GenomeNet

Database: Pfam
Entry: Orthopox_A49R
LinkDB: Orthopox_A49R
Original site: Orthopox_A49R 
#=GF ID   Orthopox_A49R
#=GF AC   PF06489.9
#=GF DE   Orthopoxvirus A49R protein
#=GF AU   Moxon SJ
#=GF SE   Pfam-B_14072 (release 10.0)
#=GF GA   25.00 25.00;
#=GF TC   357.80 357.70;
#=GF NC   23.70 23.10;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF DR   INTERPRO; IPR009473;
#=GF CC   This family consists of several Orthopoxvirus A49R proteins. The
#=GF CC   function of this family is unknown.
#=GF SQ   2
#=GS A49_VAR67/1-162   AC P33857.1
#=GS A49R_VACCW/1-162  AC P31037.1
#=GS A49R_VACCW/1-162  DR PDB; 4D5T B; 13-162;
#=GS A49R_VACCW/1-162  DR PDB; 4D5T E; 13-162;
#=GS A49R_VACCW/1-162  DR PDB; 4D5T H; 13-162;
#=GS A49R_VACCW/1-162  DR PDB; 4D5R B; 17-162;
#=GS A49R_VACCW/1-162  DR PDB; 4D5T C; 13-162;
#=GS A49R_VACCW/1-162  DR PDB; 4D5S A; 18-160;
#=GS A49R_VACCW/1-162  DR PDB; 4D5T D; 13-162;
#=GS A49R_VACCW/1-162  DR PDB; 4D5S B; 18-160;
#=GS A49R_VACCW/1-162  DR PDB; 4D5T G; 13-162;
#=GS A49R_VACCW/1-162  DR PDB; 4D5T F; 13-162;
#=GS A49R_VACCW/1-162  DR PDB; 4D5R A; 13-162;
#=GS A49R_VACCW/1-162  DR PDB; 4D5T A; 13-162;
A49_VAR67/1-162              MDEGYYSGNLESVLGYVSDMHTKLASITQLVIAKIETIDNDILNNDIVNFIMCRSNLNNPFISFLDTVYTIIDQEIYQNELINSLDDNKIIDCIVNKFMSFYKDNLENIVDAIITLKYIMNNPDFKTTYAEVLGSRIADIDIKQVIRENILQLSNDIRERYL
A49R_VACCW/1-162             MDEAYYSGNLESVLGYVSDMHTELASISQLVIAKIETIDNDILNKDIVNFIMCRSNLDNPFISFLDTVYTIIDQENYQTELINSLDDNEIIDCIVNKFMSFYKDNLENIVDAIITLKYIMNNPDFKTTYAEVLGSRIADIDIKQVIRENILQLSNDIRERYL
#=GR A49R_VACCW/1-162  SS    XXXXXXXXXXXX-TT-SSTHHHHHHHHHHHHHHHGGGS-HHHHHHHHHHHHTT---TTSHHHHHHHHHHHHHTCHHHHHHHHHT--HHHHHHHHHHHHGGGGSS-HHHHHHHHHHHHHHHTSHHHHHHHHHHHHHHHTT---HHHHHHHHHHHHHHHHHHHT
#=GC SS_cons                 XXXXXXXXXXXX-TT-SSTHHHHHHHHHHHHHHHGGGS-HHHHHHHHHHHHTT---TTSHHHHHHHHHHHHHTCHHHHHHHHHT--HHHHHHHHHHHHGGGGSS-HHHHHHHHHHHHHHHTSHHHHHHHHHHHHHHHTT---HHHHHHHHHHHHHHHHHHHT
#=GC seq_cons                MDEuYYSGNLESVLGYVSDMHTcLASIoQLVIAKIETIDNDILNpDIVNFIMCRSNLsNPFISFLDTVYTIIDQE.YQsELINSLDDNcIIDCIVNKFMSFYKDNLENIVDAIITLKYIMNNPDFKTTYAEVLGSRIADIDIKQVIRENILQLSNDIRERYL
//
DBGET integrated database retrieval system