHHHHHHHHTT--EEEEEEETTEEEEEEEEEETTEEEEEEETTSEEEEEEES--HHHHHHHHHTT-EEEE-TTSEEEEEEE--HHHHHHHHHHH
#=GC seq_cons                 ITSDMEEDKDLMLKLLDKNGFVLKKVEIYRSNYLAILEKRTNGIRNFEINNNGNMRIFGYKMMEHHIQKFTDIGMSCKIAKNGNVYLDIKRSAENIEAVITVA
//
DBGET integrated database retrieval system