GenomeNet

Database: Pfam
Entry: Mpt_N
LinkDB: Mpt_N
Original site: Mpt_N 
#=GF ID   Mpt_N
#=GF AC   PF09176.9
#=GF DE   Methylene-tetrahydromethanopterin dehydrogenase, N-terminal
#=GF AU   Sammut SJ
#=GF SE   pdb_1lu9
#=GF GA   19.10 19.10;
#=GF TC   20.30 66.60;
#=GF NC   18.70 17.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   12176390
#=GF RT   Structure of methylene-tetrahydromethanopterin dehydrogenase
#=GF RT   from methylobacterium extorquens AM1. 
#=GF RA   Ermler U, Hagemeier CH, Roth A, Demmer U, Grabarse W, Warkentin
#=GF RA   E, Vorholt JA; 
#=GF RL   Structure. 2002;10:1127-1137.
#=GF DR   INTERPRO; IPR015259;
#=GF DR   SCOP; 1lu9; fa;
#=GF CC   Members of this family adopt a alpha-beta structure, with a core
#=GF CC   comprising three alpha/beta/alpha layers, in which each sheet
#=GF CC   contains four strands. They are predominantly found in
#=GF CC   prokaryotic methylene-tetrahydromethanopterin dehydrogenase,
#=GF CC   which catalyses the dehydrogenation of
#=GF CC   methylene-tetrahydromethanopterin and the reversible
#=GF CC   dehydrogenation of methylene-H(4)F [1].
#=GF SQ   102
#=GS H0HRA4_9RHIZ/10-90      AC H0HRA4.1
#=GS I1YK93_METFJ/2-50       AC I1YK93.1
#=GS C6WWF3_METML/18-98      AC C6WWF3.1
#=GS C5CPW4_VARPS/18-98      AC C5CPW4.1
#=GS B8EIJ6_METSB/17-97      AC B8EIJ6.1
#=GS Q0BW54_GRABC/17-97      AC Q0BW54.1
#=GS A0A0F3IJX1_9GAMM/18-98  AC A0A0F3IJX1.1
#=GS C0N5L4_9GAMM/10-90      AC C0N5L4.1
#=GS V5SF42_9RHIZ/19-99      AC V5SF42.1
#=GS V5SB86_9RHIZ/66-144     AC V5SB86.1
#=GS A0A0A8K3Y2_9RHIZ/18-98  AC A0A0A8K3Y2.1
#=GS I1XGE1_METNJ/18-98      AC I1XGE1.1
#=GS A0A0K8P4Z4_9BURK/18-98  AC A0A0K8P4Z4.1
#=GS D7DIQ1_METV0/18-98      AC D7DIQ1.1
#=GS I9W7D9_9RALS/18-98      AC I9W7D9.1
#=GS B1LVZ4_METRJ/17-97      AC B1LVZ4.1
#=GS A0A0D6JB88_9RHIZ/19-99  AC A0A0D6JB88.1
#=GS I3CEJ8_9GAMM/18-98      AC I3CEJ8.1
#=GS F9ZXB9_METMM/17-97      AC F9ZXB9.1
#=GS B8IK69_METNO/16-96      AC B8IK69.1
#=GS G7ZC35_AZOL4/18-98      AC G7ZC35.1
#=GS I0HWH2_RUBGI/18-98      AC I0HWH2.1
#=GS E8TE75_MESCW/18-98      AC E8TE75.1
#=GS G3IYH3_9GAMM/18-98      AC G3IYH3.1
#=GS F5RAW2_METUF/18-98      AC F5RAW2.1
#=GS G3ITU5_9GAMM/16-96      AC G3ITU5.1
#=GS A0A0F3INZ4_9GAMM/16-96  AC A0A0F3INZ4.1
#=GS H0Q595_9RHOO/18-98      AC H0Q595.1
#=GS MTDB_METEA/17-97        AC O85012.1
#=GS A0A0J6RNJ1_9RHIZ/17-97  AC A0A0J6RNJ1.1
#=GS E1TEW9_BURSG/30-110     AC E1TEW9.1
#=GS A0A0K8P219_9BURK/16-96  AC A0A0K8P219.1
#=GS A6C5L4_9PLAN/16-96      AC A6C5L4.1
#=GS Q0G4J9_9RHIZ/17-97      AC Q0G4J9.1
#=GS Q60BG9_METCA/16-96      AC Q60BG9.1
#=GS C6XDX4_METGS/23-103     AC C6XDX4.1
#=GS H8GH98_METAL/18-98      AC H8GH98.1
#=GS F5SZ75_9GAMM/18-98      AC F5SZ75.1
#=GS D5SWH3_PLAL2/16-96      AC D5SWH3.1
#=GS F5SZ77_9GAMM/16-96      AC F5SZ77.1
#=GS Q7UF75_RHOBA/31-111     AC Q7UF75.1
#=GS Q1H0Q9_METFK/18-98      AC Q1H0Q9.1
#=GS G4SX06_META2/18-98      AC G4SX06.1
#=GS D2R6M8_PIRSD/18-98      AC D2R6M8.1
#=GS D5C3H9_NITHN/18-98      AC D5C3H9.1
#=GS C0N5L2_9GAMM/16-96      AC C0N5L2.1
#=GS L0DKD0_SINAD/20-100     AC L0DKD0.1
#=GS H8GPW2_METAL/16-96      AC H8GPW2.1
#=GS D5WEW5_BURSC/22-102     AC D5WEW5.1
#=GS A0A0F7JUF5_9GAMM/18-98  AC A0A0F7JUF5.1
#=GS Q602P5_METCA/18-98      AC Q602P5.1
#=GS G4SX05_META2/18-98      AC G4SX05.1
#=GS H5WKF8_9BURK/18-98      AC H5WKF8.1
#=GS G4T3T0_META2/16-96      AC G4T3T0.1
#=GS A0A0F3IKA4_9GAMM/10-90  AC A0A0F3IKA4.1
#=GS J7QMP3_METSZ/112-192    AC J7QMP3.1
#=GS G3IYH4_9GAMM/18-98      AC G3IYH4.1
#=GS G8MDS4_9BURK/22-102     AC G8MDS4.1
#=GS E8R414_ISOPI/27-107     AC E8R414.1
#=GS F0SMF6_RUBBR/16-96      AC F0SMF6.1
#=GS A3ZL36_9PLAN/18-98      AC A3ZL36.1
#=GS F9ZYK4_METMM/18-98      AC F9ZYK4.1
#=GS B1Y0Z5_LEPCP/18-98      AC B1Y0Z5.1
#=GS I1YK95_METFJ/16-96      AC I1YK95.1
#=GS D5C3H7_NITHN/16-96      AC D5C3H7.1
#=GS A2SKX3_METPP/16-96      AC A2SKX3.1
#=GS Q1YFY0_AURMS/18-98      AC Q1YFY0.1
#=GS E4RM55_HALHG/16-96      AC E4RM55.1
#=GS Q0BU29_GRABC/18-98      AC Q0BU29.1
#=GS N0BBB6_9RHIZ/57-137     AC N0BBB6.1
#=GS B0UF34_METS4/17-97      AC B0UF34.1
#=GS F8J8U4_HYPSM/19-99      AC F8J8U4.1
#=GS G2DX02_9GAMM/18-98      AC G2DX02.1
#=GS N6X948_9RHOO/18-98      AC N6X948.1
#=GS A0A0F2SA91_9FIRM/16-96  AC A0A0F2SA91.1
#=GS G8AVD0_AZOBR/1-76       AC G8AVD0.1
#=GS D5MJU9_9BACT/20-100     AC D5MJU9.1
#=GS J7Q829_METSZ/17-97      AC J7Q829.1
#=GS B0UC59_METS4/17-97      AC B0UC59.1
#=GS B2JVN5_BURP8/3-83       AC B2JVN5.1
#=GS A0A0M2TZR0_9FIRM/16-96  AC A0A0M2TZR0.1
#=GS A2SJ22_METPP/18-98      AC A2SJ22.1
#=GS F9ZZ74_METMM/16-96      AC F9ZZ74.1
#=GS I1XGE3_METNJ/16-96      AC I1XGE3.1
#=GS G7ZAQ6_AZOL4/18-98      AC G7ZAQ6.1
#=GS N0B330_9RHIZ/19-99      AC N0B330.1
#=GS B2JX35_BURP8/22-102     AC B2JX35.1
#=GS A7IG89_XANP2/19-99      AC A7IG89.1
#=GS Q13QS9_BURXL/26-106     AC Q13QS9.1
#=GS A0A0A8K9M5_9RHIZ/16-96  AC A0A0A8K9M5.1
#=GS F5R8M3_METUF/16-96      AC F5R8M3.1
#=GS A0A0B4XGN3_9RHIZ/10-90  AC A0A0B4XGN3.1
#=GS B1LV94_METRJ/17-97      AC B1LV94.1
#=GS H8GH97_METAL/18-98      AC H8GH97.1
#=GS F9ZYK3_METMM/18-98      AC F9ZYK3.1
#=GS A0A0J6REW2_9RHIZ/16-96  AC A0A0J6REW2.1
#=GS Q602P4_METCA/10-90      AC Q602P4.1
#=GS F5RC91_METUF/45-125     AC F5RC91.1
#=GS I4BWW3_ANAMD/16-96      AC I4BWW3.1
#=GS D7A5F9_STAND/19-99      AC D7A5F9.1
#=GS MTDA_METEA/17-97        AC P55818.3
#=GS MTDA_METEA/17-97        DR PDB; 1LUA A; 17-97;
#=GS MTDA_METEA/17-97        DR PDB; 1LU9 B; 17-97;
#=GS MTDA_METEA/17-97        DR PDB; 1LU9 C; 17-97;
#=GS MTDA_METEA/17-97        DR PDB; 1LUA B; 17-97;
#=GS MTDA_METEA/17-97        DR PDB; 1LUA C; 17-97;
#=GS MTDA_METEA/17-97        DR PDB; 1LU9 A; 17-97;
#=GS B8ITX1_METNO/17-97      AC B8ITX1.1
H0HRA4_9RHIZ/10-90                 .PFDVNMALDAGFDAVVPYVDVSLGDVTSLVQDAIFSRPPDAGVNTGIFIAGRDVSLSLDMFDAAKKAMVPPFQVSVFADPA.
I1YK93_METFJ/2-50                  r---------------------------------FFSRGPAGVKKTGMFIGGRDIGLAMDMLDAAKKAMSPPFEISVMADPS.
C6WWF3_METML/18-98                 .PFDVNMAFDAGFDKVVPYTNVELSEVTGLTQDAIFSRGLSGVKREAIFIGGRDIDLAMDMLNTAKKAMFAPFACSAFADPS.
C5CPW4_VARPS/18-98                 .PFDINMAADAGYQIIVPYCEVGLDRITGLTQDTIFSRGPKGVARTGIFIGGRDAQLAADMLERARTSMVKPFVVSAMADPS.
B8EIJ6_METSB/17-97                 .PFDVNMALDAGYDSVTPYTGVTLDEVTALVQDAMFSRSPRDAVRTGVFIAGKDAGLALDMLERFKATLLKPFEISAFADPA.
Q0BW54_GRABC/17-97                 .VFDSVVAYDGGADHVIGHANVTPENVGALVDGAIFTRGPKEKRFTALWIGGGSMEAGEAVLSAVKKKFFGNFRVSVMLDSN.
A0A0F3IJX1_9GAMM/18-98             .PFDVNMAIDAGFDVLVPYSNVKLDSVYGLTQDAIFSRGPSGVKRTALFIGGRDFGLAMDMLKATGQAMVPPFEISVLADPS.
C0N5L4_9GAMM/10-90                 .PFDINMALDAGYDVLMPYQHVKLEEVSGLTQDAIFSRGPSGVKKTGMFIGGRDIGLAMDMLDAAKKAMVPPFEISVFADPS.
V5SF42_9RHIZ/19-99                 .PFDVNMAADAGYKVIVPYINVTLEEVTPLVQDAIFSRPPDYGTRTGVFIGGKDAILSLDMLEAARKAQVPPFQLSVVADPA.
V5SB86_9RHIZ/66-144                .PFDCNMAVDSGFKVVLPYDNVAVGDVAGLVQDAIFSRPP--GARTGVFIGGKDVTLALDMMKAARAAMVPSFEVSVFADP-g
A0A0A8K3Y2_9RHIZ/18-98             .PFDINMGIDAGYDHAIPYTNATIEDIYGLVQDAIFSRSPEGIKRQAVFIGGKRAIESLDMMDKAKKAMVPPFEVSVFADPA.
I1XGE1_METNJ/18-98                 .PFDINMALDAGYDIIMPYNNVELNEVASLTQDAIFSRGPSGVKKTGMFIGGRDIGLAMDMLDAAKSAMVPPFEIPVFADPS.
A0A0K8P4Z4_9BURK/18-98             .PFDVNMAADAGYQVITPYCGVTLEQVTGLTQDAIFSRGPKGVARTGIFIGGRDVLLAADMLERARAALVPPFQVSLFADPS.
D7DIQ1_METV0/18-98                 .PFDVNMAIDAGFDQVIPYTNVALSEVVGLTQDAIFSRSPSGIKRESIFIGGRDIDLAMDMLGAAEKAMFPPFEISVFADPS.
I9W7D9_9RALS/18-98                 .PFDVNMGVDAGYEVAVPYCEVGMDNIVAMTQDAIFSRGPKGVASTGIFIGGRDVVMAADMLALARGAMVPPFEVPVFADPS.
B1LVZ4_METRJ/17-97                 .VFDTVVGYDGGADHITGYGGVNPDNVGALVDGTIYTRGGSEKKSTAIFVGGGSMAAGEELFTAVKKRFFGPFRVSVMLDSN.
A0A0D6JB88_9RHIZ/19-99             .PFDVNMAADAGYKVITPYLNVTLEEVTGLVQDAIFSRPPASGVRTGVFIGGKDALLALDMLKATKEAMVPPFELSAFADPA.
I3CEJ8_9GAMM/18-98                 .PFDVNMAIDAGFEHIIPYTSVEVSEIAGLVQDAIFSRGPKGVKRTGIFIGGRDIAVADDMLRQAKQAMVPPFEASVMLDPS.
F9ZXB9_METMM/17-97                 .PFDVTIAADAGYNQILPITNIKSSQVADMVQDAIFARPPKRFNDTGIFIGGRDVHLAADMFQYAKKAMVGDFKVGVFADPN.
B8IK69_METNO/16-96                 .VFDTVVGYDGGADNITGYGNVTPENVGALVDGTIYTRGGSEKKSTAIFVGGGSMAAGEAVFEAVKKRFFGPFRVSSMLDSN.
G7ZC35_AZOL4/18-98                 .PFDINMACDAGYGVVVPYTNVETGEVPGLVQDMIFSRAPGDAKRTGLFIAGRDILKALDMLEAARGAMVPPFEISVFADPS.
I0HWH2_RUBGI/18-98                 .PFDVNMAADAGYQLVVPYGEVGLDAVAGMTQDAIFSRGPKGVARTGIFIGGRDALLAADMLKKAQAAMVKPFVVSLMADPS.
E8TE75_MESCW/18-98                 .PFDVNMALDAGFDAVVPYVDVGLAEVTGLVQDAIFSRPPDAGVDTGIFIAGKDASLALDMFDAAKKAMVPPFQVSVFADPA.
G3IYH3_9GAMM/18-98                 .PFDINMALDAGFDVLIPYNNVKLDSVYGLTQDATFSRSPSGVKRTGIFIGGRDLGLAMDMLNTSKQAMVSPFEISVFADPS.
F5RAW2_METUF/18-98                 .PFDVNMACDAGFQVLMPYSGVGLDQIYGLTQDAIFSRGPNGVKRTGIFIGGRDIGMAADMLDACRGAMVPPFEVSVFADPS.
G3ITU5_9GAMM/16-96                 .VFDTVVAYDGGADHVIGHGGLTPENITALVEGTIFTRAPKDKKNTAIFVGGSDMIAGQALFTAVQKHFFPGFQVSVMLDSN.
A0A0F3INZ4_9GAMM/16-96             .VFDTVVGYDGGADHVIGYGGITPDNVKALVEGAIFTRAPKDKKNTAIFVGGSDMAKGQTLFNAVQSHFFPGFQVSVMLDSN.
H0Q595_9RHOO/18-98                 .PFDINMAVDAGYDVVVPYCRVTAEEIRGLTQDAIFSRGPKGVKATGIFIGGRNVIAASDMLETARAAMVPPFEVSVMADPS.
MTDB_METEA/17-97                   .PFDVNMAIDAGFETLIPYTGVDLTDVVSLTQDSIFSRAPQDGVRTGIFIGGKNAELALDMVDRAKKAFVPPFVNHVFADPA.
A0A0J6RNJ1_9RHIZ/17-97             .PFDVNMAVDAGFEVVSTYTAVEPGEVVPLVQDSIFSRAPQDGTRTAIFIGGKNAEASLDMVDAATSAFVPPFANHVFADPA.
E1TEW9_BURSG/30-110                .PFDVNMAADAGYQVIVPYCNVDAGMVGNLTQDAIFSRGPKGVARTGIFIGGRDVMLAADMLDTARKAMVPPFEVSVFADPS.
A0A0K8P219_9BURK/16-96             .VFDNVVAYDGGADHVTAYGGVTPANVGPLVDGAIFTRAPKDKKSTAIFVGGSDMAAGEALFAAVRAKFFAGFRVGTMLDSN.
A6C5L4_9PLAN/16-96                 .SFDRVVAIDAGVDELMSYSDVTPVNVESLVHGAMFTRGPKELNNTAIFVGGSEVHSGETLFQKIQDTFFGPMRVSVMMDSN.
Q0G4J9_9RHIZ/17-97                 .PFDVNQALDAGYDSVTPYENVELDEVSDLVQDVIFSRPPDHGVNSAMFFGGDDAVLALDMIDAAKGALVPPFTCNLMADPA.
Q60BG9_METCA/16-96                 .VFDTVVGYDGGADQVIAHGHLTPDNVGPLVEGTIFTRAPKDKKNTAIFVGGSDLVAGQNLLRAVRKKFFADFRVSVMLDSN.
C6XDX4_METGS/23-103                .PFDVNMAYDAGYDAIAQYTNVQLSEVTGLVQDAIFSRGPRGVWRTGMLIGGRDVDLAMDMLETAKKSMVPPFEISVFADPS.
H8GH98_METAL/18-98                 .PFDINMAVDAGFDVLIPYSNVKLDNVNGLAQDAIFSRGPSGVKRTAIFIGGRDIGLAIDMLAACRRAMVPPFEISVLADPS.
F5SZ75_9GAMM/18-98                 .PFDINMALDAGYDVLIPYSHVELSEVAGLTQDAIFSRGPSGVKKTGMFIGGRDIGLAMDMLDSAKKSMVPPFEISVFADPS.
D5SWH3_PLAL2/16-96                 .VFDRVVAVDAGVDELFSYGSVSPEAAVGLTHGAIFTRKVADLKSTAIFVGGSDVQAGEAVYAKVLHSFFGPMRVSVMLDSN.
F5SZ77_9GAMM/16-96                 t-FDQAVAYDAGVDNIIAHGGATRDNVTPHVHGMIFTRGGKNLKNSAIFIGGSNVPASDLVGKAVKKAFFGPVSVSVMLDPN.
Q7UF75_RHOBA/31-111                .SFDSVVAVDAGVDHLLQYGNVQSEAVESLVHGAMFTRGGDDLKNSALFIGGNDVVKAEAIFRSVQKAFFGPVRVSVMLDAS.
Q1H0Q9_METFK/18-98                 .PFDVNMAFDAGFDKIVPYTNVELKEVTGLVQDAIFSRSPSGVKRESIFIGGRDIDVAMDMLETARKAMVPPFEVSVFADPS.
G4SX06_META2/18-98                 .PFDVNMALDAGWVSAIPYINVEPSEVRGLVQDAIFSRSPKSLKKTGIFIGGRDTKQALDMLKTAKNSMVPPFEVSVFADPS.
D2R6M8_PIRSD/18-98                 .VFDAVVAVDSGVDHLLQYRGVTPGQVRDLVHGCIFTRGGADLAATAIFVGGSQIAAGEALLGEVLASFFGPMRVSVMLDAS.
D5C3H9_NITHN/18-98                 .PFDINMAVDAGFEVIVPYPHVKLEEINGLVQDTIFSRGPGGVKRTAIFMGGRDIGLALEMLEAAKKAMVPPFEVSILVDPS.
C0N5L2_9GAMM/16-96                 t-FDQAVAYDSGVDNIIAYGGATRDNVTPHVHGMIFTRGGKSLKNSAIFIGGSNVAASDLVGEAVKKAFFGPVRVSVMLDPN.
L0DKD0_SINAD/20-100                .VFDGVVAVDSGVEHLFRHGGVQPDAVRDLVYGALFTRGPADLQRTAIFVGGSNVAVGEAILKEVTKTFFANFRVSVLFDAN.
H8GPW2_METAL/16-96                 .VFDTVVAYDGGADHVTGFGGLTPDTISGLVEGAIFTRPPKDKKNTAIFIGGSDMIAGQDLLKAVQSKFFPGFQVSVMLDSN.
D5WEW5_BURSC/22-102                .PFDVNMAADAGYQVIVPYCNVEAGMVANLTQDAIFSRGPKGVSRTGIFIGGRDVMQAVDMLDTARKAMVPPFEVSVFADPS.
A0A0F7JUF5_9GAMM/18-98             .PFDVNMAIDAGWKHCIPYTGLQVSQVADFTQDAIFSRGPKGVKRTGIFIGGRDIHHAMDMLEAARKAMVPPFEVSVFADPS.
Q602P5_METCA/18-98                 .PFDINMAVDAGFEVIVPYSNVKAEEVHGLVQDAIFSRGPAGVKRTGIFIGGRDLAVALTMLETAKGAMVPPFEVSVLADPS.
G4SX05_META2/18-98                 .PFDVNMALDAGFDVLIPYSNVKLDGVHGLTQDAIFSRGPNGVKRTGLFIGGRDIGLAIDMLSAAEQAMVPPFEISVFADPS.
H5WKF8_9BURK/18-98                 .PFDVNMAADAGYQLIMPYTGVSLDAISGLTQDAIFSRGPKGVARTGIFIGGRDVALAADMAQRAVAAMVPPFVVSVMADPS.
G4T3T0_META2/16-96                 a-FDTIVAYDGGADHVIGHGGLTPDTIAPLVEGTIFTRAPKDKKNTAIFVGGSDMLAGQQLFSAVQKHFFPGFQVSIMLDSN.
A0A0F3IKA4_9GAMM/10-90             .PFDVNMAMDAGWVTAIPYINVEPSEVQGLVQDAIFSRSTKNLKRTGIFIGGRDTKQAMDMLKTAKRSMVPPFEVSVFADPS.
J7QMP3_METSZ/112-192               .PFDVNMALDAGYDAAIPYTNVTLDEVTALVQDAMFSRAPSAALRTGIFFAGRDAVLALDMMDKAKKALLKPFEVSLFADP-y
G3IYH4_9GAMM/18-98                 .PFDVNMALDAGWVSALPYINVEPSEVQGLVQDAIFSRSPKNLKRTGIFIGGRDTKQAMDMLNTAKRSMFAPFEVSVFADPS.
G8MDS4_9BURK/22-102                .PFDVNMAADAGYQILVPYCNVGEDSVVQLTQDAIFSRGPKGVSRTGIFIGGRDVMLAADMLERARNAMVPPFEVSVFADPS.
E8R414_ISOPI/27-107                l-FDAVVGIDAGVDHLLRYGGVTVSQVRDLVHGAIFTRGPADLKRTAIFVGGSDVDAAERLMEAVHAAFFSDFRVSTMLDPN.
F0SMF6_RUBBR/16-96                 .SFDAVTAIDAGVDQLLSYSNVTPSNVNPLVQGGIFTRSPEDLKNTAAFVGGSNVDEGEQVLKSVLDCFFGPMRVSVMMDSN.
A3ZL36_9PLAN/18-98                 t-FDSVVAVDSGVDQLFRHGGVSAAQVRDLVYGLIFTRSPAELKSSAIFIGGSDVAQAETLLSAAVGSFFGPLRVSILFDPN.
F9ZYK4_METMM/18-98                 .PFDINMALDAGFDVLMPYSNVKLENIQNLTQDAIFSRSPSGIKKTGIFIGGRDIGLAIDMLQATKPAMVPPFEVSVFADPS.
B1Y0Z5_LEPCP/18-98                 .PFDINMAADAGWQVITPYCNVALSAIGALTQDTIFSRSPKGLARTGIFIGGRDALLAADMLEAARKAMFKPFQVSLMADPS.
I1YK95_METFJ/16-96                 t-FDQAVAYDSGVDNIIAHGNATRDNVTSHVHGMIFTRGGKNLKNSAIFIGGSNVAASDRVGDAVKNAFFGPVRVSVMLDPN.
D5C3H7_NITHN/16-96                 .VFDQVVAYDSGVDHIMSYGGVTPDKVEGLVHGLMFTRGGKQLANSAIFLGGSHVSDSQQLAEAVKKCFFGSVRVSVMLDPN.
A2SKX3_METPP/16-96                 .VFDNVVAYDGGADHVTAYGGITPANVGGLVDGAIFTRAPKDKKNTAIFVGGSNMADGEALFKAVRKKFFANFRVSVMLDSN.
Q1YFY0_AURMS/18-98                 .PFDVNMALDAGYDAVLPYESVEMAEVADLVQDVIFSRPPDRGVRSAVFFGGNDSVLALDMIAAAKDALVPPFGCNIMADPS.
E4RM55_HALHG/16-96                 t-FDQVVAYDAGVDNIIAHSGITKEEVEDIIYGAIFTRSAKKLKNTAVFIGGSDVEAGEEIMKAVKDVFFANYSISTMLDSN.
Q0BU29_GRABC/18-98                 .PFDVNMALDAGFDAVIPYVDVTNDQVNGLVQDAIFSRPPRLGPKTGIFIAGRNAGQALDWIDESKKALVPPFGCSVYADPA.
N0BBB6_9RHIZ/57-137                .PFDVNMAVDAGYKVVVPHTGVRLNDTRALVQDAIFSRPPHYGCRTAMFIGGKDALLALDMLAVAKTSLVPPFQLSVLADP-g
B0UF34_METS4/17-97                 .PFDVNMAVDAGFEVVTAYTGVTLTEVGPLVQDSIFSRAPQDGARTGLFIAGKNAEDALDMVDRARKAFVPPFVNHVFADPA.
F8J8U4_HYPSM/19-99                 .PFDVNMAADAGYKVIIPYINVELAEVTGLIQDAIFSRPPNYGVRTGFFMGGKDAILALDMLEAAKKAMVPPFECSCFADPA.
G2DX02_9GAMM/18-98                 .PFDVNMACDAGWTVCVPYLQVALDEVPGLVQDAIFSRGPKGVKRTGLFLGGRDINLANDMLDAARGAMVPPFEVSVLADPS.
N6X948_9RHOO/18-98                 .PFDINMAVDAGYQVVVPYCGVSLDEITGLTQDAIFSRGPKGVKATGIFIGGRDVMLAADMLARARKAMVPPFEVSVIADPS.
A0A0F2SA91_9FIRM/16-96             .VFDQITAYDAGADQVLAYGGVQLEEVANLVYGAIFTRGGEGLRNTAVFIGGTQVPTAEKLMRKVLDTFFADFRVSVMFDAN.
G8AVD0_AZOBR/1-76                  .-----MAADAGMGPLFPYTGVALEEVTGITQDAMFSRDPANAARTGLFIGGRDAVLALDMMDAARKAMFAPFTISVMVDPS.
D5MJU9_9BACT/20-100                .PFDINMAYDAGFHAVIPYGGVNEESAVLLVQDIIFSRGPKGAKFSALFIGGNDIDSAERVRQAAAKSMFPPFQVSMMIDP-k
J7Q829_METSZ/17-97                 .VFDTVVGYDGGADHIIGYGAVTPENVGALVDGCIYTRGPKEKQCTAIFVGGGSMTAGEAVFKAVKKRFFSNFRVSAMLDSN.
B0UC59_METS4/17-97                 .VFDTVVGYDGGADNITGYGGVTPESVGALVDGTIYTRGGSEKKSTAIFVGGGSMAAGEAVFEAVKKRFFGPFRVSAMLDSN.
B2JVN5_BURP8/3-83                  .PFDVNMAVDAGYQVVVPYTDVDAKLIGPLTQDAIFSRGPKGVAHTGIFIGGRDVMLATDMLRLSREAMVPPFEVSVFADPS.
A0A0M2TZR0_9FIRM/16-96             .VFDQVVAYDAGVDHVISLSGVRREDVTPLVHGAMFTRGGDKLKNTAIFIGGSDVTRGEELLAETMHTFFGPVRVSVMHDSN.
A2SJ22_METPP/18-98                 .PFDINMAADAGYQLLPTYSEVTLDGVTGLTQDAIFSRGPKGVARTGLFIGGRDVLLAADMLDAARKAMVKPFVVSVMADPS.
F9ZZ74_METMM/16-96                 .VFDTVVAYDGGADHVIGHGGLTPDSIGGLVEGCIFTRAPKDKKNTAIFIGGSNMIAGQNLLAAVQAHFFPGFQVSVMLDSN.
I1XGE3_METNJ/16-96                 t-FDQAVAYDSGVDNIIAHGGATRDNVTAHVHGMIFTRGGKNLKNSAIFIGGSNVTASELVGEAVKKAFFGPVRVSVMLDPN.
G7ZAQ6_AZOL4/18-98                 .PFDVNMAMDAGIDMVVPYTGIETAQVEALTQDAMFSRDPKNAARTGLFIGGRDAAMALDMLDVARKAMFPPFQISVFADPS.
N0B330_9RHIZ/19-99                 .PFDVNMAADAGYKVIVPYINVELNEVAGLIQDAIFSRPPNYGVRTGFFMGGKDAILALDMLDAAKKAMVPPFECSVFADPA.
B2JX35_BURP8/22-102                .PFDVNMAADAGYQILVPYCEVDVRNVVQLTQDAIFSRGPKGVSRTGIFIGGRDVMLAADMLDRAREAMVPPFEVSVFADPS.
A7IG89_XANP2/19-99                 .PFDVNMAVDAGYTTIAPYSRVALSEVRDLTQDMMFSRAPQSAPRTGLFIGGKDAALALDMAAEAKASIFPPFEISIFPDPA.
Q13QS9_BURXL/26-106                .PFDVNMAADAGYQIIVPYCGVEAGMVANLTQDAIFSRGPKGVSRTGIFIGGRDVMLAADMLDSARKAMVPPFEVSVFADPS.
A0A0A8K9M5_9RHIZ/16-96             i-FDTVVGYDGGADNVTGYAAVTPDNVGALIDGCIYTRGGKDKQNTAIFVGGGNMAKGEELFETVKKHFFGPFRVSVMLDSN.
F5R8M3_METUF/16-96                 .VFDSVVCHDGGADHVIGYGGVHPHNVGAMVDGTIFTRAPKDKKNTAIFIGGSNMAEGETLFKAVKKRFFGNFRVSVMLDSN.
A0A0B4XGN3_9RHIZ/10-90             .PFDVNMALDAGYDHVVPYTDVALADIAGLVQDAVFSRPPDAGVATGIFIAGRDTILALDMIDAAKQAMVPPFEVSVFADPA.
B1LV94_METRJ/17-97                 .PFDVNMAVDAGFETVVTYTEVSLADVVSLTQDSIFSRSPADGTRTGIFIGGKNAEDALDMVDRAKKAFVPPFVNHVFADPA.
H8GH97_METAL/18-98                 .PFDVNMAMDAGWVSAVPYINVEPSEVQGLVQDAIFSRSAKNLKRTGIFIGGRDTKQAMDMLKIAKRSMVPPFEVSVFADPS.
F9ZYK3_METMM/18-98                 .PFDVNMAMDAGWIQAVPYINVEPSEVRGLVQDAIFSRSPKGLKRTAFFIGGRETKQAMDMLKMAKNSMFPPFEVSVFADPS.
A0A0J6REW2_9RHIZ/16-96             .VFDVVVGYDGGADIITGYPNVTPENVGALVDGTIYTRGGAEKKSTAIFVGGGSMAAGEAVFKAVRKRFFGPFRVSCMLDSN.
Q602P4_METCA/10-90                 .PFDANMALDAGWLSLVPYTNLEAGEITALVQDAIFSRSPAGVKRTAVFIGGRDVGTAMAMLRTARKSMVPPFEISAFADPS.
F5RC91_METUF/45-125                .PFDVTIAADAGFDLVIPLTGIRPENVTALVQDAIFCRPPNRFNDTGIFIGGRDVHMATDMFQSARGAMVGEFKVGVFADPN.
I4BWW3_ANAMD/16-96                 .VFDAVTAYDAGADVVLQYGNVTTENVVDLVYGVMFTRGGDKLKYSAIFIGGSNVSRASEILDVVKKTFFGNVRNSVMFDPS.
D7A5F9_STAND/19-99                 .PFDVNMAVDAGYTTILPYSNVTLDEIADLTQDMMFSRHPDAAPRTGLFIGGKDASLALDMADKAKSVLFPPFEISLFVDPA.
MTDA_METEA/17-97                   .VFDVVVGYDGGADHITGYGNVTPDNVGAYVDGTIYTRGGKEKQSTAIFVGGGDMAAGERVFEAVKKRFFGPFRVSCMLDSN.
#=GR MTDA_METEA/17-97        SS    .HHHHHHHHHTT-SEEEEESS--TTTHHHHHHHHHSSS-GGGGGGEEEEEE-S-HHHHHHHHHHHHHH-BTTB--EEEE-CC.
B8ITX1_METNO/17-97                 .PFDVNMAVDAGFEVVTAYTGVSLAEVGPLVQDSIFSRAPQDGVRTGIFVAGKNAEEALDMVDRARKAFVPPFVNHVFADPA.
#=GC SS_cons                       .HHHHHHHHHTT-SEEEEESS--TTTHHHHHHHHHSSS-GGGGGGEEEEEE-S-HHHHHHHHHHHHHH-BTTB--EEEE-CC.
#=GC seq_cons                      .PFDlNMAhDAGa-hllsYssVshspVsuLVQDAIFSRuPcshpcTuIFIGG+DsthAhDMlcsu+cuhhsPFcVSVhADPu.
//
DBGET integrated database retrieval system