GenomeNet

Database: Pfam
Entry: Mpt_N
LinkDB: Mpt_N
Original site: Mpt_N 
#=GF ID   Mpt_N
#=GF AC   PF09176.6
#=GF DE   Methylene-tetrahydromethanopterin dehydrogenase, N-terminal
#=GF AU   Sammut SJ
#=GF SE   pdb_1lu9
#=GF GA   19.10 19.10;
#=GF TC   21.30 24.80;
#=GF NC   17.80 15.50;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   12176390
#=GF RT   Structure of methylene-tetrahydromethanopterin dehydrogenase
#=GF RT   from methylobacterium extorquens AM1. 
#=GF RA   Ermler U, Hagemeier CH, Roth A, Demmer U, Grabarse W, Warkentin
#=GF RA   E, Vorholt JA; 
#=GF RL   Structure. 2002;10:1127-1137.
#=GF DR   INTERPRO; IPR015259;
#=GF DR   SCOP; 1lu9; fa;
#=GF CC   Members of this family adopt a alpha-beta structure, with a core
#=GF CC   comprising three alpha/beta/alpha layers, in which each sheet
#=GF CC   contains four strands. They are predominantly found in
#=GF CC   prokaryotic methylene-tetrahydromethanopterin dehydrogenase,
#=GF CC   which catalyses the dehydrogenation of
#=GF CC   methylene-tetrahydromethanopterin and the reversible
#=GF CC   dehydrogenation of methylene-H(4)F [1].
#=GF SQ   128
#=GS B1FSE6_9BURK/26-106  AC B1FSE6.1
#=GS C6WWF3_METML/18-98   AC C6WWF3.1
#=GS C5CPW4_VARPS/18-98   AC C5CPW4.1
#=GS E8KZ80_9RHIZ/17-97   AC E8KZ80.1
#=GS Q0BW54_GRABC/17-97   AC Q0BW54.1
#=GS C0N5L4_9GAMM/10-90   AC C0N5L4.1
#=GS Q6QUH8_METME/1-81    AC Q6QUH8.1
#=GS B1LVZ4_METRJ/17-97   AC B1LVZ4.1
#=GS E8L3F3_9RHIZ/17-97   AC E8L3F3.1
#=GS D5QTA7_METTR/17-97   AC D5QTA7.1
#=GS B8IK69_METNO/16-96   AC B8IK69.1
#=GS Q7AV35_METED/17-97   AC Q7AV35.1
#=GS G7ZC35_AZOL4/18-98   AC G7ZC35.1
#=GS Q6QUG5_9BACT/1-37    AC Q6QUG5.1
#=GS I0HWH2_RUBGE/18-98   AC I0HWH2.1
#=GS E8TE75_MESCW/18-98   AC E8TE75.1
#=GS G3IYH3_9GAMM/18-98   AC G3IYH3.1
#=GS B7KXA6_METC4/17-97   AC B7KXA6.1
#=GS Q6QUG7_9BACT/2-37    AC Q6QUG7.1
#=GS Q6PW18_9BACT/1-37    AC Q6PW18.1
#=GS B1ZHH6_METPB/17-97   AC B1ZHH6.1
#=GS Q6QUG8_9BACT/1-37    AC Q6QUG8.1
#=GS Q6QUG0_9GAMM/1-81    AC Q6QUG0.1
#=GS Q6R961_9RHIZ/19-99   AC Q6R961.1
#=GS G3ITU5_9GAMM/16-96   AC G3ITU5.1
#=GS A9W3S2_METEP/17-97   AC A9W3S2.1
#=GS E1TEW9_BURSG/30-110  AC E1TEW9.1
#=GS Q6QUG4_9BACT/1-37    AC Q6QUG4.1
#=GS Q6QUH1_9GAMM/1-37    AC Q6QUH1.1
#=GS Q7AV34_METED/17-97   AC Q7AV34.1
#=GS C6XDX4_METSD/23-103  AC C6XDX4.1
#=GS F5SZ75_9GAMM/18-98   AC F5SZ75.1
#=GS D5SWH3_PLAL2/16-96   AC D5SWH3.1
#=GS F5SZ77_9GAMM/16-96   AC F5SZ77.1
#=GS Q7UF75_RHOBA/31-111  AC Q7UF75.1
#=GS D5C3H9_NITHN/18-98   AC D5C3H9.1
#=GS H8GPW2_METAL/16-96   AC H8GPW2.1
#=GS H5WKF8_9BURK/18-98   AC H5WKF8.1
#=GS G4T3T0_META2/16-96   AC G4T3T0.1
#=GS G8MDS4_9BURK/22-102  AC G8MDS4.1
#=GS E8R414_ISOPI/27-107  AC E8R414.1
#=GS Q6QUJ2_METAA/1-81    AC Q6QUJ2.1
#=GS A9W3P0_METEP/17-97   AC A9W3P0.1
#=GS F0SMF6_PLABD/16-96   AC F0SMF6.1
#=GS A3ZL36_9PLAN/18-98   AC A3ZL36.1
#=GS Q6QUH6_9GAMM/1-81    AC Q6QUH6.1
#=GS B1Y0Z5_LEPCP/18-98   AC B1Y0Z5.1
#=GS G4ISR9_9RHIZ/19-99   AC G4ISR9.1
#=GS D5C3H7_NITHN/16-96   AC D5C3H7.1
#=GS F8J8U4_HYPSM/19-99   AC F8J8U4.1
#=GS G2DX02_9GAMM/18-98   AC G2DX02.1
#=GS G8AVD0_AZOBR/1-76    AC G8AVD0.1
#=GS Q6QUG2_9BACT/1-37    AC Q6QUG2.1
#=GS B0UC59_METS4/17-97   AC B0UC59.1
#=GS B2JVN5_BURP8/3-83    AC B2JVN5.1
#=GS A2SJ22_METPP/18-98   AC A2SJ22.1
#=GS F9ZZ74_METMM/16-96   AC F9ZZ74.1
#=GS Q6QUH7_9GAMM/1-81    AC Q6QUH7.1
#=GS Q6QUG6_9BACT/1-37    AC Q6QUG6.1
#=GS F5R8M3_9RHOO/16-96   AC F5R8M3.1
#=GS B1LV94_METRJ/17-97   AC B1LV94.1
#=GS H8GH97_METAL/18-98   AC H8GH97.1
#=GS F9ZYK3_METMM/18-98   AC F9ZYK3.1
#=GS Q6QUG9_9RHIZ/1-37    AC Q6QUG9.1
#=GS D7A5F9_STAND/19-99   AC D7A5F9.1
#=GS B8ITX1_METNO/17-97   AC B8ITX1.1
#=GS H0HRA4_9RHIZ/10-90   AC H0HRA4.1
#=GS B8EIJ6_METSB/17-97   AC B8EIJ6.1
#=GS I0Y5Z8_9BURK/22-102  AC I0Y5Z8.1
#=GS Q6QUZ1_9PLAN/19-101  AC Q6QUZ1.1
#=GS E4QQJ1_METS6/18-98   AC E4QQJ1.1
#=GS D7DIQ1_METS0/18-98   AC D7DIQ1.1
#=GS F9ZXB9_METMM/17-97   AC F9ZXB9.1
#=GS Q71U41_METFL/18-98   AC Q71U41.1
#=GS Q4JIT7_9BACT/16-96   AC Q4JIT7.1
#=GS H1MWJ2_9PLAN/20-100  AC H1MWJ2.1
#=GS B3FR86_9GAMM/1-30    AC B3FR86.1
#=GS Q6QUH5_9GAMM/1-81    AC Q6QUH5.1
#=GS F5RAW2_9RHOO/18-98   AC F5RAW2.1
#=GS H1KEG9_METEX/17-97   AC H1KEG9.1
#=GS F2ARP3_RHOBT/31-111  AC F2ARP3.1
#=GS H0Q595_9RHOO/18-98   AC H0Q595.1
#=GS MTDB_METEA/17-97     AC O85012.1
#=GS E8YSC6_9BURK/38-118  AC E8YSC6.1
#=GS A6C5L4_9PLAN/16-96   AC A6C5L4.1
#=GS Q0G4J9_9RHIZ/17-97   AC Q0G4J9.1
#=GS B1ZIC3_METPB/17-97   AC B1ZIC3.1
#=GS B7KXD7_METC4/17-97   AC B7KXD7.1
#=GS Q60BG9_METCA/16-96   AC Q60BG9.1
#=GS H8GH98_METAL/18-98   AC H8GH98.1
#=GS Q1H0Q9_METFK/18-98   AC Q1H0Q9.1
#=GS D2R6M8_PIRSD/18-98   AC D2R6M8.1
#=GS G4SX06_META2/18-98   AC G4SX06.1
#=GS C0N5L2_9GAMM/16-96   AC C0N5L2.1
#=GS Q9RQ02_XANAU/19-99   AC Q9RQ02.1
#=GS D5WEW5_BURSC/22-102  AC D5WEW5.1
#=GS G4SX05_META2/18-98   AC G4SX05.1
#=GS Q602P5_METCA/18-98   AC Q602P5.1
#=GS G3IYH4_9GAMM/18-98   AC G3IYH4.1
#=GS F9ZYK4_METMM/18-98   AC F9ZYK4.1
#=GS Q6QUG1_9BACT/1-37    AC Q6QUG1.1
#=GS G4ILG6_9RHIZ/57-137  AC G4ILG6.1
#=GS A2SKX3_METPP/16-96   AC A2SKX3.1
#=GS Q1YFY0_MOBAS/18-98   AC Q1YFY0.1
#=GS Q6QUH9_METRU/1-81    AC Q6QUH9.1
#=GS E4RM55_HALSL/16-96   AC E4RM55.1
#=GS Q0BU29_GRABC/18-98   AC Q0BU29.1
#=GS B0UF34_METS4/17-97   AC B0UF34.1
#=GS D5MJU9_9BACT/20-100  AC D5MJU9.1
#=GS Q6QUH3_METAA/1-81    AC Q6QUH3.1
#=GS Q6QUH2_METAA/1-81    AC Q6QUH2.1
#=GS Q4JIQ0_9BACT/16-96   AC Q4JIQ0.1
#=GS D3L4V4_9BACT/16-96   AC D3L4V4.1
#=GS G7ZAQ6_AZOL4/18-98   AC G7ZAQ6.1
#=GS B2JX35_BURP8/22-102  AC B2JX35.1
#=GS A7IG89_XANP2/19-99   AC A7IG89.1
#=GS Q13QS9_BURXL/26-106  AC Q13QS9.1
#=GS Q6QUG3_9BACT/1-37    AC Q6QUG3.1
#=GS Q6QUH0_9GAMM/1-37    AC Q6QUH0.1
#=GS Q4JIQ9_9BACT/16-96   AC Q4JIQ9.1
#=GS Q602P4_METCA/10-90   AC Q602P4.1
#=GS F5RC91_9RHOO/45-125  AC F5RC91.1
#=GS D8JXT2_HYPDA/19-99   AC D8JXT2.1
#=GS D5QUP3_METTR/18-98   AC D5QUP3.1
#=GS MTDA_METEA/17-97     AC P55818.3
#=GS MTDA_METEA/17-97     DR PDB; 1LUA A; 17-97;
#=GS MTDA_METEA/17-97     DR PDB; 1LU9 C; 17-97;
#=GS MTDA_METEA/17-97     DR PDB; 1LU9 B; 17-97;
#=GS MTDA_METEA/17-97     DR PDB; 1LUA B; 17-97;
#=GS MTDA_METEA/17-97     DR PDB; 1LUA C; 17-97;
#=GS MTDA_METEA/17-97     DR PDB; 1LU9 A; 17-97;
#=GS H1KED8_METEX/17-97   AC H1KED8.1
#=GS Q6QUH4_9GAMM/1-81    AC Q6QUH4.1
#=GS Q2VNP4_METAI/17-97   AC Q2VNP4.1
B1FSE6_9BURK/26-106             .PFDVNMAADAGYQIIVPYCNVDAGMVANLTQDAIFSRGPKGVARTGIFIGGRDVMLAADMLDSARRAMVPPFEVSV..FADPS.
C6WWF3_METML/18-98              .PFDVNMAFDAGFDKVVPYTNVELSEVTGLTQDAIFSRGLSGVKREAIFIGGRDIDLAMDMLNTAKKAMFAPFACSA..FADPS.
C5CPW4_VARPS/18-98              .PFDINMAADAGYQIIVPYCEVGLDRITGLTQDTIFSRGPKGVARTGIFIGGRDAQLAADMLERARTSMVKPFVVSA..MADPS.
E8KZ80_9RHIZ/17-97              .VFDTVVGYDGGADRIIGYGGVNPENVGALVDGCIYTRGPKEKQYTAIFVGGGSMTAGEAVFKAVKKRFFSNFRVSA..MLDSN.
Q0BW54_GRABC/17-97              .VFDSVVAYDGGADHVIGHANVTPENVGALVDGAIFTRGPKEKRFTALWIGGGSMEAGEAVLSAVKKKFFGNFRVSV..MLDSN.
C0N5L4_9GAMM/10-90              .PFDINMALDAGYDVLMPYQHVKLEEVSGLTQDAIFSRGPSGVKKTGMFIGGRDIGLAMDMLDAAKKAMVPPFEISV..FADPS.
Q6QUH8_METME/1-81               .PFDINMAYDAGYDAIAQYTNVQLSEVTGLVQDAIFSRGPRGVWRTGMLIGGRDVDLAMDMLETAKKSMVPPFEISV..FADPS.
B1LVZ4_METRJ/17-97              .VFDTVVGYDGGADHITGYGGVNPDNVGALVDGTIYTRGGSEKKSTAIFVGGGSMAAGEELFTAVKKRFFGPFRVSV..MLDSN.
E8L3F3_9RHIZ/17-97              .PFDVNMALDAGYDAAIPYTNVTLDEVTALVQDAMFSRAPSAALKTGIFFAGRDAVLALDMLEAAQKALLKPFEVSL..FADP-y
D5QTA7_METTR/17-97              .VFDTVVAYDGGADHVIGYANVTPQNVGALVDGAIYTRGPKEKQFTALFVGGGDMVAGEALFKAVRKRFFSNFRVSV..MLDSN.
B8IK69_METNO/16-96              .VFDTVVGYDGGADNITGYGNVTPENVGALVDGTIYTRGGSEKKSTAIFVGGGSMAAGEAVFEAVKKRFFGPFRVSS..MLDSN.
Q7AV35_METED/17-97              .VFDVVVGYDGGADHITGYGNVTPDNVGAYVDGTIYTRGGKEKQSTAIFVGGGDMAAGERVFEAVKKRFFGPFRVSC..MLDSN.
G7ZC35_AZOL4/18-98              .PFDINMACDAGYGVVVPYTNVETGEVPGLVQDMIFSRAPGDAKRTGLFIAGRDILKALDMLEAARGAMVPPFEISV..FADPS.
Q6QUG5_9BACT/1-37               .--------------------------------------------TGIFIGGRSALTAVEMLRVAKLSMFAPFEHCM..LADPS.
I0HWH2_RUBGE/18-98              .PFDVNMAADAGYQLVVPYGEVGLDAVAGMTQDAIFSRGPKGVARTGIFIGGRDALLAADMLKKAQAAMVKPFVVSL..MADPS.
E8TE75_MESCW/18-98              .PFDVNMALDAGFDAVVPYVDVGLAEVTGLVQDAIFSRPPDAGVDTGIFIAGKDASLALDMFDAAKKAMVPPFQVSV..FADPA.
G3IYH3_9GAMM/18-98              .PFDINMALDAGFDVLIPYNNVKLDSVYGLTQDATFSRSPSGVKRTGIFIGGRDLGLAMDMLNTSKQAMVSPFEISV..FADPS.
B7KXA6_METC4/17-97              .VFDVVVGYDGGADHITGYGNVTPDNVGAYVDGTIYTRGGKEKQSTAIFVGGGDMAAGERVFEAVKKRFFGPFRVSC..MLDSN.
Q6QUG7_9BACT/2-37               d----------------------------------------------ICIGGRSALTAVEMLRVAKLSMFAPFELCM..LADPS.
Q6PW18_9BACT/1-37               .--------------------------------------------TGIFIGGTDMAAGEKVLAVVRDTFFGPMRVSV..MLDSN.
B1ZHH6_METPB/17-97              .VFDVVVGYDGGADHITGYGNVTPDNVGAYVDGTIYTRGGKEKQSTAIFVGGGDMAAGERVFEAVKKRFFGPFRVSC..MLDSN.
Q6QUG8_9BACT/1-37               .--------------------------------------------TGIFIGGRSALTAVEMLRVAKLSMFAPFELCM..LADPS.
Q6QUG0_9GAMM/1-81               .PFDINMALDAGFDVLIPYSNVKLDGVHGLTQDAVFSRGPAGVKRTGLFIGGRDIGLAIDMLNAAEQAMVPPFEISV..FADPS.
Q6R961_9RHIZ/19-99              .PFDVNMAADAGYKVIVPYINVTQEEVTGLVQDAIFSRPPDYGVRTGFFVGGKDAILALDFLEAARKALVPPFQLSV..LADPA.
G3ITU5_9GAMM/16-96              .VFDTVVAYDGGADHVIGHGGLTPENITALVEGTIFTRAPKDKKNTAIFVGGSDMIAGQALFTAVQKHFFPGFQVSV..MLDSN.
A9W3S2_METEP/17-97              .PFDVNMAIDAGFETLIPYTGVDLTDVVSLTQDSIFSRAPQDGVRTGIFIGGKNAELALDMVDRAKKAFVPPFVNHV..FADPA.
E1TEW9_BURSG/30-110             .PFDVNMAADAGYQVIVPYCNVDAGMVGNLTQDAIFSRGPKGVARTGIFIGGRDVMLAADMLDTARKAMVPPFEVSV..FADPS.
Q6QUG4_9BACT/1-37               .--------------------------------------------TGIFIGGRSALTAVEMLRVAKLSMFAPFELCM..LADPS.
Q6QUH1_9GAMM/1-37               .--------------------------------------------TGIFIGGRDTKQALDMLKTAKNSMVPPFEVSV..FADPS.
Q7AV34_METED/17-97              .PFDVNMAIDAGFETLIPYTGVDLTDVVSLTQDSIFSRAPQDGVRTGIFIGGKNAELALDMVDRAKKAFVPPFVNHV..FADPA.
C6XDX4_METSD/23-103             .PFDVNMAYDAGYDAIAQYTNVQLSEVTGLVQDAIFSRGPRGVWRTGMLIGGRDVDLAMDMLETAKKSMVPPFEISV..FADPS.
F5SZ75_9GAMM/18-98              .PFDINMALDAGYDVLIPYSHVELSEVAGLTQDAIFSRGPSGVKKTGMFIGGRDIGLAMDMLDSAKKSMVPPFEISV..FADPS.
D5SWH3_PLAL2/16-96              .VFDRVVAVDAGVDELFSYGSVSPEAAVGLTHGAIFTRKVADLKSTAIFVGGSDVQAGEAVYAKVLHSFFGPMRVSV..MLDSN.
F5SZ77_9GAMM/16-96              t-FDQAVAYDAGVDNIIAHGGATRDNVTPHVHGMIFTRGGKNLKNSAIFIGGSNVPASDLVGKAVKKAFFGPVSVSV..MLDPN.
Q7UF75_RHOBA/31-111             .SFDSVVAVDAGVDHLLQYGNVQSEAVESLVHGAMFTRGGDDLKNSALFIGGNDVVKAEAIFRSVQKAFFGPVRVSV..MLDAS.
D5C3H9_NITHN/18-98              .PFDINMAVDAGFEVIVPYPHVKLEEINGLVQDTIFSRGPGGVKRTAIFMGGRDIGLALEMLEAAKKAMVPPFEVSI..LVDPS.
H8GPW2_METAL/16-96              .VFDTVVAYDGGADHVTGFGGLTPDTISGLVEGAIFTRPPKDKKNTAIFIGGSDMIAGQDLLKAVQSKFFPGFQVSV..MLDSN.
H5WKF8_9BURK/18-98              .PFDVNMAADAGYQLIMPYTGVSLDAISGLTQDAIFSRGPKGVARTGIFIGGRDVALAADMAQRAVAAMVPPFVVSV..MADPS.
G4T3T0_META2/16-96              .AFDTIVAYDGGADHVIGHGGLTPDTIAPLVEGTIFTRAPKDKKNTAIFVGGSDMLAGQQLFSAVQKHFFPGFQVSI..MLDSN.
G8MDS4_9BURK/22-102             .PFDVNMAADAGYQILVPYCNVGEDSVVQLTQDAIFSRGPKGVSRTGIFIGGRDVMLAADMLERARNAMVPPFEVSV..FADPS.
E8R414_ISOPI/27-107             l-FDAVVGIDAGVDHLLRYGGVTVSQVRDLVHGAIFTRGPADLKRTAIFVGGSDVDAAERLMEAVHAAFFSDFRVST..MLDPN.
Q6QUJ2_METAA/1-81               .PFDINMALDAGFDVLIPYSNVKLDGVHGLTQDAIFSRGPNGVKRTGLFIGGRDIGLAIDMLSAAEQAMVPPFEISV..FADPS.
A9W3P0_METEP/17-97              .VFDIVVGYDGGADHITGYGNVTPDNVGAYVDGTIYTRGGKEKQSTAIFVGGGDMAAGERVFEAVKKRFFGPFRVSC..MLDSN.
F0SMF6_PLABD/16-96              .SFDAVTAIDAGVDQLLSYSNVTPSNVNPLVQGGIFTRSPEDLKNTAAFVGGSNVDEGEQVLKSVLDCFFGPMRVSV..MMDSN.
A3ZL36_9PLAN/18-98              t-FDSVVAVDSGVDQLFRHGGVSAAQVRDLVYGLIFTRSPAELKSSAIFIGGSDVAQAETLLSAAVGSFFGPLRVSI..LFDPN.
Q6QUH6_9GAMM/1-81               .PFDVNMALDAGFDVLMPYSNVKLETIHTLTQDAIFSRSPSASKKTAIFSGGRDMGMAIDMLQATKPAMVPPFQVSV..FADPS.
B1Y0Z5_LEPCP/18-98              .PFDINMAADAGWQVITPYCNVALSAIGALTQDTIFSRSPKGLARTGIFIGGRDALLAADMLEAARKAMFKPFQVSL..MADPS.
G4ISR9_9RHIZ/19-99              .PFDVNMAADAGYKVIVPYINVELNEVAGLIQDAIFSRPPNYGVRTGFFMGGKDAILALDMLDAAKKAMVPPFECSV..FADPA.
D5C3H7_NITHN/16-96              .VFDQVVAYDSGVDHIMSYGGVTPDKVEGLVHGLMFTRGGKQLANSAIFLGGSHVSDSQQLAEAVKKCFFGSVRVSV..MLDPN.
F8J8U4_HYPSM/19-99              .PFDVNMAADAGYKVIIPYINVELAEVTGLIQDAIFSRPPNYGVRTGFFMGGKDAILALDMLEAAKKAMVPPFECSC..FADPA.
G2DX02_9GAMM/18-98              .PFDVNMACDAGWTVCVPYLQVALDEVPGLVQDAIFSRGPKGVKRTGLFLGGRDINLANDMLDAARGAMVPPFEVSV..LADPS.
G8AVD0_AZOBR/1-76               .-----MAADAGMGPLFPYTGVALEEVTGITQDAMFSRDPANAARTGLFIGGRDAVLALDMMDAARKAMFAPFTISV..MVDPS.
Q6QUG2_9BACT/1-37               .--------------------------------------------TGIFIGGRSALTAVEMLRVGKQSMFAPFELCM..LADPS.
B0UC59_METS4/17-97              .VFDTVVGYDGGADNITGYGGVTPESVGALVDGTIYTRGGSEKKSTAIFVGGGSMAAGEAVFEAVKKRFFGPFRVSA..MLDSN.
B2JVN5_BURP8/3-83               .PFDVNMAVDAGYQVVVPYTDVDAKLIGPLTQDAIFSRGPKGVAHTGIFIGGRDVMLATDMLRLSREAMVPPFEVSV..FADPS.
A2SJ22_METPP/18-98              .PFDINMAADAGYQLLPTYSEVTLDGVTGLTQDAIFSRGPKGVARTGLFIGGRDVLLAADMLDAARKAMVKPFVVSV..MADPS.
F9ZZ74_METMM/16-96              .VFDTVVAYDGGADHVIGHGGLTPDSIGGLVEGCIFTRAPKDKKNTAIFIGGSNMIAGQNLLAAVQAHFFPGFQVSV..MLDSN.
Q6QUH7_9GAMM/1-81               .PFDINMAMDAGWISAIPYINVEPSEVRGLVQDAIFSRSPKGLLRTAIFIGGRETKQAMDMLKMAKNSMVPPFEVSV..FADPS.
Q6QUG6_9BACT/1-37               .--------------------------------------------TGIFIGGRSALTAVEMLRVAKLSMFAPFELCM..LADPS.
F5R8M3_9RHOO/16-96              .VFDSVVCHDGGADHVIGYGGVHPHNVGAMVDGTIFTRAPKDKKNTAIFIGGSNMAEGETLFKAVKKRFFGNFRVSV..MLDSN.
B1LV94_METRJ/17-97              .PFDVNMAVDAGFETVVTYTEVSLADVVSLTQDSIFSRSPADGTRTGIFIGGKNAEDALDMVDRAKKAFVPPFVNHV..FADPA.
H8GH97_METAL/18-98              .PFDVNMAMDAGWVSAVPYINVEPSEVQGLVQDAIFSRSAKNLKRTGIFIGGRDTKQAMDMLKIAKRSMVPPFEVSV..FADPS.
F9ZYK3_METMM/18-98              .PFDVNMAMDAGWIQAVPYINVEPSEVRGLVQDAIFSRSPKGLKRTAFFIGGRETKQAMDMLKMAKNSMFPPFEVSV..FADPS.
Q6QUG9_9RHIZ/1-37               .--------------------------------------------TGIFIGGKNAELALDMVDRAKKAFVPPFVNHV..FADPA.
D7A5F9_STAND/19-99              .PFDVNMAVDAGYTTILPYSNVTLDEIADLTQDMMFSRHPDAAPRTGLFIGGKDASLALDMADKAKSVLFPPFEISL..FVDPA.
B8ITX1_METNO/17-97              .PFDVNMAVDAGFEVVTAYTGVSLAEVGPLVQDSIFSRAPQDGVRTGIFVAGKNAEEALDMVDRARKAFVPPFVNHV..FADPA.
H0HRA4_9RHIZ/10-90              .PFDVNMALDAGFDAVVPYVDVSLGDVTSLVQDAIFSRPPDAGVNTGIFIAGRDVSLSLDMFDAAKKAMVPPFQVSV..FADPA.
B8EIJ6_METSB/17-97              .PFDVNMALDAGYDSVTPYTGVTLDEVTALVQDAMFSRSPRDAVRTGVFIAGKDAGLALDMLERFKATLLKPFEISA..FADPA.
I0Y5Z8_9BURK/22-102             .PFDVNMAADAGYQILVPYCNVDEDIVVQLTQDAIFSRGPKGVSRTGIFIGGRDVMLAADMLEKARNAMVPPFEVSV..FADPS.
Q6QUZ1_9PLAN/19-101             .VFDRVVAVDAGVQHIFSYGGVTPQNVMPLVHGCIFTRGGADLRRTAVFVGGSDVTAGEAVLAEIKKHLIPQYGLSVslMLDSN.
E4QQJ1_METS6/18-98              .PFDVNMAYDAGYDAIAQYTNVQLSEVTGLVQDAIFSRGPRGVWRTGMLIGGRDVDLAMDMLETAKKSMVPPFEISV..FADPS.
D7DIQ1_METS0/18-98              .PFDVNMAIDAGFDQVIPYTNVALSEVVGLTQDAIFSRSPSGIKRESIFIGGRDIDLAMDMLGAAEKAMFPPFEISV..FADPS.
F9ZXB9_METMM/17-97              .PFDVTIAADAGYNQILPITNIKSSQVADMVQDAIFARPPKRFNDTGIFIGGRDVHLAADMFQYAKKAMVGDFKVGV..FADPN.
Q71U41_METFL/18-98              .PFDVNMAFDAGFDKIVPYTNVELKEVTGLVQDAIFSRSPSGVKRESIFIGGRDIDVAMDMLETARKAMVPPFEVSV..FADPS.
Q4JIT7_9BACT/16-96              .AFDRIVAYDAGADEVLSYGGVGDADVPGLVHGAIFTRGPKDLKNTALFIGGSSMARGELLLHGAKESFFGPFRVSI..LFDPN.
H1MWJ2_9PLAN/20-100             .VFDGVVAVDSGVEHLFRHGGVQPDAVRDLVYGALFTRGPADLQRTAIFVGGSNVAVGEAILKEVTKTFFANFRVSV..LFDAN.
B3FR86_9GAMM/1-30               .---------------------------------------------------RDIAVADDMLRQAKQAMVPPFEASV..MLDPS.
Q6QUH5_9GAMM/1-81               .PFDINMALDAGYDVLIPYSHVELNEVAGLTQDAIFSRGPSGVKKTGMFIGGRDIGLAMDMLESAKKSMVPPFEISV..FADPS.
F5RAW2_9RHOO/18-98              .PFDVNMACDAGFQVLMPYSGVGLDQIYGLTQDAIFSRGPNGVKRTGIFIGGRDIGMAADMLDACRGAMVPPFEVSV..FADPS.
H1KEG9_METEX/17-97              .VFDVVVGYDGGADHITGYGNVTPDNVGAYVDGTIYTRGGKEKQSTAIFVGGGDMAAGERVFEAVKKRFFGPFRVSC..MLDSN.
F2ARP3_RHOBT/31-111             .SFDSVVAVDAGVDHLLQYGNVQSEAVESLVHGAMFTRGGDDLKNSALFVGGNDVVKAEAIFRSVQKAFFGPVRVSV..MLDAS.
H0Q595_9RHOO/18-98              .PFDINMAVDAGYDVVVPYCRVTAEEIRGLTQDAIFSRGPKGVKATGIFIGGRNVIAASDMLETARAAMVPPFEVSV..MADPS.
MTDB_METEA/17-97                .PFDVNMAIDAGFETLIPYTGVDLTDVVSLTQDSIFSRAPQDGVRTGIFIGGKNAELALDMVDRAKKAFVPPFVNHV..FADPA.
E8YSC6_9BURK/38-118             .PFDVNMAADAGYQVIVPYCNVDAGMVANLTQDAIFSRGPKGVARTGIFIGGRDVMLAADMLDTARKAMVPPFEVSV..FADPS.
A6C5L4_9PLAN/16-96              .SFDRVVAIDAGVDELMSYSDVTPVNVESLVHGAMFTRGPKELNNTAIFVGGSEVHSGETLFQKIQDTFFGPMRVSV..MMDSN.
Q0G4J9_9RHIZ/17-97              .PFDVNQALDAGYDSVTPYENVELDEVSDLVQDVIFSRPPDHGVNSAMFFGGDDAVLALDMIDAAKGALVPPFTCNL..MADPA.
B1ZIC3_METPB/17-97              .PFDVNMAIDAGFETLIPYTNVDLADVVSLTQDSIFSRAPQDGVRTGIFIGGKNAELALDMVDRAKKAFVPPFVNHV..FADPA.
B7KXD7_METC4/17-97              .PFDVNMAIDAGFETLIPYTGVDLTDVVSLTQDSIFSRAPQDGVRTGIFIGGKNAELALDMVDRAKKAFVPPFVNHV..FADPA.
Q60BG9_METCA/16-96              .VFDTVVGYDGGADQVIAHGHLTPDNVGPLVEGTIFTRAPKDKKNTAIFVGGSDLVAGQNLLRAVRKKFFADFRVSV..MLDSN.
H8GH98_METAL/18-98              .PFDINMAVDAGFDVLIPYSNVKLDNVNGLAQDAIFSRGPSGVKRTAIFIGGRDIGLAIDMLAACRRAMVPPFEISV..LADPS.
Q1H0Q9_METFK/18-98              .PFDVNMAFDAGFDKIVPYTNVELKEVTGLVQDAIFSRSPSGVKRESIFIGGRDIDVAMDMLETARKAMVPPFEVSV..FADPS.
D2R6M8_PIRSD/18-98              .VFDAVVAVDSGVDHLLQYRGVTPGQVRDLVHGCIFTRGGADLAATAIFVGGSQIAAGEALLGEVLASFFGPMRVSV..MLDAS.
G4SX06_META2/18-98              .PFDVNMALDAGWVSAIPYINVEPSEVRGLVQDAIFSRSPKSLKKTGIFIGGRDTKQALDMLKTAKNSMVPPFEVSV..FADPS.
C0N5L2_9GAMM/16-96              t-FDQAVAYDSGVDNIIAYGGATRDNVTPHVHGMIFTRGGKSLKNSAIFIGGSNVAASDLVGEAVKKAFFGPVRVSV..MLDPN.
Q9RQ02_XANAU/19-99              .PFDVNMAVDAGYTTIAPYSRVALAEVRDLTQDMMFSRAPQSAPRTGLFIGGKDAALALDMAAEAKASIFPPFEISI..FPDPA.
D5WEW5_BURSC/22-102             .PFDVNMAADAGYQVIVPYCNVEAGMVANLTQDAIFSRGPKGVSRTGIFIGGRDVMQAVDMLDTARKAMVPPFEVSV..FADPS.
G4SX05_META2/18-98              .PFDVNMALDAGFDVLIPYSNVKLDGVHGLTQDAIFSRGPNGVKRTGLFIGGRDIGLAIDMLSAAEQAMVPPFEISV..FADPS.
Q602P5_METCA/18-98              .PFDINMAVDAGFEVIVPYSNVKAEEVHGLVQDAIFSRGPAGVKRTGIFIGGRDLAVALTMLETAKGAMVPPFEVSV..LADPS.
G3IYH4_9GAMM/18-98              .PFDVNMALDAGWVSALPYINVEPSEVQGLVQDAIFSRSPKNLKRTGIFIGGRDTKQAMDMLNTAKRSMFAPFEVSV..FADPS.
F9ZYK4_METMM/18-98              .PFDINMALDAGFDVLMPYSNVKLENIQNLTQDAIFSRSPSGIKKTGIFIGGRDIGLAIDMLQATKPAMVPPFEVSV..FADPS.
Q6QUG1_9BACT/1-37               .--------------------------------------------TGIFIGGRSALTAVEMLRVGKQSMFAPFELCM..LADPS.
G4ILG6_9RHIZ/57-137             .PFDVNMAVDAGYKVVVPHTGVRLNDTRALVQDAIFSRPPHYGCRTAMFIGGKDALLALDMLAVAKTSLVPPFQLSV..LADP-g
A2SKX3_METPP/16-96              .VFDNVVAYDGGADHVTAYGGITPANVGGLVDGAIFTRAPKDKKNTAIFVGGSNMADGEALFKAVRKKFFANFRVSV..MLDSN.
Q1YFY0_MOBAS/18-98              .PFDVNMALDAGYDAVLPYESVEMAEVADLVQDVIFSRPPDRGVRSAVFFGGNDSVLALDMIAAAKDALVPPFGCNI..MADPS.
Q6QUH9_METRU/1-81               .PFDTNMALDAGFDVLMPYSNVKLENIQNLTQDAIFSRSPSGIKKTGIFIGGRDIGLAIDMLQATKPAMVPPFEVSV..FADPS.
E4RM55_HALSL/16-96              t-FDQVVAYDAGVDNIIAHSGITKEEVEDIIYGAIFTRSAKKLKNTAVFIGGSDVEAGEEIMKAVKDVFFANYSIST..MLDSN.
Q0BU29_GRABC/18-98              .PFDVNMALDAGFDAVIPYVDVTNDQVNGLVQDAIFSRPPRLGPKTGIFIAGRNAGQALDWIDESKKALVPPFGCSV..YADPA.
B0UF34_METS4/17-97              .PFDVNMAVDAGFEVVTAYTGVTLTEVGPLVQDSIFSRAPQDGARTGLFIAGKNAEDALDMVDRARKAFVPPFVNHV..FADPA.
D5MJU9_9BACT/20-100             .PFDINMAYDAGFHAVIPYGGVNEESAVLLVQDIIFSRGPKGAKFSALFIGGNDIDSAERVRQAAAKSMFPPFQVSM..MIDP-k
Q6QUH3_METAA/1-81               .PFDINMALDAGWVSAIPYINVEPSEVRGVVQDAIFSRSPKSLKKTGIFIGGRDTKQALDMLKTAKNSMVPPFEVSV..FADPS.
Q6QUH2_METAA/1-81               .PFDINMALDAGFDVLIPYSNVKLDGVHGLTQDAIFSRGPNGVKRTGLFIGGRDIGLAIDMLSAAEQAMVPPFEISV..FADPS.
Q4JIQ0_9BACT/16-96              .VFDRVVAYDGGADEIMSCSGVTPDSVRDLVHGAIFTRGPKDLHNTAIFIGGTDMAAGEKVLAVVRDTFFGPMRVSV..MLDSN.
D3L4V4_9BACT/16-96              .VFDAVTAYDAGADIVLQYGNVTKENVRDLVYGVMFTRGGDNLKFSAIFIGGSKVIEAAEILEIVKSTFFGNVRNSV..MFDPS.
G7ZAQ6_AZOL4/18-98              .PFDVNMAMDAGIDMVVPYTGIETAQVEALTQDAMFSRDPKNAARTGLFIGGRDAAMALDMLDVARKAMFPPFQISV..FADPS.
B2JX35_BURP8/22-102             .PFDVNMAADAGYQILVPYCEVDVRNVVQLTQDAIFSRGPKGVSRTGIFIGGRDVMLAADMLDRAREAMVPPFEVSV..FADPS.
A7IG89_XANP2/19-99              .PFDVNMAVDAGYTTIAPYSRVALSEVRDLTQDMMFSRAPQSAPRTGLFIGGKDAALALDMAAEAKASIFPPFEISI..FPDPA.
Q13QS9_BURXL/26-106             .PFDVNMAADAGYQIIVPYCGVEAGMVANLTQDAIFSRGPKGVSRTGIFIGGRDVMLAADMLDSARKAMVPPFEVSV..FADPS.
Q6QUG3_9BACT/1-37               .--------------------------------------------TGIFIGGKNAILALDMLAAARQAMFPPFQISV..FADPA.
Q6QUH0_9GAMM/1-37               .--------------------------------------------TAVFIGGRDIGLAIDMLAAAKRAMVPPFEVSV..LADPS.
Q4JIQ9_9BACT/16-96              .VFDQVVAYDAGADEIMSYGGVVPEDVRDLVHGLMFTRAPKSLKSSAVWIGGNNMSQGEQLLAMAVDAMFAPFTVSV..MLDSN.
Q602P4_METCA/10-90              .PFDANMALDAGWLSLVPYTNLEAGEITALVQDAIFSRSPAGVKRTAVFIGGRDVGTAMAMLRTARKSMVPPFEISA..FADPS.
F5RC91_9RHOO/45-125             .PFDVTIAADAGFDLVIPLTGIRPENVTALVQDAIFCRPPNRFNDTGIFIGGRDVHMATDMFQSARGAMVGEFKVGV..FADPN.
D8JXT2_HYPDA/19-99              .PFDVNMAADAGYKVIVPYINVELNEVAGLIQDAIFSRPPNYGVRTGFFMGGKDAILALDMIEAAKKAMVPPFECSV..FADPA.
D5QUP3_METTR/18-98              .PFDVNMALDAGFDAAIPYTNVTLDEVTALVQDAMFSRAPSAALRTGIFFAGRDAILALDMLEAAKGALLKPFEISL..FADP-y
MTDA_METEA/17-97                .VFDVVVGYDGGADHITGYGNVTPDNVGAYVDGTIYTRGGKEKQSTAIFVGGGDMAAGERVFEAVKKRFFGPFRVSC..MLDSN.
#=GR MTDA_METEA/17-97     SS    .HHHHHHHHHTT-SEEEEESS--TTTHHHHHHHHHSSS-GGGGGGEEEEEE-S-HHHHHHHHHHHHHH-BTTB--EE..EE-CC.
H1KED8_METEX/17-97              .PFDVNMAIDAGFETLIPYTGVDLTDVVSLTQDSIFSRAPQDGVRTGIFIGGKNAELALDMVDRAKKAFVPPFVNHV..FADPA.
Q6QUH4_9GAMM/1-81               .PFDINMALDAGFDVLMPYSNVKLESIHNLTQDAIFSRSPSASKKTAIFIGGRDMGMAIDMLQATKPAMVPPFEVSV..FADPS.
Q2VNP4_METAI/17-97              .PFDVNMALDAGYDSITPYSGVTLEDVTPLVQDAMFSRSPKDAVRTGIFIAGKDAGLALDMMELVKKTLLKPFEISA..FADPA.
#=GC SS_cons                    .HHHHHHHHHTT-SEEEEESS--TTTHHHHHHHHHSSS-GGGGGGEEEEEE-S-HHHHHHHHHHHHHH-BTTB--EE..EE-CC.
#=GC seq_cons                   .PFDlshAhDAGh-hlhsYssVp.spVsuLsQDuIFoRuPpshtcTuIFIGG+DsthAhDMLcsA+cuhhsPFclSV..hADPu.
//
DBGET integrated database retrieval system