GenomeNet

Database: Pfam
Entry: PF03617
LinkDB: PF03617
Original site: PF03617 
#=GF ID   IBV_3A
#=GF AC   PF03617.11
#=GF DE   IBV 3A protein 
#=GF AU   Finn RD
#=GF SE   Pfam-B_3183 (release 7.0)
#=GF GA   25.00 25.00;
#=GF TC   138.50 138.40;
#=GF NC   18.10 17.80;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF DR   INTERPRO; IPR005214;
#=GF CC   The gene product of gene 3 from Avian infectious bronchitis
#=GF CC   virus. Currently, the function of this protein remains unknown.
#=GF SQ   1
#=GS NS3A_IBVB/1-57  AC P30237.2
NS3A_IBVB/1-57             MIQSPTSFLIVLILLWCKLVLSCFREFIIALQQLIQVLLQIINSNLQSRLTLWHSLD
#=GC seq_cons              MIQSPTSFLIVLILLWCKLVLSCFREFIIALQQLIQVLLQIINSNLQSRLTLWHSLD
//
DBGET integrated database retrieval system