GenomeNet

Database: Pfam
Entry: NTNH_C
LinkDB: NTNH_C
Original site: NTNH_C 
#=GF ID   NTNH_C
#=GF AC   PF08470.6
#=GF DE   Nontoxic nonhaemagglutinin C-terminal
#=GF AU   Wuster A
#=GF SE   Pfam-B_4024 (release 18.0)
#=GF GA   23.90 23.90;
#=GF TC   24.10 88.70;
#=GF NC   22.70 21.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 80369284 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   11595633
#=GF RT   Clostridium botulinum and its neurotoxins: a metabolic and
#=GF RT   cellular perspective. 
#=GF RA   Johnson EA, Bradshaw M; 
#=GF RL   Toxicon 2001;39:1703-1722.
#=GF RN   [2]
#=GF RM   11233171
#=GF RT   Characterization of nicking of the nontoxic-nonhemagglutinin
#=GF RT   components of Clostridium botulinum types C and D progenitor
#=GF RT   toxin. 
#=GF RA   Sagane Y, Watanabe T, Kouguchi H, Sunagawa H, Inoue K, Fujinaga
#=GF RA   Y, Oguma K, Ohyama T; 
#=GF RL   J Protein Chem 2000;19:575-581.
#=GF DR   INTERPRO; IPR013677;
#=GF CC   Bacteria of the Clostridium genus produce protein neurotoxins,
#=GF CC   which are complexes consisting of neurotoxin (NT),
#=GF CC   haemagglutinin (HA), nontoxic nonhaemagglutinin (NTNH), and RNA
#=GF CC   [1, 2].  The domain described here is found at the C-terminus of
#=GF CC   the NTNH component.
#=GF SQ   84
#=GS F4AAX8_CLOBO/1031-1195  AC F4AAX8.1
#=GS Q45914_CLOBO/1032-1193  AC Q45914.1
#=GS Q45914_CLOBO/1032-1193  DR PDB; 3V0B B; 1032-1193;
#=GS Q45914_CLOBO/1032-1193  DR PDB; 3V0A B; 1032-1193;
#=GS S8B264_CLOBO/1000-1161  AC S8B264.1
#=GS O87710_9CLOT/994-1158   AC O87710.1
#=GS B1BE43_CLOBO/1031-1195  AC B1BE43.1
#=GS C9WWZ2_CLOBO/1031-1195  AC C9WWZ2.1
#=GS Q38197_CBCP/1031-1195   AC Q38197.1
#=GS Q9ZAJ6_CLOBO/997-1160   AC Q9ZAJ6.1
#=GS P71108_CLOBO/1032-1193  AC P71108.1
#=GS K4Q2R4_CLOBO/1031-1195  AC K4Q2R4.1
#=GS C9WWY6_CLOBO/998-1159   AC C9WWY6.1
#=GS BXEN_CLOBU/996-1160     AC Q06366.1
#=GS Q9LBR2_CLOBO/1031-1195  AC Q9LBR2.1
#=GS Q9LBR2_CLOBO/1031-1195  DR PDB; 3VUO A; 1031-1195;
#=GS O33871_CLOBO/1031-1195  AC O33871.1
#=GS Q79E33_CLOBO/1-54       AC Q79E33.1
#=GS Q93HT4_CLOBO/1031-1195  AC Q93HT4.1
#=GS B1Q6S7_CLOBO/1032-1196  AC B1Q6S7.1
#=GS C5VU80_CLOBO/1031-1195  AC C5VU80.1
#=GS B1L2G4_CLOBM/998-1159   AC B1L2G4.1
#=GS I6Z8H4_CLOBO/1031-1195  AC I6Z8H4.1
#=GS A5HZZ8_CLOBH/1032-1193  AC A5HZZ8.1
#=GS C3KS14_CLOB6/998-1159   AC C3KS14.1
#=GS A8R088_CLOBO/1031-1195  AC A8R088.1
#=GS C3KSE1_CLOB6/1031-1195  AC C3KSE1.1
#=GS D2KKE9_CLOBO/998-1161   AC D2KKE9.1
#=GS B0FNS3_CLOBO/999-1160   AC B0FNS3.1
#=GS A8Y866_CLOBO/997-1161   AC A8Y866.1
#=GS P71107_CLOBO/1032-1193  AC P71107.1
#=GS D2KKE7_CLOBO/998-1159   AC D2KKE7.1
#=GS B1INP6_CLOBK/1031-1195  AC B1INP6.1
#=GS E8ZMV9_CLOB0/1032-1193  AC E8ZMV9.1
#=GS Q45888_CLOBO/1031-1195  AC Q45888.2
#=GS S8BVG3_CLOBO/998-1161   AC S8BVG3.1
#=GS Q45893_CLOBO/1032-1196  AC Q45893.1
#=GS B1Q6N5_CLOBO/1000-1161  AC B1Q6N5.1
#=GS P71109_CLOBO/998-1159   AC P71109.1
#=GS B0RZB5_CLOBO/997-1161   AC B0RZB5.1
#=GS Q9ZX77_CBDP/1031-1195   AC Q9ZX77.1
#=GS C4IHM0_CLOBU/997-1161   AC C4IHM0.1
#=GS M1ZP45_CLOBO/182-343    AC M1ZP45.1
#=GS K4Q0Z4_CLOBO/1031-1195  AC K4Q0Z4.1
#=GS C1FUH8_CLOBJ/998-1159   AC C1FUH8.1
#=GS E9N6Q8_CLOBO/999-1163   AC E9N6Q8.1
#=GS Q2PPK7_CLOBO/998-1159   AC Q2PPK7.1
#=GS A8Y860_CLOBO/997-1161   AC A8Y860.1
#=GS O06018_CLOBO/1032-1196  AC O06018.1
#=GS D2IYR6_CLOBO/1032-1193  AC D2IYR6.1
#=GS P71117_CLOBO/1031-1195  AC P71117.1
#=GS L1LIP0_CLOBO/1031-1195  AC L1LIP0.1
#=GS O69276_CLOBO/1000-1161  AC O69276.1
#=GS B0FNQ9_CLOBO/1000-1161  AC B0FNQ9.1
#=GS B0FNQ2_CLOBO/1043-1207  AC B0FNQ2.1
#=GS B0FNR6_CLOBO/998-1159   AC B0FNR6.1
#=GS Q45887_CLOBO/999-1163   AC Q45887.1
#=GS S5RIT5_CLOBO/1031-1195  AC S5RIT5.1
#=GS S8BIN6_CLOBO/998-1161   AC S8BIN6.1
#=GS Q53550_CLOBO/1031-1195  AC Q53550.1
#=GS BXCN_CLOBO/1031-1195    AC P46081.1
#=GS Q45891_CLOBO/1000-1161  AC Q45891.1
#=GS D2KKE8_CLOBO/998-1161   AC D2KKE8.1
#=GS Q9ZAJ9_CLOBO/1031-1195  AC Q9ZAJ9.1
#=GS D2KR62_CLOBO/998-1159   AC D2KR62.1
#=GS A8R094_CLOBO/1031-1195  AC A8R094.1
#=GS C5UY14_CLOBO/997-1161   AC C5UY14.1
#=GS BXEN_CLOBO/996-1160     AC P46082.1
#=GS U4PAN0_CLOBO/1031-1195  AC U4PAN0.1
#=GS C7BEA7_CLOBO/1032-1193  AC C7BEA7.1
#=GS Q332E1_CBCP/1031-1195   AC Q332E1.1
#=GS B1QYV2_CLOBU/997-1161   AC B1QYV2.1
#=GS Q45844_CLOBO/999-1163   AC Q45844.1
#=GS A7FS62_CLOB1/1032-1193  AC A7FS62.1
#=GS A8Y872_CLOBO/997-1161   AC A8Y872.1
#=GS D5VV57_CLOB2/998-1161   AC D5VV57.1
#=GS Q45850_CLOBO/998-1161   AC Q45850.2
#=GS B1QP90_CLOBO/1031-1195  AC B1QP90.1
#=GS B1QQF7_CLOBO/997-1160   AC B1QQF7.1
#=GS Q45880_CLOBO/1032-1193  AC Q45880.1
#=GS B2V3U8_CLOBA/997-1161   AC B2V3U8.1
#=GS B2TSC3_CLOBB/1031-1195  AC B2TSC3.1
#=GS Q33CP4_CLOBO/1031-1195  AC Q33CP4.1
#=GS Q45916_CLOBO/1031-1195  AC Q45916.2
#=GS Q9LBS8_CLOBO/1031-1195  AC Q9LBS8.1
#=GS O69277_CLOBO/1032-1196  AC O69277.1
#=GS A7GBG2_CLOBL/998-1161   AC A7GBG2.1
F4AAX8_CLOBO/1031-1195             .NYFSYLDNSYIRDSSKSLLEYNKNYQLYNYVFPKTSLYEVNDNNKSYLSLKNTDGINIPSVKFKLINIDESKGYVQKWDECIICVSDGTEKYLDISSENNRIQLVSSKDNAKKITVNTDLFRPDCITFSYNDKYFSLSLRDGDYNWMICNDNNKVPKGAHLWIL-e
Q45914_CLOBO/1032-1193             .NYFEVLNNSYIRDSNEERLEYNKTYQLYNYVFSDKPICEVKQNNNIYLTINNTNNLNLQASKFKLLSINPNKQYVQKLDEVIISVLDNMEKYIDI-SEDNRLQLIDNKNNAKKMIISNDIFISNCLTLSYNGKYICLSMKDENHNWMICNN--DMSKYLYLWSFK.
#=GR Q45914_CLOBO/1032-1193  SS    .HHHHHH-SSB-B-TTSSB-BTT-EEEEEESSSTT-BEEEEESSSSEEEEE--STT-------EEEE-S-TT--B-BTT-EEEEEEESSSEEEEEE--TTSBEEEES-GGG---EEEE--TT-TT-BEEEETTEEEEEEEE-SS-EEEEE-S--SS-GGGG-EEEE.
S8B264_CLOBO/1000-1161             .NYFKVLNNSYIRDSSEERLEYNKTYQLYNYVFSENPIYEIKQNNNIYLTINNTNNLNLQVSKFKLLSINPNKQYVQKLDEVIISVLDNMEKYIDI-SEDNRLQLIDNKNNAKKMIISNDIFISNCLTLSYNGKYICLSMKDENHNWMICNN--DMSKYLYLWSFK.
O87710_9CLOT/994-1158              .NYFADLNNSYIRNGNEERLEYNKKYNLFNYVFSKTPICKVNHNNKIYLSINNDDNLNVKPLSFMLLSVDSNKKYVQKCDEVIISILDDKERYLCKSNEDNRIEIVDNKSSANIFIINNDIFISNCLTLKFNNKFIYLSEKYMNYNWIECENKYTIPKKAYLWILK.
B1BE43_CLOBO/1031-1195             .NYFSYLDNSYIRDSSKSLLEYNKNYQLYNYVFPKTSLYEVNDNNKSYLSLKNTDGINIPSVKFKLINIDESKGYVQKWDECIICVSDGTEKYLDISPENNRIQLVSSKDNAKKITVNTDLFRPDCITFSYNDKYFSLSLRDGDYNWMICNDNNKVPKGAHLWIL-e
C9WWZ2_CLOBO/1031-1195             .NYFSYLNNSYIRDISGERLEYNKTYELYNYVFPENSLYEVTENNNIYLSIKDTNNLNIQGAKFKLINIDTNKQYVQKWDEGIVCLLGDEEKYVDISSENNRIQLVSSKDTAKRIIFNNDIFRPNCLTFAYNNKYLSLSFRDRNYNWMICNNNDNIPKAAHLWALK.
Q38197_CBCP/1031-1195              .NYFSYLDNSYIRDSSKSLLEYNKNYQLYNYVFPETSLYEVNDNNKSYLSLKNTDGINISSVKFKLINIDESKVYVQKWDECIICVLDGTEKYLDISPENNRIQLVSSKDNAKKITVNTDLFRPDCITFSYNDKYFSLSLRDGDYNWMICNDNNKVPKGAHLWIL-e
Q9ZAJ6_CLOBO/997-1160              .NYFKNLNNSYIRDSNEERLEYNKTYQLYNYVFSDKPICEVKQNNNIYLTINNTNNLNLQASKFKLLSINPNKQYVQKFDEVIISVLDNMEKYIDI-SEDNRLQLIDNKNSAKKMIISNDIFISNCLTLSYGDKYVCLSMKDENYNWMICNNESNIPKKAYLWILK.
P71108_CLOBO/1032-1193             .NYFKVLNNSYIRDSNEERLEYNKTYQLYNYVFSDKPICEVKQNNNIYLTINNTNNLNLQPSKFKLLSINPNKQYVQKLDEVIISVLGNMEKYIDI-SEDNRLQLIDNKNGAKKMIISNDMFISNCLTLSCGGKYICLSMKDENHNWMICNN--DMSKYLYLWSFK.
K4Q2R4_CLOBO/1031-1195             .NYFSYLDNSYIRDSSKSLLEYNKNYQLYNYVFPKTSLYEVNDNNKSYLSLKNTDGINIPSVKFKLINIDESKGYVQKWDECIICVSDGTEKYLDISPENNRIQLVSSKDNAKKITVNTDLFRPDCITFSYNDKYFSLSLRDGDYNWMICNDNNKVPKGAHLWIL-e
C9WWY6_CLOBO/998-1159              .NYFKVLNNSYIRDSNEERLEYNKTYQLYNYVFSDKPICEVKQNNNIYLTINNTNNLNLQASKFKLLSINPNKQYVQKLDEVIISVLDNMEKYIDI-SEDNRLQLIDNKNNAKKMIISNDIFISNCLTLSYNGKYICLSMKDENHNWMICNN--DMSKYLYLWSFK.
BXEN_CLOBU/996-1160                .DYFSDLNNSYIRNFDEEILQYNRTYELFNYVFPEIAINKIEQNNNIYLSNNNENSLNFKPLKFKLLNTNPNKQYVQKWDEVIFSVLDGTEKYLDISIDNNRIQLVDNKNNAKTFIINNDIFISNCLTLTYNNVNVYLSIKNQDYNWVICDLNHDIPKKSYLWILK.
Q9LBR2_CLOBO/1031-1195             .NYFSYLDNSYIRDSSKSLLEYNKNYQLYNYVFPETSLYEVNDNNKSYLSLKNTDGINIPSVKFKLINIDESKGYVQKWDECIICVSDGTEKYLDISPENNRIQLVSSKDNAKKITVNTDLFRPDCITFSYNDKYFSLSLRDGDYNWMICNDNNKVPKGAHLWILK.
#=GR Q9LBR2_CLOBO/1031-1195  SS    .HHHHHH-SSB-B-TTS-B-BSS--BEEEESSSTTS-EEEEE-SSSEEEEE-SSTTSS--B--EEEEESSSS--B-BTTEEEEEEEESSSEEEEEE-XSS-BEEEES-GGGS-EEEEEE-SS-TT-EEEEETTEE-EE--S-SS---EE--XXSSS-GGG--EEEE.
O33871_CLOBO/1031-1195             .NYFSYLNNSYIRDISGERLEYNKTYELYNYVFPENSLYEVTENNNIYLSIKDTNNLNIEGAKFKLINIDANKQYVQKWDEGVVCLLGDEEKYVDISSENNRIQLVNSKDTAKRIIFNNDIFMPNCLTFAYNNKYLSLSLRDRNYNWMICNNNDNIPKAAHLWALK.
Q79E33_CLOBO/1-54                  .---------------------------------------------------------------------------------------------------------------KKMIISNNIFISNCLTLSCGGKYICLSMKDENYNWMICNNESNIPKKAYLWTLK.
Q93HT4_CLOBO/1031-1195             .NYFSYLDNSYIRDSSKSLLEYNKNYQLYNYVFPETSLYEVNDNNKSYLSLKNTDGINISSVKFKLINIDESKVYVQKWDECIICVLDGTEKYLDISPENNRIQLVSSKDNAKKITVNTDLFRPDCITFSYNDKYFSLSLRDGDYNWMICNDNNKVPKGAHLWIL-e
B1Q6S7_CLOBO/1032-1196             .NYFTYLNNSYIRDISGERLEYNKTYELYNYVFPESSLYEVTENNNIYLSIKNTNNLNIQGAKFKLINIDANKQYVQKWDEGVVCLLGDEEKYVDISSENNRIQLVSSKDTAKRIIFNNDIFRPNCLTFAYNNKYLSLSLRDRNYNWMICNNNDNIPKAAHLWALK.
C5VU80_CLOBO/1031-1195             .NYFSYLDNSYIRDSSKSLLEYNKNYQLYNYVFPETSLYEVNDNNKSYLSLKNTDGINISSVKFKLINIDESKGYVQKWDECIICVLDGTEKYLDISPENNRIQLVSSKDNAKKITVNTDLFRPDCITFSYNDKYFSLSLRDGDYNWMICNDNNKVPKGAHLWIL-e
B1L2G4_CLOBM/998-1159              .NYFKNLNNSYIRDSNEERLEYNKTYQLYNYVFSDKPICEVKQNNNIYLTINNTNNLNLQASKFKLLSINPNKQYVQKFDEAIISILDNMEKYIDI-SEDNRLQLIDNKNSAKKMLISNDIFISNCLTLSYNGKYICLSMKDENYNWMICNN--DMSKYLYLWSFK.
I6Z8H4_CLOBO/1031-1195             .NYFSYLNNSYIRDISGERLEYNKTYELCNYVFPENSLYEVTENNNIYLSIKDINNLNIQGAKFKLINIDTNKQYVQKWDEGVVCLLGDEEKYVDISSENNRIQLVSSKDTAKRIIFNNDIFRPNCLTFAYNNKYLSLSFRDRNYNWMICNNNDNIPKAAHLWALK.
A5HZZ8_CLOBH/1032-1193             .NYFEVLNNSYIRDSNEERLEYNKTYQLYNYVFSDKPICEVKQNNNIYLTINNTNNLNLQASKFKLLSINPNKQYVQKLDEVIISVLDNMEKYIDI-SEDNRLQLIDNKNNAKKMIISNDIFISNCLTLSYNGKYICLSMKDENHNWMICNN--DMSKYLYLWSFK.
C3KS14_CLOB6/998-1159              .NYFKDLNNSYIRDSNEERLEYNKTYQLYNYVFPDNPIYEVKQNNNIYLTINNTNNLNLQASKFKLLSINPNKQYVQKLDEVIISVLDNMEKYIDI-SADNRLQLIDNKNSAKKMLISNDIFISNCLTLSYNGKYICLSMKDETYNWMICNN--DASKYLYLWSFK.
A8R088_CLOBO/1031-1195             .NYFSYLNNSYIRDISGERLEYNKTYELYNYVFPENSLYEVTENNNIYLSIKDTNNLNIQGAKFKLINIDTNKQYVQKWDEGVVCLLGDEEKYVDISSENNRIQLVSSKDTAKRIIFNNDIFRPNCLTFAYNNKYLSLSFRDRNYNWMICNNNDNIPKAAHLWALK.
C3KSE1_CLOB6/1031-1195             .NYFSYLNNSYIRDISGERLEYNKTYELYNYVFPENSLYEVTENNNIYLSIKDTNNLNIQGAKFKLINIDANKQYVQKWDEGVVCLLGDEEKYVDISSENNRIQLVSSKDTAKRIIFNNDIFRPNCLTFAYNNKYLSLSLRDRNYNWMICNNNDNIPKAAHLWALK.
D2KKE9_CLOBO/998-1161              .NYFKNLNNSYIRDSNEERLEYNKTYQLYNYVFSDKPICEVKQNNNIYLTINNTNNLNLQASKFKLLSINPNKQYVQKFDEVIISILDNMEKYIDI-SEDNRLQLIDNKNSAKKMLISNDIFISNCLTLSYNGKYICLSMKDENYNWMICNNESNIPKRAYLWILK.
B0FNS3_CLOBO/999-1160              .NYFKDLNNSYIRDSNEERLEYNKTYQLYNYVFPDNPIYEVKQNNNIYLTINNTNNLNLQASKFKLLSINPNKQYVQKLDEVIISVLDNMEKYIDI-SADNRLQLIDNKNSAKKMLISNDIFISNCLTLSYNGKYICLSMKDETYNWMICNN--DASKYLYLWSFK.
A8Y866_CLOBO/997-1161              .DYFSDLNNSYIRNFDEEILQYNRTYELFNYVFPEIAINKIEQNNNIYLSINNENNLNFKPLKFKLLNTNPNKQYVQKWDEVIFSVLDGTEKYLDISTTNNRIQLVDNKNNAQIFIINNDIFISNCLTLTYNNVNVYLSIKNQDYNWVICDLNHDIPKKSYLWILK.
P71107_CLOBO/1032-1193             .NYFEVLNNSYIRDSNEERLEYNKTYQLYNYVFSDKPICEVKQNNNIYLTINNTNNLNLQASKFKLLSINPNKQYVQKLDEVIISVLDNMEKYIDI-SEDNRLQLIDNKNNAKKMIISNDIFISNCLTLSYNGKYICLSMKDENHNWMICNN--DMSKYLYLWSFK.
D2KKE7_CLOBO/998-1159              .NYFKVLNNSYIRDSNEERLEYNKTYQLYNYVFSDKPICEVKQNNNIYLTINNTNNLNLQPSKFKLLSINSNKQYVQKFDEVIISILGNMEKYIDI-SEDNRLQLIDNKNGAKKMIISNDMFISNCLTLSCGGKYICLSMKDENHNWMICNN--DMSKYLYLWSFK.
B1INP6_CLOBK/1031-1195             .NYFSYLNNSYIRDISGERLEYNKTYELYNYVFPENSLYEVTENNNIYLSIKDTNNLNIQGAKFKLINIDANKQYVQKWDEGVVCLLGDEEKYVDISSENNRIQLVNSKDTAKRIIFNNDIFMPNCLTFAYNNKYLSLSLRDRNYNWMICNNNDNIPKAAHLWALK.
E8ZMV9_CLOB0/1032-1193             .NYFKALNNSYIRDSSEERLEYNKTYQLYNYVFSDKPICEVKQNNNIYLTINNTNNLNLQASKFKLLSINPNKQYVQKFDEVIISILDNMEKYIDI-SEDNRLQLIDNKNSAKKMIISNDIFISNCLTLSCGGKYICLSMKDENHNWMICNN--DMSKYLYLWSFK.
Q45888_CLOBO/1031-1195             .NYFSYLNNSYIRDISGERLEYNKIYELYNYVFPENSLYEVTENNNIYLSIKDTNDLNIQGAKFKLINIDTNKQYVQKWDEGVVCLLGDEEKYVDISSENNRIQLVSSRDTAKKIIFNNDIFKPNCLTFAYNNKYLSLSFRDRNYNWMIYNNNDNIPKAAHLWTLK.
S8BVG3_CLOBO/998-1161              .NYFKNLNNSYIRDSNEERLEYNKTYQLYNYVFSDKPICEVKQNNNIYLTINNTNNLNLQASKFKLLSINPNKQYVQKFDEVIISILDNMEKYIDI-SEDNRLQLIDNKNSAKKMIISNDIFISNCLTLSYGGKYVCLSMKDENYNWMICNNESNIPKKAYLWILK.
Q45893_CLOBO/1032-1196             .NYFTYLNNSYIRDISGERLEYNKTYELYNYVFPESSLYEVTENNNIYLSIKNTNNLNIQGAKFKLINIDANKQYVQKWDEGVVCLLGDEEKYVDISSENNRIQLVSSKDTAKRIIFNNDIFRPNCLTFAYNNKYLSLSLRDRNYNWMICNNNDNIPKAAHLWALK.
B1Q6N5_CLOBO/1000-1161             .NYFKVLNNSYIRDSSEERLEYNKTYQLYNYVFSENPIYEIKQNNNIYLTINNTNNLNLQVSKFKLLSINPNKQYVQKLDEVIISVLDNMEKYIDI-SEDNRLQLIDNKNNAKKMIISNDIFISNCLIISYNGKYICLSMKDENHNWMICNN--DMSKYLYLWSFK.
P71109_CLOBO/998-1159              .NYFKVLNNSYIRDSNEERLEYHKTYQLDNYVFSDKPICEVKQNNNIYLTINNTNNLNLQPSKFKLLSINSNKQYVQKFDEVIISILGNMEKYIDI-SEDNRLQLIDNKNGAKKMIISNDMFISNCLTLSCGGKYICLSMKDENHNWMICNN--DMSKYLYLWSFK.
B0RZB5_CLOBO/997-1161              .DYFSDLNNSYIRNFDEEILQYNRTYELFNYVFPEIAINKIEQNNNIYLSINNENNLNFKPLKFKLLNTNPNKQYVQKWDEVIFSVLDGTEKYLDISTTNNRIQLVDNKNNAQIFIINNDIFISNCLTLTYNNVNVYLSIKNQDYNWVICDLNHDIPKKSYLWILK.
Q9ZX77_CBDP/1031-1195              .NYFSYLDNSYIRDSSKSLLEYNKNYQLYNYVFPETSLYEVNDNNKSYLSLKNTDGINISSVKFKLINIDESKGYVQKWDECIICVLDGTEKYLDISPENNRIQLVSSKDNAKKITVNTDLFRPDCITFSYNDKYFSLSLRDGDYNWMICNDNNKVPKGAHLWIL-e
C4IHM0_CLOBU/997-1161              .DYFSDLNNSYIRNFDEEILQYNRTYELFNYVFPEIAINKIEQNNNIYLSNNNENSLNFKPLKFKLLNTNPNKQYVQKWDEVIFSVLDGTEKYLDISIDNNRIQLVDNKNNAKTFIINNDIFISNCLTLTYNNVNVYLSIKNQDYNWVICDLNHDIPKKSYLWILK.
M1ZP45_CLOBO/182-343               .NYFKVLNNSYIRDSSEERLEYNKTYQLYNYVFSENPIYEIKQNNNIYLTINNTNNLNLQVSKFKLLSINPNKQYVQKLDEVIISVLDNMEKYIDI-SEDNRLQLIDNKNNAKKMIISNDIFISNCLIISYNGKYICLSMKDENHNWMICNN--DMSKYLYLWSFK.
K4Q0Z4_CLOBO/1031-1195             .NYFSYLDNSYIRDSSKSLLEYNKNYQLYNYVFPKTSLYEVNDNNKSYLSLKNTDGINIPSVKFKLINIDESKGYVQKWDECIICVSDGTEKYLDISPENNRIQLVSSKDNAKKITVNTDLFRPDCITFSYNDKYFSLSLRDGDYNWMICNDNNKVPKGAHLWIL-e
C1FUH8_CLOBJ/998-1159              .NYFKVLNNSYIRDSNEERLEYNKTYQLYNYVFSDKPICEVKQNNNIYLTINNTNNLNLQPSKFKLLSINSNKQYVQKFDEVIISILGNMEKYIDI-SEDNRLQLIDNKNGAKKMIISNDMFISNCLTLSCGGKYICLSMKDENHNWMICNN--DMSKYLYLWSFK.
E9N6Q8_CLOBO/999-1163              .NYFKNLNNSYVRDSNDERLEYNKTYQLYDYVFPDNPICEVKQDNNIYLTINNINNLNMKPCKFKLLSINSNKQYVQKWDEVIISVLYDTEKYVCISNENNRVKIIDNKNNASKFIISNDIFISNCLTLAHNNKYICLSMKDENYNWMICNNESNIPKKAYLWILK.
Q2PPK7_CLOBO/998-1159              .NYFKVLNNSYIRDSNEERLEYNKTYQLYNYVFSDKPICEVKQNNNIYLTINNTNNLNLQPSKFKLLSINSNKQYVQKFDEVIISILGNMEKYIDI-SEDNRLQLINNKNSAKKMIISNDIFISNCLTLSCGGKYICLSMKDENYNWMICNN--DMSKYLYLWSFK.
A8Y860_CLOBO/997-1161              .DYFSDLNNSYIRNFDEEILQYNRTYELFNYVFPEIAINKIEQNNNIYLSINNENNLNFKPLKFKLLNTNPNKQYVQKWDEVIFSVLDGTEKYLDISTDNNRIQLLDNKNNAKTFIINNDIFISNCLTLTYNNVNVYLSIKNQDYNWVICDFNHDIPKKSYLWILK.
O06018_CLOBO/1032-1196             s-YFTNLNNSYIRDSYGARLEYNKNYELYNYVFPENSLYEVIENNNMYLSIKNIKNTNILGAKFKLINTDESKQYVQKWDEVIICVLGDTEKYADIQAGNNRIQLVNSKDNARKIIVNNNIFRPNCVLFSYNNKYLSLSLRNRNYNWMICNDNSFIPKHAHLWILK.
D2IYR6_CLOBO/1032-1193             .NYFKALNNSYIRDSSEERLEYNKTYQLYNYVFSDKPICEVKQNNNIYLTINNTNNLNLQASKFKLLSINPNKQYVQKFDEVIISILDNMEKYIDI-SEDNRLQLIDNKNSAKKMIISNDIFISNCLTLSCGGKYICLSMKDENHNWMICNN--DMSKYLYLWSFK.
P71117_CLOBO/1031-1195             .NYFSYLNNSYIRDISGERLEYNKTYELYNYVFPENSLYEVTENNNIYLSIKDTNNLNIQGAKFKLINIDANKQYVQKWDEGVVCLLGDEEKYVDISSENNRIQLVNSKDTAKRIIFNNDIFMPNCLTFAYNNKYLSLSLRDRNYNWMICNNNDNIPKAAHLWALK.
L1LIP0_CLOBO/1031-1195             .NYFSYLNNSYIRDISGERLEYNKTYELYNYVFPENSLYEVTENNNIYLSIKDTNNLNIQGAKFKLINIDANKQYVQKWDEGVVCLLGDEEKYVDISSENNRIQLVNSKDTAKRIIFNNDIFMPNCLTFAYNNKYLSLSLRDRNYNWMICNNNDNIPKAAHLWALK.
O69276_CLOBO/1000-1161             .NYFKVLNNSYIRDSSEERLEYNKTYQLYNYVFSENPIYEIKQNNNIYLTINNTNNLNLQVSKFKLLSINPNKQYVQKLDEVIISVLDNMEKYIDI-SEDNRLQLIDNKNNAKKMIISNDIFISNCLIISYNGKYICLSMKDENHNWMICNN--DMSKYLYLWSFK.
B0FNQ9_CLOBO/1000-1161             .NYFKVLNNSYIRDSSEERLEYNKTYQLYNYVFSENPIYEIKQNNNIYLTINNTNNLNLQVSKFKLLSINPNKQYVQKLDEVIISVLDNMEKYIDI-SEDNRLQLIDNKNNAKKMIISNDIFISNCLTLSYNGKYICLSMKDENHNWMICNN--DMSKYLYLWSFK.
B0FNQ2_CLOBO/1043-1207             .NYFSYLNNSYIRDISGERLEYNKTYELYNYVFPENSLYEVTENNNIYLSIKDTNNLNIQGAKFKLINIDANKQYVQKWDEGVVCLLGDEEKYVDISSENNRIQLVSSKDTAKRIIFNNDIFRPNCLTFAYNNKYLSLSFRDRNYNWMICNNNDNIPKAAHLWALK.
B0FNR6_CLOBO/998-1159              .NYFKNLNNSYIRDSNEERLEYNKTYQLYNYVFSDKPICEVKQNNNIYLTINNTNNLNLQASKFKLLSINPNKQYVQKFDEAIISILDNMEKYIDI-SEDNRLQLIDNKNSAKKMLISNDIFISNCLTLSYNGKYICLSMKDENLNWMICNN--DMSKYLYLWSFK.
Q45887_CLOBO/999-1163              .NYFKNLNNSYVRDSNDERLEYNKTYQLYDYVFPDNPICEVKQDNNIYLTINNINNLNMKPCKFKLLSINSNKQYVQKWDEVIISVLYDTEKYVCISNENNRVKIIDNKIMQVKFIISNDIFISNCLTHAHNNKYICLSMKDENYNWMICNNESNIPKKAYLWILK.
S5RIT5_CLOBO/1031-1195             .NYFSYLNNSYIRDISGERLEYNKTYELCNYVFPENSLYEVTENNNIYLSIKDINNLNIQGAKFKLINIDTNKQYVQKWDEGVVCLLGDEEKYVDISSENNRIQLVSSKDTAKRIIFNNDIFRPNCLTFAYNNKYLSLSFRDRNYNWMICNNNDNIPKAAHLWALK.
S8BIN6_CLOBO/998-1161              .NYFKNLNNSYIRDSNEERLEYNKTYQLYNYVFSDKPICEVKQNNNIYLTINNTNNLNLQASKFKLLSINPNKQYVQKFDEVIISILDNMEKYIDI-SEDNRLQLIDNKNSAKKMLISNDIFISNCLTLSYNGKYICLSMKDENYNWMICNNESNIPKRAYLWILK.
Q53550_CLOBO/1031-1195             .NYFSYLDNSYIRDSSKSLLEYNKNYQLYNYVFPETSLYEVNDNNKSYLSLKNTDGINISSVKFKLINIDESKGYVQKWDECIICVLDGTEKYLDISPENNRIQLVSSKDNAKKITVNTDLFRPDCITFSYNDKYFSLSLRDGDYNWMICNDNNKVPKGAHLWIL-e
BXCN_CLOBO/1031-1195               .NYFSYLDNSYIRDSSKSLLEYNKNYQLYNYVFPETSLYEVNDNNKSYLSLKNTDGINISSVKFKLINIDESKVYVQKWDECIICVLDGTEKYLDISPENNRIQLVSSKDNAKKITVNTDLFRPDCITFSYNDKYFSLSLRDGDYNWMICNDNNKVPKGAHLWIL-e
Q45891_CLOBO/1000-1161             .NYFKVLNNSYIRDSSEERLEYNKTYQLYNYVFSENPIYEIKQNNNIYLTINNTNNLNLQVSKFKLLSINPNKQYVQKLDEVIISVLDNMEKYIDI-SEDNRLQLIDNKNNAKKMIISNDIFISNCLIISYNGKYICLSMKDENHNWMICNN--DMSKYLYLWSFK.
D2KKE8_CLOBO/998-1161              .NYFKVLNNSYIRDSNEERLEYNKTYQLYNYVFSDKPICEVKQNNNIYLTINNTNNLNLQPSKFKLLSINSNKQYVQKFDEVIISILGNMEKYIDI-SEDNRLQLIDNKNGAKKMIISNDMFISNCLTLSCGGKYICLSMKDENYNWMICNNESNIPKRAYLWILK.
Q9ZAJ9_CLOBO/1031-1195             .NYFSYLNNSYIRDISGERLEYNKTYELYNYVFPENSLYEVTENNNIYLSIKDTNNLNIQGAKFKLINIDANKQYVQKWDEGVVCLLGDEEKYVDISSENNRIQLVSSKDTAKRIIFNNDIFRPNCLTFAYNNKYLSLSLRDRNYNWMICNNNNNIPKAAHLWALK.
D2KR62_CLOBO/998-1159              .NYFKVLNNSYIRDSNEERLEYNKTYQLYNYVFSDKPICEVKQNNNIYLTINNTNNLNLQPSKFKLLSINPNKQYVQKFDEVIISILGNMEKYIDI-SEDNRLQLIDNKNGAKKMIISNDMFISNCLTLSCGGKYICLSMKDENHNWMICNN--DMSKYLYLWSFK.
A8R094_CLOBO/1031-1195             .NYFSYLNNSYIRDISGERLEYNKTYELYNYVFPENSLYEVTENNNIYLSIKDTNNLNIQGAKFKLINIDTNKQYVQKWDEGVVCLLGDEEKYVDISSENNRIQLVSSKDTAKRIIFNNDIFRPNCLTFAYNNKYLSLSFRDRNYNWMICNNNDNIPKAAHLWALK.
C5UY14_CLOBO/997-1161              .DYFSDLNNSYIRNFDEEILQYNRTYELFNYVFPEIAINKIEQNNNIYLSINNENNLNFKPLKFKLLNTNPNKQYVQKWDEVIFSVLDGTEKYLDISTTNNRIQLVDNKNNAQIFIINNDIFISNCLTLTYNNVNIYLSIKNQDYNWVICDLNHDIPKKSYLWILK.
BXEN_CLOBO/996-1160                .DYFSDLNNSYIRNFDEEILQYNRTYELFNYVFPEIAINKIEQNNNIYLSINNENNLNFKPLKFKLLNTNPNKQYVQKWDEVIFSVLDGTEKYLDISTTNNRIQLVDNKNNAQIFIINNDIFISNCLTLTYNNVNVYLSIKNQDYNWVICDLNHDIPKKSYLWILK.
U4PAN0_CLOBO/1031-1195             .NYFSYLNNSYIRDISGERLEYNKIYELYNYVFPENSLYEVTENNNIYLSIKDTNDLNIQGAKFKLINIDTNKQYVQKWDEGVVCLLGDEEKYVDISSENNRIQLVSSRDTAKKIIFNNDIFKPNCLTFAYNNKYLSLSFRDRNYNWMIYNNNDNIPKAAHLWTLK.
C7BEA7_CLOBO/1032-1193             .NYFKALNNSYIRDSSEERLEYNKTYQLYNYVFSDKPICEVKQNNNIYLTINNTNNLNLQASKFKLLSINPNKQYVQKFDEVIISILDNMEKYIDI-SEDNRLQLIDNKNSAKKMIISNDIFISNCLTLSCGGKYICLSMKDENHNWMICNN--DMSKYLYLWSFK.
Q332E1_CBCP/1031-1195              .NYFSYLDNSYIRDSSKSLLEYNKNYQLYNYVFPETSLYEVNDNNKSYLSLKNTDGINISSVKFKLINIDESKVYVQKWDECIICVLDGTEKYLDISPENNRIQLVSSKDNAKKITVNTDLFRPDCITFSYNDKYFSLSLRDGDYNWMICNDNNKVPKGAHLWIL-e
B1QYV2_CLOBU/997-1161              .DYFSDLNNSYIRNFDEEILQYNRTYELFNYVFPEIAINKIEQNNNIYLSNNNENSLNFKPLKFKLLNTNPNKQYVQKWDEVIFSVLDGTEKYLDISIDNNRIQLVDNKNNAKTFIINNDIFISNCLTLTYNNVNVYLSIKNQDYNWVICDLNHDIPKKSYLWILK.
Q45844_CLOBO/999-1163              .NYFKNLNNSYVRDSNDERLEYNKTYQLYDYVFPDNPICEVKQDNNIYLTINNINNLNMKPCKFKLLSINSNKQYVQKWDEVIISVLYDTEKYVCISNENNRVKIIDNKIMQVKFIISNDIFISNCLTHAHNNKYICLSMKDENYNWMICNNESNIPKKAYLWILK.
A7FS62_CLOB1/1032-1193             .NYFEVLNNSYIRDSNEERLEYNKTYQLYNYVFSDKPICEVKQNNNIYLTINNTNNLNLQASKFKLLSINPNKQYVQKLDEVIISVLDNMEKYIDI-SEDNRLQLIDNKNNAKKMIISNDIFISNCLTLSYNGKYICLSMKDENHNWMICNN--DMSKYLYLWSFK.
A8Y872_CLOBO/997-1161              .DYFSDLNNSYIRNFDEEILQYNRTYELFNYVFPEIAINKIEQNNNIYLSINNENNLNFKPLKFKLLNTNPNKQYVQKWDEVIFSVLDGTEKYLDISTTNNRIQLVDNKNNAQIFIINNDIFISNCLTLTYNNVNVYLSIKNQDYNWVICDLNHDIPKKSYLWILK.
D5VV57_CLOB2/998-1161              .NYFKNLNNSYIRDSNEERLEYNKTYQLYNYVFSENPIYEIKQNNNIYLTINNTNNLNLQASKFKLLSINPNKQHVQKFDEVIISILDNMEKYIDI-SEDNRLQLIDNKNGAKKMIISNNIFISNCLTLSCGGKYICLSMKDENYNWMICNNESNIPKKAYLWTLK.
Q45850_CLOBO/998-1161              .NYFKNLNNSYIRDSNEERLEYNKTYQLYNYVFSENPIYEIKQNNNIYLTINNTNNLNLQASKFKLLSINPNKQHVQKFDEVIISILDNMEKYIDI-SEDNRLQLIDNKNGAKKMIISNNIFISNCLTLSCGGKYICLSMKDENYNWMICNNESNIPKKAYLWTLK.
B1QP90_CLOBO/1031-1195             .NYFSYLNNSYIRDISGERLEYNKTYELYNYVFPENSLYEVTENNNIYLSIKDTNNLNIQGAKFKLINIDANKQYVQKWDEGVVCLLGDEEKYVDISSENNRIQLVSSKDTAKRIIFNNDIFRPNCLTFAYNNKYLSLSLRDRNYNWMICNNNDNIPKAAHLWALK.
B1QQF7_CLOBO/997-1160              .NYFKNLNNSYIRDSNEERLEYNKTYQLYNYVFSDKPICEVKQNNNIYLTINNTNNLNLQASKFKLLSINPNKQYVQKFDEVIISVLDNMEKYIDI-SEDNRLQLIDNKNSAKKMIISNDIFISNCLTLSYGDKYVCLSMKDENYNWMICNNESNIPKKAYLWILK.
Q45880_CLOBO/1032-1193             .NYFKVLNNSYIRDSSEERLEYNKTYQLYNYVFSENPIYEIKQNNNIYLTINNTNNLNLQVSKFKLLSINPNKQYVQKLDEVIISVLDNMEKYIDI-SEDNRLQLIDNKNNAKKMIISNDIFISNCLIISYNGKYICLSMKDENHNWMICNN--DMSKYLYLWSFK.
B2V3U8_CLOBA/997-1161              .DYFSDLNNSYIRNFDEEILQYNRTYELFNYVFPEIAINKIEQNNNIYLSINNENNLNFKPLKFKLLNTNPNKQYVQKWDEVIFSVLDGTEKYLDISTTNNRIQLVDNKNNAQIFIINNDIFISNCLTLTYNNVNVYLSIKNQDYNWVICDLNHDIPKKSYLWILK.
B2TSC3_CLOBB/1031-1195             .NYFSYLNNSYIRDISGERLEYNKIYELYNYVFPENSLYEVTENNNIYLSIKDTNDLNIQGAKFKLINIDTNKQYVQKWDEGVVCLLGDEEKYVDISSENNRIQLVSSRDTAKKIIFNNDIFKPNCLTFAYNNKYLSLSFRDRNYNWMIYNNNDNIPKAAHLWTLK.
Q33CP4_CLOBO/1031-1195             .NYFSYLNNSYIRDISGERLEYNKTYELYNYVFPENSLYEVTENNNIYLSIKDTNNLNIQGAKFKLINIDANKQYVQKWDEGVVCLLGDEEKYVDISSENNRIQLVNSKDTAKRIIFNNDIFMPNCLTFAYNNKYLSLSLRDRNYNWMICNNNDNIPKAAHLWALK.
Q45916_CLOBO/1031-1195             .NYFSYLDNSYIRDSSKSLLEYNKNYQLYNYVFPETSLYEVNDNNKSYLSLKNTDGINISSVKFKLINIDESKVYVQKWDECIICVLDGTEKYLDISPENNRIQLVSSKDNAKKITVNTDLFRPDCITFSYNDKYFSLSLRDGDYNWMICNDNNKVPKGAHLWIL-e
Q9LBS8_CLOBO/1031-1195             .NYFSYLDNSYIRDSSKSLLEYNKNYQLYNYVFPKTSLYEVNDNNKSYLSLKNTDGINIPSVKFKLINIDESKGYVQKWDECIICVSDGTEKYLDISSENNRIQLVSSKDNAKKITVNTDLFRPDCITFSYNDKYFSLSLRDGDYNWMICNDNNKVPKGAHLWIL-e
O69277_CLOBO/1032-1196             .NYFTYLNNSYIRDISGERLEYNKTYELYNYVFPESSLYEVTENNNIYLSIKNTNNLNIQGAKFKLINIDANKQYVQKWDEGVVCLLGDEEKYVDISSENNRIQLVSSKDTAKRIIFNNDIFRPNCLTFAYNNKYLSLSLRDRNYNWMICNNNDNIPKAAHLWALK.
A7GBG2_CLOBL/998-1161              .NYFKNLNNSYIRDSNEERLEYNKTYQLYNYVFSENPIYEIKQNNNIYLTINNTNNLNLQASKFKLLSINPNKQHVQKFDEVIISILDNMEKYIDI-SEDNRLQLIDNKNGAKKMIISNNIFISNCLTLSCGGKYICLSMKDENYNWMICNNESNIPKKAYLWTLK.
#=GC SS_cons                       .HHHHHH-SSB-B-TTSSB-BTT-EEEEEESSSTTSBEEEEESSSSEEEEE-SSTTSS--B--EEEEESSTT--B-BTTEEEEEEEESSSEEEEEE-XTTSBEEEES-GGGS-EEEEEE-TT-TT-EEEEETTEEEEEEEC-SS-EEEEE-SXSSS-GGGG-EEEE.
#=GC seq_cons                      .NYFphLNNSYIRDSscERLEYNKTYQLYNYVFs-sslhEVppNNNIYLoIpNTNNLNlQuuKFKLlsIssNKQYVQKaDEsIIslLDshEKYlDI.SEsNRlQLlssKssAKKhIlsNDIFhsNCLThoYNsKYlsLSh+DcNYNWMICNNppslPKtuaLWhLK.
//
DBGET integrated database retrieval system