GenomeNet

Database: Pfam
Entry: NTNH_C
LinkDB: NTNH_C
Original site: NTNH_C 
#=GF ID   NTNH_C
#=GF AC   PF08470.8
#=GF DE   Nontoxic nonhaemagglutinin C-terminal
#=GF AU   Wuster A
#=GF SE   Pfam-B_4024 (release 18.0)
#=GF GA   23.90 23.90;
#=GF TC   24.10 198.90;
#=GF NC   22.70 22.70;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   11595633
#=GF RT   Clostridium botulinum and its neurotoxins: a metabolic and
#=GF RT   cellular perspective. 
#=GF RA   Johnson EA, Bradshaw M; 
#=GF RL   Toxicon 2001;39:1703-1722.
#=GF RN   [2]
#=GF RM   11233171
#=GF RT   Characterization of nicking of the nontoxic-nonhemagglutinin
#=GF RT   components of Clostridium botulinum types C and D progenitor
#=GF RT   toxin. 
#=GF RA   Sagane Y, Watanabe T, Kouguchi H, Sunagawa H, Inoue K, Fujinaga
#=GF RA   Y, Oguma K, Ohyama T; 
#=GF RL   J Protein Chem 2000;19:575-581.
#=GF DR   INTERPRO; IPR013677;
#=GF CC   Bacteria of the Clostridium genus produce protein neurotoxins,
#=GF CC   which are complexes consisting of neurotoxin (NT),
#=GF CC   haemagglutinin (HA), nontoxic nonhaemagglutinin (NTNH), and RNA
#=GF CC   [1, 2].  The domain described here is found at the C-terminus of
#=GF CC   the NTNH component.
#=GF SQ   5
#=GS A0A0A7G0U0_9CLOT/996-1160  AC A0A0A7G0U0.1
#=GS C4IHM0_CLOBU/997-1161      AC C4IHM0.1
#=GS A5HZZ8_CLOBH/1032-1193     AC A5HZZ8.1
#=GS C5VU80_CLOBO/1031-1195     AC C5VU80.1
#=GS B2TSC3_CLOBB/1031-1195     AC B2TSC3.1
A0A0A7G0U0_9CLOT/996-1160             NYFADLNNSYIRNGNEERLEYNKKYNLFNYVFSKTPICKVNHNNKIYLSINNDDNLNVKPLSFMLLSVDSNKKYVQKCDEVIISILDDKERYLCKSNEDNRIEIVDNKSSANIFIINNDIFISNCLTLKFNNKFIYLSEKYMNYNWIECENKYTIPKKAYLWILK.
C4IHM0_CLOBU/997-1161                 DYFSDLNNSYIRNFDEEILQYNRTYELFNYVFPEIAINKIEQNNNIYLSNNNENSLNFKPLKFKLLNTNPNKQYVQKWDEVIFSVLDGTEKYLDISIDNNRIQLVDNKNNAKTFIINNDIFISNCLTLTYNNVNVYLSIKNQDYNWVICDLNHDIPKKSYLWILK.
A5HZZ8_CLOBH/1032-1193                NYFEVLNNSYIRDSNEERLEYNKTYQLYNYVFSDKPICEVKQNNNIYLTINNTNNLNLQASKFKLLSINPNKQYVQKLDEVIISVLDNMEKYIDI-SEDNRLQLIDNKNNAKKMIISNDIFISNCLTLSYNGKYICLSMKDENHNWMICNN--DMSKYLYLWSFK.
C5VU80_CLOBO/1031-1195                NYFSYLDNSYIRDSSKSLLEYNKNYQLYNYVFPETSLYEVNDNNKSYLSLKNTDGINISSVKFKLINIDESKGYVQKWDECIICVLDGTEKYLDISPENNRIQLVSSKDNAKKITVNTDLFRPDCITFSYNDKYFSLSLRDGDYNWMICNDNNKVPKGAHLWIL-e
B2TSC3_CLOBB/1031-1195                NYFSYLNNSYIRDISGERLEYNKIYELYNYVFPENSLYEVTENNNIYLSIKDTNDLNIQGAKFKLINIDTNKQYVQKWDEGVVCLLGDEEKYVDISSENNRIQLVSSRDTAKKIIFNNDIFKPNCLTFAYNNKYLSLSFRDRNYNWMIYNNNDNIPKAAHLWTLK.
#=GC seq_cons                         NYFSsLNNSYIRDusEERLEYNKsYpLYNYVFPEsuIsEVscNNNIYLSINNTNsLNlpulKFKLLNIDsNKQYVQKWDEVIISVLDspEKYLDISsENNRIQLVDNKsNAKKhIINNDIFISNCLTLoYNNKYlsLShKDpNYNWMICNNNpcIPKtAYLWILK.
//
DBGET integrated database retrieval system