GenomeNet

Database: Pfam
Entry: PLRV_ORF5
LinkDB: PLRV_ORF5
Original site: PLRV_ORF5 
#=GF ID   PLRV_ORF5
#=GF AC   PF01690.12
#=GF DE   Potato leaf roll virus readthrough protein
#=GF AU   Bashton M, Bateman A
#=GF SE   Pfam-B_1335 (release 4.1)
#=GF GA   27.40 27.40;
#=GF TC   27.70 27.70;
#=GF NC   27.30 27.30;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   7513925
#=GF RT   Changes in the amino acid sequence of the coat protein
#=GF RT   readthrough domain of potato leafroll luteovirus affect the
#=GF RT   formation of an epitope and aphid transmission. 
#=GF RA   Jolly CA, Mayo MA; 
#=GF RL   Virology 1994;201:182-185.
#=GF DR   INTERPRO; IPR002929;
#=GF CC   This family consists mainly of the potato leaf roll virus 
#=GF CC   readthrough protein. This is generated via a readthrough  of
#=GF CC   open reading frame 3 a coat protein allowing transcription of
#=GF CC   open reading frame 5 to give an extended coat protein  with a
#=GF CC   large c-terminal addition or read through domain [1]. The
#=GF CC   readthrough protein is thought to play a role in the 
#=GF CC   circulative aphid transmission of potato leaf roll virus [1].
#=GF CC   Also in the family is open reading frame 6 from beet western
#=GF CC   yellows virus and potato leaf roll virus both luteovirus and an
#=GF CC   unknown protein from cucurbit aphid-borne yellows virus a
#=GF CC   closterovirus.
#=GF SQ   317
#=GS D4P4V5_9LUTE/198-664  AC D4P4V5.1
#=GS B0FKR2_BYDVP/201-644  AC B0FKR2.1
#=GS F8RUL6_9LUTE/198-418  AC F8RUL6.1
#=GS D4P4U7_9LUTE/198-265  AC D4P4U7.1
#=GS Q8QYN3_PLRV/1-107     AC Q8QYN3.1
#=GS F8RUD5_9LUTE/198-664  AC F8RUD5.1
#=GS Q70FV1_9LUTE/1-414    AC Q70FV1.1
#=GS Q99GS1_PLRV/1-490     AC Q99GS1.1
#=GS Q8QHP7_PLRV/1-107     AC Q8QHP7.1
#=GS F8RUL0_9LUTE/198-418  AC F8RUL0.1
#=GS C7AXW3_BYDVP/21-187   AC C7AXW3.1
#=GS A5A304_BYDVP/203-650  AC A5A304.1
#=GS Q7T6K5_9LUTE/1-387    AC Q7T6K5.1
#=GS B1A428_9LUTE/202-640  AC B1A428.1
#=GS Q45ZY5_BYDVP/202-650  AC Q45ZY5.1
#=GS B0FL14_BYDVP/201-646  AC B0FL14.1
#=GS Q91QP6_9LUTE/1-439    AC Q91QP6.1
#=GS F8RUM8_9LUTE/198-418  AC F8RUM8.1
#=GS B0ZT75_9LUTE/201-655  AC B0ZT75.1
#=GS Q8QYM9_PLRV/210-699   AC Q8QYM9.1
#=GS C7AXX1_BYDVP/21-187   AC C7AXX1.1
#=GS F8RUL3_9LUTE/198-418  AC F8RUL3.1
#=GS D3JXR4_9LUTE/198-664  AC D3JXR4.1
#=GS A5A2Q2_BYDVP/202-652  AC A5A2Q2.1
#=GS F8VCF6_9LUTE/202-635  AC F8VCF6.1
#=GS Q7T6J7_9LUTE/1-415    AC Q7T6J7.1
#=GS F8RUE7_9LUTE/198-664  AC F8RUE7.1
#=GS F8RUF3_9LUTE/198-664  AC F8RUF3.1
#=GS B0ZT93_9LUTE/201-655  AC B0ZT93.1
#=GS Q7T6J9_9LUTE/1-415    AC Q7T6J9.1
#=GS F8RUN4_9LUTE/198-418  AC F8RUN4.1
#=GS B0FKT6_BYDVP/201-646  AC B0FKT6.1
#=GS B7TWC5_9LUTE/202-640  AC B7TWC5.1
#=GS H9NAD4_9LUTE/198-265  AC H9NAD4.1
#=GS Q84815_PLRV/1-490     AC Q84815.1
#=GS D4P4W7_9LUTE/198-664  AC D4P4W7.1
#=GS Q91QR1_9LUTE/1-519    AC Q91QR1.1
#=GS Q7T6K4_9LUTE/1-415    AC Q7T6K4.1
#=GS D4P4W1_9LUTE/198-664  AC D4P4W1.1
#=GS Q91IC7_BYDVP/1-449    AC Q91IC7.1
#=GS F8RUI6_9LUTE/198-418  AC F8RUI6.1
#=GS Q2L3F9_9LUTE/198-664  AC Q2L3F9.1
#=GS B0FKU2_BYDVP/201-646  AC B0FKU2.1
#=GS Q9IZG0_BYDVP/202-650  AC Q9IZG0.1
#=GS F8RUC3_9LUTE/198-664  AC F8RUC3.1
#=GS B0FKZ0_BYDVP/201-646  AC B0FKZ0.1
#=GS C8CBB0_9LUTE/203-692  AC C8CBB0.1
#=GS Q8JZ09_9LUTE/204-661  AC Q8JZ09.1
#=GS B5L2B9_9LUTE/204-661  AC B5L2B9.1
#=GS Q65849_BYDVP/1-449    AC Q65849.1
#=GS B0FKM0_BYDVP/201-644  AC B0FKM0.1
#=GS Q70FV0_9LUTE/1-417    AC Q70FV0.1
#=GS B0FKQ6_BYDVP/201-644  AC B0FKQ6.1
#=GS D0EX81_9LUTE/198-265  AC D0EX81.1
#=GS Q45ZZ5_BYDVP/202-650  AC Q45ZZ5.1
#=GS G8Z1X3_9LUTE/201-663  AC G8Z1X3.1
#=GS F8RUC9_9LUTE/198-664  AC F8RUC9.1
#=GS Q8QYR8_PLRV/210-699   AC Q8QYR8.1
#=GS Q8QYR3_PLRV/210-699   AC Q8QYR3.1
#=GS C7AXX0_BYDVP/21-187   AC C7AXX0.1
#=GS Q84829_PLRV1/1-490    AC Q84829.1
#=GS H9NAE6_9LUTE/198-265  AC H9NAE6.1
#=GS A5A2T8_BYDVP/205-650  AC A5A2T8.1
#=GS MCAPS_BWYVG/203-660   AC P09515.2
#=GS A5A2S0_BYDVP/207-650  AC A5A2S0.1
#=GS MCAPS_TYYVF/204-661   AC P09514.2
#=GS Q91GX6_BYDVP/1-449    AC Q91GX6.1
#=GS F2X6V5_9LUTE/198-664  AC F2X6V5.1
#=GS A5A2W9_9LUTE/206-511  AC A5A2W9.1
#=GS C7AXW8_BYDVP/21-187   AC C7AXW8.1
#=GS B0FKK2_BYDVP/201-644  AC B0FKK2.1
#=GS B3GQA5_PLRV/1-107     AC B3GQA5.1
#=GS D7EZI4_9LUTE/204-660  AC D7EZI4.1
#=GS B0FKT0_BYDVP/201-646  AC B0FKT0.1
#=GS B7TWD1_9LUTE/202-640  AC B7TWD1.1
#=GS B5L2B5_9LUTE/204-661  AC B5L2B5.1
#=GS F8RUH7_9LUTE/198-418  AC F8RUH7.1
#=GS Q70FV2_9LUTE/1-417    AC Q70FV2.1
#=GS B1A422_9LUTE/202-640  AC B1A422.1
#=GS Q45ZZ0_BYDVP/202-650  AC Q45ZZ0.1
#=GS Q2L3H1_9LUTE/198-664  AC Q2L3H1.1
#=GS B0FEU2_PLRV/210-699   AC B0FEU2.1
#=GS A5A2P7_9LUTE/206-511  AC A5A2P7.1
#=GS C7AXW7_BYDVP/21-187   AC C7AXW7.1
#=GS F8RUH4_9LUTE/198-418  AC F8RUH4.1
#=GS Q7T6J8_9LUTE/1-415    AC Q7T6J8.1
#=GS Q7T6K2_9LUTE/1-415    AC Q7T6K2.1
#=GS D2K8X5_9LUTE/198-265  AC D2K8X5.1
#=GS Q8BA01_PLRV/210-699   AC Q8BA01.1
#=GS B0ZT87_9LUTE/201-655  AC B0ZT87.1
#=GS E3UIL9_PEMV1/190-472  AC E3UIL9.1
#=GS D2K8V5_9LUTE/198-265  AC D2K8V5.1
#=GS B0FKL4_BYDVP/202-650  AC B0FKL4.1
#=GS B1A440_9LUTE/202-640  AC B1A440.1
#=GS E0A2S1_9LUTE/1-137    AC E0A2S1.1
#=GS Q2L3I9_9LUTE/198-664  AC Q2L3I9.1
#=GS Q7T6J5_9LUTE/1-415    AC Q7T6J5.1
#=GS Q8B6L8_9LUTE/1-519    AC Q8B6L8.1
#=GS Q2L3I3_9LUTE/198-664  AC Q2L3I3.1
#=GS Q8B6M0_9LUTE/1-519    AC Q8B6M0.1
#=GS G3E226_9LUTE/1-258    AC G3E226.1
#=GS Q70FV8_9LUTE/1-417    AC Q70FV8.1
#=GS Q8QYQ6_PLRV/210-699   AC Q8QYQ6.1
#=GS F8RUI0_9LUTE/198-418  AC F8RUI0.1
#=GS Q91QQ1_9LUTE/1-363    AC Q91QQ1.1
#=GS Q8QYR0_PLRV/3-107     AC Q8QYR0.1
#=GS Q2L3H7_9LUTE/198-664  AC Q2L3H7.1
#=GS Q65872_BYDV1/1-455    AC Q65872.1
#=GS B1A419_9LUTE/202-640  AC B1A419.1
#=GS B1A443_9LUTE/202-640  AC B1A443.1
#=GS A5A2S6_BYDVP/206-650  AC A5A2S6.1
#=GS Q8V2F5_BLRV/198-650   AC Q8V2F5.1
#=GS Q2L3G5_9LUTE/198-664  AC Q2L3G5.1
#=GS E0A2S0_9LUTE/1-137    AC E0A2S0.1
#=GS B0FKK8_BYDVP/201-646  AC B0FKK8.1
#=GS B0FKV4_BYDVP/201-646  AC B0FKV4.1
#=GS Q91QQ6_9LUTE/1-514    AC Q91QQ6.1
#=GS Q8QYM7_PLRV/2-107     AC Q8QYM7.1
#=GS F8RUE1_9LUTE/198-664  AC F8RUE1.1
#=GS G3E244_9LUTE/1-257    AC G3E244.1
#=GS B0FKW0_BYDVP/201-644  AC B0FKW0.1
#=GS H1D1M3_9FIRM/93-163   AC H1D1M3.1
#=GS E0A2S3_9LUTE/1-137    AC E0A2S3.1
#=GS F8RUJ5_9LUTE/198-418  AC F8RUJ5.1
#=GS Q8QYP9_PLRV/210-699   AC Q8QYP9.1
#=GS Q7T6K8_9LUTE/1-415    AC Q7T6K8.1
#=GS B0FKX2_BYDVP/201-643  AC B0FKX2.1
#=GS B1A437_9LUTE/202-640  AC B1A437.1
#=GS Q91AV7_9LUTE/1-422    AC Q91AV7.1
#=GS Q7T6J6_9LUTE/1-415    AC Q7T6J6.1
#=GS Q5UUW8_9LUTE/197-651  AC Q5UUW8.1
#=GS C7AXX2_BYDVP/21-187   AC C7AXX2.1
#=GS O09708_PEMV1/190-471  AC O09708.1
#=GS Q84820_PLRV/1-490     AC Q84820.1
#=GS E2DRQ5_9LUTE/203-692  AC E2DRQ5.1
#=GS Q65848_9LUTE/198-637  AC Q65848.1
#=GS Q9J1A7_9LUTE/202-650  AC Q9J1A7.1
#=GS Q65862_9LUTE/1-306    AC Q65862.1
#=GS D2K8U5_9LUTE/198-265  AC D2K8U5.1
#=GS A5A2X4_BYDVP/202-651  AC A5A2X4.1
#=GS A5A334_BYDVP/202-650  AC A5A334.1
#=GS Q17S69_9LUTE/202-684  AC Q17S69.1
#=GS B3GQB0_PLRV/210-699   AC B3GQB0.1
#=GS B1A413_9LUTE/202-640  AC B1A413.1
#=GS A7XUE7_9LUTE/202-640  AC A7XUE7.1
#=GS Q7T6J4_9LUTE/1-415    AC Q7T6J4.1
#=GS A5A316_BYDVP/203-650  AC A5A316.1
#=GS B7TWC8_9LUTE/202-640  AC B7TWC8.1
#=GS Q8B6K4_9LUTE/1-518    AC Q8B6K4.1
#=GS H9NAD9_9LUTE/198-265  AC H9NAD9.1
#=GS B0FKR8_BYDVP/201-644  AC B0FKR8.1
#=GS G0YSX3_9LUTE/1-490    AC G0YSX3.1
#=GS B1A410_9LUTE/202-640  AC B1A410.1
#=GS C7AXW6_BYDVP/21-187   AC C7AXW6.1
#=GS Q8QYQ3_PLRV/2-107     AC Q8QYQ3.1
#=GS B0ZT69_9LUTE/201-655  AC B0ZT69.1
#=GS Q91AV3_9LUTE/1-422    AC Q91AV3.1
#=GS F8RUJ2_9LUTE/198-418  AC F8RUJ2.1
#=GS Q65874_9LUTE/1-306    AC Q65874.1
#=GS Q70FV4_9LUTE/1-417    AC Q70FV4.1
#=GS A5A2Y6_BYDVP/202-650  AC A5A2Y6.1
#=GS H9NAC9_9LUTE/198-265  AC H9NAC9.1
#=GS Q6STE1_BYDVP/181-421  AC Q6STE1.1
#=GS O93184_PEMV1/190-474  AC O93184.1
#=GS Q65877_BYDVR/5-449    AC Q65877.1
#=GS Q5UUX6_9LUTE/201-655  AC Q5UUX6.1
#=GS Q70FV9_9LUTE/1-414    AC Q70FV9.1
#=GS B0FKN2_BYDVP/201-646  AC B0FKN2.1
#=GS Q7T6K1_9LUTE/1-415    AC Q7T6K1.1
#=GS Q8QYP3_PLRV/210-699   AC Q8QYP3.1
#=GS B3FHC0_9LUTE/221-670  AC B3FHC0.1
#=GS Q84819_PLRV/1-490     AC Q84819.1
#=GS Q45GB7_9LUTE/204-661  AC Q45GB7.1
#=GS Q7T6K6_9LUTE/1-415    AC Q7T6K6.1
#=GS Q19A29_BYDVP/3-243    AC Q19A29.1
#=GS F8RUK7_9LUTE/198-418  AC F8RUK7.1
#=GS B0FL20_BYDVP/201-646  AC B0FL20.1
#=GS Q84822_PLRV/1-490     AC Q84822.1
#=GS C7AXW9_BYDVP/21-187   AC C7AXW9.1
#=GS B1A416_9LUTE/202-640  AC B1A416.1
#=GS E0A2S5_9LUTE/1-137    AC E0A2S5.1
#=GS G3E238_9LUTE/1-259    AC G3E238.1
#=GS Q9QQN6_9LUTE/1-467    AC Q9QQN6.1
#=GS Q7T6K9_9LUTE/1-415    AC Q7T6K9.1
#=GS A5A2T2_BYDVP/202-644  AC A5A2T2.1
#=GS Q8B6K6_9LUTE/1-519    AC Q8B6K6.1
#=GS E0A2S2_9LUTE/1-137    AC E0A2S2.1
#=GS Q8QYN6_PLRV/210-699   AC Q8QYN6.1
#=GS E0YC37_9LUTE/201-329  AC E0YC37.1
#=GS F8RUG8_9LUTE/198-418  AC F8RUG8.1
#=GS Q9IZF4_9LUTE/206-510  AC Q9IZF4.1
#=GS D2K8U0_9LUTE/198-265  AC D2K8U0.1
#=GS Q460A0_BYDVP/202-650  AC Q460A0.1
#=GS Q80FH7_9LUTE/198-664  AC Q80FH7.1
#=GS B0FL26_BYDVP/201-646  AC B0FL26.1
#=GS Q7T6K3_9LUTE/1-415    AC Q7T6K3.1
#=GS E7FL73_9LUTE/208-720  AC E7FL73.1
#=GS A5A2U4_BYDVP/202-650  AC A5A2U4.1
#=GS Q9JH75_9LUTE/2-467    AC Q9JH75.1
#=GS A7XUE2_9LUTE/202-640  AC A7XUE2.1
#=GS B0FKQ0_BYDVP/201-643  AC B0FKQ0.1
#=GS G3E232_9LUTE/1-257    AC G3E232.1
#=GS B0FKX8_BYDVP/202-650  AC B0FKX8.1
#=GS Q99AS9_BYDVM/201-655  AC Q99AS9.1
#=GS MCAPS_BYDVP/206-650   AC P09516.3
#=GS A0YD71_9GAMM/51-142   AC A0YD71.1
#=GS Q5CC80_BYDVP/201-649  AC Q5CC80.1
#=GS B0FKP4_BYDVP/201-646  AC B0FKP4.1
#=GS Q670I2_9LUTE/210-687  AC Q670I2.1
#=GS Q7T6K0_9LUTE/1-415    AC Q7T6K0.1
#=GS Q80J50_9LUTE/201-655  AC Q80J50.1
#=GS Q8B6L0_9LUTE/1-517    AC Q8B6L0.1
#=GS B0FKY4_BYDVP/202-650  AC B0FKY4.1
#=GS Q8B6L4_9LUTE/1-519    AC Q8B6L4.1
#=GS B0ZT81_9LUTE/201-655  AC B0ZT81.1
#=GS F8RUM5_9LUTE/197-418  AC F8RUM5.1
#=GS D2K8W5_9LUTE/198-265  AC D2K8W5.1
#=GS C7AXW5_BYDVP/21-187   AC C7AXW5.1
#=GS Q70FV3_9LUTE/1-417    AC Q70FV3.1
#=GS Q65972_9LUTE/201-662  AC Q65972.2
#=GS D2K8X0_9LUTE/198-265  AC D2K8X0.1
#=GS F8RUH1_9LUTE/198-418  AC F8RUH1.1
#=GS O92521_9LUTE/1-454    AC O92521.1
#=GS A5A2Z2_BYDVP/202-650  AC A5A2Z2.1
#=GS F8RUG5_9LUTE/198-418  AC F8RUG5.1
#=GS F8RUF9_9LUTE/198-664  AC F8RUF9.1
#=GS A5A328_BYDVP/202-650  AC A5A328.1
#=GS A5A2R5_9LUTE/206-511  AC A5A2R5.1
#=GS A5A310_BYDVP/202-650  AC A5A310.1
#=GS B0FKM6_BYDVP/201-644  AC B0FKM6.1
#=GS B3FGU1_9LUTE/201-663  AC B3FGU1.1
#=GS A5A2Z8_BYDVP/206-650  AC A5A2Z8.1
#=GS F8RUK1_9LUTE/198-418  AC F8RUK1.1
#=GS B3FGT5_9LUTE/201-658  AC B3FGT5.1
#=GS Q84817_PLRV/1-490     AC Q84817.1
#=GS MCAPS_PLRVW/205-698   AC P11626.3
#=GS B0ZT99_9LUTE/201-655  AC B0ZT99.1
#=GS E0A2S4_9LUTE/1-137    AC E0A2S4.1
#=GS B2BJG5_9LUTE/207-719  AC B2BJG5.1
#=GS B1A452_9LUTE/202-640  AC B1A452.1
#=GS F8RUI9_9LUTE/198-418  AC F8RUI9.1
#=GS MCAPS_PLRV1/206-698   AC P17525.2
#=GS F8RUG2_9LUTE/198-418  AC F8RUG2.1
#=GS F8RUI3_9LUTE/198-418  AC F8RUI3.1
#=GS D2K8V0_9LUTE/198-265  AC D2K8V0.1
#=GS D7EZJ0_9LUTE/201-663  AC D7EZJ0.1
#=GS Q8B6M4_9LUTE/1-439    AC Q8B6M4.1
#=GS B0FL02_BYDVP/202-650  AC B0FL02.1
#=GS Q8B6M2_9LUTE/1-519    AC Q8B6M2.1
#=GS B0FEU6_PLRV/1-107     AC B0FEU6.1
#=GS F8RUN1_9LUTE/198-418  AC F8RUN1.1
#=GS D7EZH8_9LUTE/204-660  AC D7EZH8.1
#=GS B1A431_9LUTE/202-640  AC B1A431.1
#=GS F8RUK4_9LUTE/198-418  AC F8RUK4.1
#=GS Q2L3F3_9LUTE/198-664  AC Q2L3F3.1
#=GS C6GYU8_9LUTE/203-504  AC C6GYU8.1
#=GS A5A2Q8_BYDVP/206-650  AC A5A2Q8.1
#=GS A5A2V0_BYDVP/207-650  AC A5A2V0.1
#=GS B5KLA5_9LUTE/1-422    AC B5KLA5.1
#=GS E3UIM2_BLRV/198-650   AC E3UIM2.1
#=GS D2K8T5_9LUTE/198-265  AC D2K8T5.1
#=GS B0FKN8_BYDVP/201-644  AC B0FKN8.1
#=GS F8RUL9_9LUTE/198-418  AC F8RUL9.1
#=GS O92523_9LUTE/1-453    AC O92523.1
#=GS Q70FV6_9LUTE/1-417    AC Q70FV6.1
#=GS B3GQA1_PLRV/210-699   AC B3GQA1.1
#=GS Q8B6K0_9LUTE/1-437    AC Q8B6K0.1
#=GS B0FKS4_BYDVP/201-644  AC B0FKS4.1
#=GS Q70FV7_9LUTE/1-417    AC Q70FV7.1
#=GS B5L2B7_9LUTE/204-661  AC B5L2B7.1
#=GS B1A425_9LUTE/202-640  AC B1A425.1
#=GS F8RUJ8_9LUTE/198-418  AC F8RUJ8.1
#=GS Q7T6L0_9LUTE/1-415    AC Q7T6L0.1
#=GS F8RUM2_9LUTE/198-418  AC F8RUM2.1
#=GS B0FKZ6_BYDVP/201-646  AC B0FKZ6.1
#=GS Q87035_9LUTE/1-522    AC Q87035.1
#=GS B1A449_9LUTE/202-640  AC B1A449.1
#=GS E5GAB5_9LUTE/204-663  AC E5GAB5.1
#=GS B1A446_9LUTE/202-640  AC B1A446.1
#=GS B5KLA3_9LUTE/1-422    AC B5KLA3.1
#=GS B7TWD7_9LUTE/202-640  AC B7TWD7.1
#=GS A0FLF6_BYDVP/202-650  AC A0FLF6.1
#=GS B5KLA7_9LUTE/1-422    AC B5KLA7.1
#=GS D2K8T0_9LUTE/198-664  AC D2K8T0.1
#=GS E5GAA9_9LUTE/204-663  AC E5GAA9.1
#=GS Q8B6K8_9LUTE/1-517    AC Q8B6K8.1
#=GS A5A2V6_BYDVP/207-650  AC A5A2V6.1
#=GS G8Z1W7_9LUTE/201-663  AC G8Z1W7.1
#=GS B1A434_9LUTE/202-640  AC B1A434.1
#=GS B7TWE0_9LUTE/202-640  AC B7TWE0.1
#=GS A5A2W2_BYDVP/206-650  AC A5A2W2.1
#=GS A5A2Y0_BYDVP/202-650  AC A5A2Y0.1
#=GS D2K8W0_9LUTE/198-265  AC D2K8W0.1
#=GS Q91GX4_BYDVP/1-449    AC Q91GX4.1
#=GS Q84840_PLRV/1-490     AC Q84840.1
#=GS Q8B6L6_9LUTE/1-520    AC Q8B6L6.1
#=GS Q7T6K7_9LUTE/1-415    AC Q7T6K7.1
#=GS Q5I4G6_BYDVP/201-644  AC Q5I4G6.1
#=GS Q8B6K2_9LUTE/1-363    AC Q8B6K2.1
#=GS Q84824_PLRV/1-490     AC Q84824.1
#=GS A5A323_9LUTE/206-511  AC A5A323.1
#=GS C7AXW4_BYDVP/21-187   AC C7AXW4.1
#=GS B7TWD4_9LUTE/202-640  AC B7TWD4.1
#=GS Q65846_9LUTE/198-637  AC Q65846.1
#=GS E0A2S6_9LUTE/1-137    AC E0A2S6.1
#=GS MCAPS_PEMVW/191-473   AC Q84711.2
#=GS Q6STE7_9LUTE/166-239  AC Q6STE7.1
#=GS B3GQB4_PLRV/2-107     AC B3GQB4.1
#=GS Q3YB89_9LUTE/202-640  AC Q3YB89.1
#=GS E0YC38_9LUTE/201-343  AC E0YC38.1
#=GS B0FKU8_BYDVP/201-646  AC B0FKU8.1
#=GS B0FKW6_BYDVP/201-643  AC B0FKW6.1
#=GS Q8B6L2_9LUTE/1-520    AC Q8B6L2.1
#=GS Q99GS4_PLRV/1-490     AC Q99GS4.1
#=GS B0FL08_BYDVP/202-650  AC B0FL08.1
#=GS Q70FV5_9LUTE/1-417    AC Q70FV5.1
#=GS G1K0U2_9LUTE/202-720  AC G1K0U2.1
D4P4V5_9LUTE/198-664             ..................vsd----.A.PPTPTPTPT--P-PAPTPAPA--.--SKYLG.YQGVPSNIVKTRGNSEYLDVGPLGNVTMYLWQDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYKTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFSLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVnDGAYSR....SKWDKTA.AMSARLpTQVSAPS...EVYTPETPE............................................QPTDEGTESMPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLTPTSADTLR.....QADK.....VR.....RALMANASRAAS.....................................PPPTTTEVPILG.AADTASQSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPVRS.E.TS.......................................................--TLQGGSLSGGSLRGG---.NLRALP.EATREQRREYEHLKNSRGKTVAKAHAKEH-g.......................................
B0FKR2_BYDVP/201-644             ....................v-DS-.S.TPEPTPAPAPQPAPQPAPEPTPApVPKRFFE.YIGTPMGVISTRENTDSISVSQLGGQSMQYIENEKCETRTIDSFWSTNNNVAAQAAFVYPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGIIAYSNSSD.DNWGIGNYRGCSFKNYLATNTWRPGHKD...LKLNDCQFTGGQIVERDSIISFHVEATGADACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEALRT....TRHSECP.TRVNNI.LIDEGYC...QPLSTITDQ............................................---GLCDVQTPGQDQE.VV--...............................................---.----.-.-.EEDRQTVS------..-----...............TESDTALKEYEV.....ATAE.....IP.....DAEEDALPSREQ.....................................LSSRPVDTSGEE.IPKPRPPSNEVLGVYQ....GQPIYAEDVPPGTRQKLr..dAAKAPS...........................TLLYDKT.P.KR.......................................................SKSILSRFIEGNRSSVESAApSTATTS.NLTREQLREYTRIRNTLGLTAAKEYKARL-l.......................................
F8RUL6_9LUTE/198-418             ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVL-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAI---.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
D4P4U7_9LUTE/198-265             ..................vgd----.A.PPTPTPIPTP---PAPTPAPA--.--SKYLG.YQGVPSNIVKTRGNSEYLDVGPLENVTMYLWQDESWSIEQL-------------------------.----------------------------------.----------------------------...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
Q8QYN3_PLRV/1-107                .mlekreenvknktsswkppl----.-.-----------------------.-------.------------------------------------------------------------------.----------------------------------.----------------------------...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----PKAVSPAIAKLR....SIRKSQsl.......................egGTLKKDA.T.DG.......................................................VSSIGSGSLTGGTLKRKATI.EERLLQ.TLTTEQRLWYENLKKT-NPLAATQWLFEY-q.......................................
F8RUD5_9LUTE/198-664             ..................vgd----.A.PPTPTPQPTP---PAPAPAPAP-.---KYFG.YQGVPNNTIRTRGNSEYLDVGQLDSVTMYLWKDESWSIEQLPAGYRVNTQDRAIPYLLIPVEKGKY.SVFIQCEGFKAVKAKGGTNNGKMSGFICDNINL-.QGWRAYAYSGCSISNYKTADSNVPGHPD...MRVNNCSFTD-QLVERDFSCSFHLEVP-QKGYFGLEAPPIEKSDHFNFVVSYANFTEKTMEWGSVSIAIDEVsDGAYSG....SKWDKTT.AMSARLrDLVSAPS...EVYTPVALV............................................SSADEGTGNTPLAPNP.ALGPdnpatkepap...........................kivdspdpkvLNW.LNNQ.K.D.EPVVNEVLRESPIY..APPPP...............PSLGHSHVDTQR.....QADK.....VR.....RSLMANASRSAS.....................................PPPAATEVPVLG.SVDTVSQGSTLRGGSL....RGNLNSRPSLPRV----....ADSPPR...........................SVSPARS.E.TS.......................................................--TLQVGSLSGGSLRGG---.SLQVLP.EATREQRRQYESLKNSQGKTVAKNYAKE--qg......................................
Q70FV1_9LUTE/1-414               ....................e----.-.-----------------------.-------.------------------------NVTMYLWKDESWSIEQLPAGYRVNNRERAIPFVLFPVDKGRY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTVSNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGHFGLEAPPIEKSDHFNFVVSYANFTDKIMEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYTPEAPE............................................ESENEGTESTPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLTPTSADTLR.....QADK.....VR.....RALMANASRSAS.....................................PPPSTTEVPVLG.ATDTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPARS.E.TS.......................................................--TLQGGSLGGGSLRGG---.NLQVLP.EATREQRREYERLKNSQGKTVARAHA----r.......................................
Q99GS1_PLRV/1-490                .....................VDSR.S.EPGPS--------PQPTPTPTPQ.KHERFIA.YVGIPMLTIQARENDDQIILGSLGNQRMKYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNADS.DYWNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP-TDGRFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEH.LEGSGS....ANRVRRP.PREGHT.YMASPRE...PEGKPVENKprd.....................................etpiQTQERQPDQTPSDDVS.DAGS...............................................VNS.GGST.E.S.LRLEFGVNSDNTYD..ATVDG...............TDWPRIPPPRHP.....PEPR.....VS.....GNSRTVTDFS--.....................................TKADLLENWDAEhFDPGYSKEDVAAATII....AHVSIQDGRSMLEKREEn..iKNKTSSwkpplpkavspaiaklrsirksqplegG------.-.-Tlkkd...............................................atdgVSSIGSGSLTGGTLKRKATI.EERLLQ.TLTTEQRLWYENLKKT-NPLAATQWLFEY-q.......................................
Q8QHP7_PLRV/1-107                .....mlekreenvknktssw----.-.-----------------------.-------.------------------------------------------------------------------.----------------------------------.----------------------------...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-KPPLPKAVSPAIAKLRs..iRKSQPLe.........................gGTLKKDA.T.DG.......................................................VSSIGSGSLTGGTLKRKVTI.EERLLQ.TLTTEQRLWYENLKKT-NPPAAIQWLHEY-q.......................................
F8RUL0_9LUTE/198-418             ....................v-DD-.A.PPTPTPTPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIGQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAI---.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
C7AXW3_BYDVP/21-187              ..............vdsstpe--PK.P.APEPTPTPQPTPAPQPAPEPTPApVPKRFFE.YIGTPTGTISTRENSDSISVSKLSGQSMQYIENEECETKVIDSFWSINNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGH--...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
A5A304_BYDVP/203-650             ...............dsstpe--PK.P.APEPTPTPQPTPAPQPSPEPTPApVPKRFFE.YIGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEAERI....TRHAETP.IRSKHI.LVSEQYE...QPLPTIIDQ............................................---GLCDVQTPEQEQT.L---...............................................---.----.V.D.EEDKQTVS------..-----...............TEPDIALMEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPMDTSGNK.IPK--PKEPEVLGTYQ....GQNIYPEDVPPIARQKLr..eAANAPS...........................TLLYERT.P.KK.......................................................GNNFLTRFLEANRSPTTPAApTVSTIS.NMTREQLAEYTRIRKSLGLTAAKEYKAQF-q.......................................
Q7T6K5_9LUTE/1-387               .....................----.-.-----------------------.-------.-------------------------VTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPX...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpAQVSAPS...EVYTPEAPE............................................QPTNEGTESMPPAPNP.ALGP...............................................---.-DNP.A.T.KEPAPKI----VDN..PDPNP...............PSLVPTHADTLR.....QADK.....VR.....RALMANASRSAS.....................................PPPTNTEVPVLG.ATDTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPARS.E.TS.......................................................--TLQGGSLSGGSLRGG---.NLRALP.EATREQRREYERLKNSQGKTVAKAHAKEH-g.......................................
B1A428_9LUTE/202-640             .....................VDGE.P.GPKPGPDPTPP--PAPPPEPTPA.KHERFIV.YTGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQT.KVWNIGVQNNVTISNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTGPNASFFLAGPAVKKIAKYNYCISYGAWTDRDMEFGMVSVVLDEH.LEGVRG....SQYVRKT.LRPGHI.SVNRTHR...LQEMPPMRE............................................DFSEEDNSSSDS-NTY.KADN...............................................SPL.TVHL.V.K.AGDEENYTTDRSDD..VEPTL...............HDADVMK-----.....FSGF.....VG.....AKDRFTLQGADPi...................................gPGDRSVRRFRPS.ATLKSAFH--------....-----------------....SGPTPD...........................ELYNAGA.E.QAdhd.................................................fehFVSRGKEKLQDEDPMAKLER.EAEDLK.PDSDNEDNDYDRTAPVFNPADGDPWS----gik.....................................
Q45ZY5_BYDVP/202-650             ..............vdsstpe--PK.P.APEPTPTPQPTPAPQPAPEPTPApVPKRFFE.YIGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SINISCEGFQSVDHIGGNEDGYWIGMIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTFDESdVEAKRI....TRHAETP.IRSKHI.LVSERYE...EPLPTITNQ............................................---GLCDVKTPEQEQT.L---...............................................---.----.V.D.EEDRQTVS------..-----...............TEPDVALQEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPLDTSGNI.IPK--SKEPEVLGTYQ....GQNIHPEDVPPLARQRLr..eAAKAPS...........................TLLYERT.P.KK.......................................................SNNFLTRFVEANRSPTTPAApTVSTTS.NMTREQLAEYTRIRKSLGLTAAKEYKAQF-q.......................................
B0FL14_BYDVP/201-646             .....................VDSStP.EPKPTPAPTPAPAPEPKPEPTPApPPKRFFE.YVGTPVGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEASGKDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEALRM....TRHSECP.TSTNNI.LIDEGYC...QPLSTITDQ............................................---GLCDVQTPSQDQE.VV--...............................................---.----.-.-.EEDRQTVS------..-----...............SESDIALKEYEA.....ATAV.....IP.....DAEEDALPSREQ.....................................LSSKPVDTSGAK.IPRSKSPTNEVLGVYQ....GQSIYAEDVPPGTRQKLr..dASKAPS...........................TLLYDKT.P.KR.......................................................SKSILSRFIEGNRSSVESAApSTATTS.NLTREQLREYTRIRNTLGLTAAKAYKAQF-s.......................................
Q91QP6_9LUTE/1-439               .....................VDGE.P.GPKPGPDPTPP--PAPPPEPTPA.KHERFIV.YTGTLSTLISARQNSDSISLYSIRDQRIRYIENENANWANIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGVIAYDDDQN.KVWNVGVQNNVTITNNKADADWKYGHPD...LTINGERFDQRQVVEKDGTISFHLVTTGPNASFFLVGPPVKKIAKYNFCISYGAWTDRDMEFGLVSVVLDEH.LEGVRG....SQYVRKT.LRPGHI.SVNRSHR...LQEMPPMRE............................................DFSEEDNSSSDSNTY-.KTDN...............................................SPM.TVHF.V.K.AGDKESYTTDQSDD..VEPSP...............HDADVMK-----.....FSGF.....VG.....AKDRFVLQGADPi...................................gPGDRSVRRFKPS.ATLKSAFH--------....-----------------....SGPTPD...........................ELYNAGA.E.QAdhd.................................................fehFVSRGKEKLQDEDPMAKLER.EAEDLK.PDSDNEDNDYDRTAPVFNPADGDPWS----gik.....................................
F8RUM8_9LUTE/198-418             ....................v-DD-.A.PPTPPPTPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAI---.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
B0ZT75_9LUTE/201-655             .....................VDSStP.EPSPQPQPEPKPDPQPTPEPQ--.-HKRFFE.YVGTPYVIIQTRESSDSIAVKSMNDQSFQYIENETSEQRTVQAWWTSNNGVQAQAAFVFPIPAGEY.SVNISCEGLQSVDHIGGNRDGYWIGLIAYQNQSG.DYWGVGNYAGCDITNLLGTNTWRPGRED...LELNGCKFTNGQIVERDAVISFHVKAQGADPKFYLMAPKTMKSDKYNYVVSYGGYTDKRMEFGSISVTVDESdVEAQRY....NRHTSTV.RKTEN-.-RDYGWM...SVLPPYDPN............................................--------QMPEQEEE.QPMV...............................................DKE.MDSRpP.V.EPLSPTSDTEAERA..FDLRE...............EELTRARLEYEA.....ATES.....IP.....DAAPDILPSKSE.....................................MSSRLIDHDGRS.LPK--PQSKEVLGTYQ....GQNITPDDVPPVIAEKLr..eVSRAPS...........................TLLYDRQ.P.KT.......................................................PKSFLSRFVETNKTSLASPG.SQSSTS.GMTREQASEYTRIRKSMGLTAAKEHKASL-a.......................................
Q8QYM9_PLRV/210-699              ...................vd--SG.S.EPGPS--------PQPTPTPTPQ.KHERFIA.YVGIPMLTIQARENDDQIILGSLGNQRMKYIEDENRSYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNADS.DYWNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP-TDGRFFLVGPAVQKTAKYNYTISYGDWTDRDMELGLITVVLDEH.LEGTDS....ANRVRRP.PREGHT.YMASPRE...PEGKPVGNKprd.....................................etpiQTQERQPDQTPSDDVS.DAGS...............................................VNS.GGST.E.S.LRLEFGVNSDSTYD..ATVDG...............TDWPRIPPPRHP.....PEPR.....VS.....GNSRTVTDFS--.....................................PETDLLENWDAKhFDPGYSKEDVAAATII....AHGSIQDGRSMLEKREEn..vKNKTSSwkpplskavspaiaklrsirksqplegGTLNKDA.T.DG.......................................................VSSIGSGSLTGGTLKRKVTI.EDRLLQ.TLTTEQRLWFENLKKT-NPPAATQWLYEY-q.......................................
C7AXX1_BYDVP/21-187              ..............vdsstpe--PK.P.APEPTPTPQPTPAPQPAPEPTPApVPKRFFE.YIGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGH--...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
F8RUL3_9LUTE/198-418             ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KYLG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGANDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAI---.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
D3JXR4_9LUTE/198-664             ....................v-DD-.A.PPTPTPQPTP---PAPAPAPAP-.---KYFG.YQGVPNNIIKTRGNSEYLDVGQLDSVTMYFWKDESWSIEKLSAGYRVNTRDRAIPYLLIPVEKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFICDNVNL-.QGWRAYAYTGCSISNYKTADSNVLGHPD...MRVNNCSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSCANFTEKIMEWGSVSIAIDEVnDGAYSG....SKWDKTT.ALRARLrNQVSAPS...EVYTPVALE............................................SSADEGTGSTPLAPNP.ALGPdnpatkepap...........................kivdspdpkvLNW.LNNQ.K.D.EPVVNEVLRESPIY..APPPP...............PSLGHTHVDTQR.....QADK.....VR.....RSLMANASRSTS.....................................PPPVATEVPVLG.SADTASLGSTLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................PVSPARS.E.TS.......................................................--TLQAGSLSGGSLRGG---.SLQVLP.EATREQRRQYESLKNSQGKTVAKNYAKE--qg......................................
A5A2Q2_BYDVP/202-652             ...........vdsstpepkp---A.P.EPEPTPTPGPTPAPQPTPEPTPApAPKRFFE.YVGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYRGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGNDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEAKRI....TRHAETP.IRYKHI.LVSERYE...EPLPTITDQ............................................---GLCDVKTPEQEQT.L---...............................................---.----.V.D.EEDRQTVS------..-----...............TEPDIALQEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPLDTSGNI.IPK--SKEPEVLGTYQ....GQNIYPEDVPPLARQRLr..eAAKAPS...........................TLLYERT.S.KK.......................................................SNNFLTRFMEANRSPTTPAApTVSTTS.NMTREQLAEYTRIRKSLGLTAAKEYKAQF-q.......................................
F8VCF6_9LUTE/202-635             .....................VDGE.P.GPKPGPDPAPQ--PTPTPEPTPA.KHERFIA.YTGTLSTLISARQSSDSISLYSIRSQRIRYIEDENSSWTNIDAKWYSQNSVEAIPMFVYPVPEGTW.SIEISCEGYQAASSTSDPHRGKCDGMIAYDDDSS.KVWNVGQQNNVTITNNKADNDWKYGHPD...LTINGDRFDQNQVVEKDGIISFHLVTTGPNASFFLVAPAVKKTAKYNFCVSYGDWTDRDMEFGMVSVVLDEH.LEGARS....SQYVRKT.LRPGHI.SVNRSHR...LQEMPPTRE............................................DFSEEDNGSSVNTYIT.DN--...............................................--S.PITV.H.L.VDNEENYTTDQSDD..VDPTL...............RDAEVMK-----.....FAGF.....VG.....AKDRFALQGAKPi...................................gPGDRSIRRFKPS.ATLKSAFH--------....-----------------....LGPTPD...........................ELYNAGA.E.QAdhd.................................................fehFVSRGKEKLQEEDPMAKLER.EVEDLK.PDSDNEGNDYDQTA----------------lfnpadgdpwsgi...........................
Q7T6J7_9LUTE/1-415               .....................----.-.-----------------------.-------.-------------------------VTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYTPEAPE............................................QPTNEGTESMPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLVPTHVDTLR.....QADK.....VR.....RALMANASRSAS.....................................PPPTNTEVPVLG.ATDTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPARS.E.TS.......................................................--TLQGGSLSGGSLRGG---.NLRALP.EATREQRREYERLKNSQGKTVAKAHAQEH-g.......................................
F8RUE7_9LUTE/198-664             .................vgda----.-.PPTPHPTP--TP-PAPTPAPA--.--LKYLG.YQGVPNNIVKTRGNSEYLDVGPLGNVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKIDHFNFVVSHANFTDKILEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYTPEAPE............................................QPADEGTESMPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLTPTSADTLR.....QADK.....VR.....RALMANASRAAS.....................................PPPTTAEVPILG.ATDTASQSGSLRGGSL....RGNLGFRPSLPRV----....ADSPPR...........................SVSPVRS.E.TS.......................................................--TLQGGSLSGGSLRGG---.NLQVLP.EATREQRREYERLKNSQGKTVARAHAKEH-g.......................................
F8RUF3_9LUTE/198-664             ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYTPEAPE............................................QPTTEGTESMPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLVPTHADTLR.....QADK.....VR.....RALMANASRSAS.....................................PPPTNTEVPVLG.ATDTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPARS.E.TS.......................................................--TLQGGSLSGGSLRGG---.NLQALP.EATREQRREYERLKNSQGKTVAKAHAKEH-g.......................................
B0ZT93_9LUTE/201-655             .....................VDSStP.EPTPQPQPEPKPDPQPTPEPQ--.-HKRFFE.YVGTPYVIIQTRESSDSIAVKSMNDQSFQYIENETSEQRTVQAWWTSNNGVQAQAAFVFPIPAGEY.SVNISCEGLQSVDHIGGNRDGYWIGLIAYQNQSG.DYWGVGNYAGCDITNLLGTNTWRPGHED...LELNGCKFTNGQIVERDAVISFHVKAQGADPKFYLMAPKTIKSDKYNYVVSYGGYTDKRMEFGSISVTVDESdVEAQRY....NRHTSTV.RKTEN-.-RDYGWM...SVLPPYDPN............................................--------QVPEQEEE.QPMV...............................................DKE.MYSR.SpV.EPPSPTSDTEAERA..FDLRE...............EELTRARLEYEA.....ATES.....IP.....DAAPDILPSKSE.....................................MSSRPIDHDGRS.LPK--PQSKEVLGTYQ....GQNITPDDVPPVIAEKLr..eVNRAPS...........................TLLYDRQ.P.KT.......................................................PKSFLSRFVETNKTSLASPG.SQSSTS.GMTREQASEYTRIRKSMGLTAAKEYKASL-a.......................................
Q7T6J9_9LUTE/1-415               .....................----.-.-----------------------.-------.-------------------------VTMYLWKDESWSIEQLSAGYRVNNRERAIPSVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYTPEAPE............................................QPTNEGTESMPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLVPTHADTLR.....QADK.....VR.....RALMANASRSAS.....................................PPPTNTEVPVLG.ATDTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPARS.E.TS.......................................................--TLQGGSLSGGSLRGG---.NLQALP.EATREQRREYERLKNSQGKTVARAHAKEH-g.......................................
F8RUN4_9LUTE/198-418             ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLGVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYVYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAI---.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
B0FKT6_BYDVP/201-646             .....................VDSStP.EPKPTPAPTPAPTPEPKPEPTPApPPKRFFE.YVGTPIGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEASGKDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEALRM....TRHSECP.TRVNNI.LIDEGYC...QPLSTITDQ............................................---GLCDVQTPGQDQE.VV--...............................................---.----.-.-.EEDRQTVS------..-----...............TESDIALKEYEA.....ATAE.....IP.....DAEEDALPSREQ.....................................LSSKPVDTSGEE.IPKPRPPSNEVLGVYQ....GQPIYADDVPPGTRQKLr..dAAKAPS...........................TLLYDKT.P.KR.......................................................SKSILSRFIEGNRSSVESAApSTATTS.NLTREQLREYTRIRNSLGLTAAKEYKARL-l.......................................
B7TWC5_9LUTE/202-640             .....................VDGE.P.GPKPGPDPTPP--PAPPPEPTPA.KHERFIV.YTGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQN.KVWNVGVQNNVTISNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTGPNASFFLVGPPVKKIAKYNYCISYGAWTDRDMEFGMVSVVLDEH.LEGVRG....SQYVRKT.LRPGHI.SVNRSHR...LQEMPPTRE............................................D-FSEEDSSSSDSNTY.KTDN...............................................SPL.TVHL.V.K.AGDEENYTTDRSDD..VEPTL...............HDADVMK-----.....FSGF.....VG.....AKDRFVLQGADPi...................................gPGDRSVRRFRPS.ATLKSAFH--------....-----------------....SGPTPD...........................ELYNAGA.E.QAdhd.................................................fehFVSRGKEKLQDEDPMAKLER.EAEDLK.PDSDNEDNDYDRTAPVFNPADGDPWS----gin.....................................
H9NAD4_9LUTE/198-265             ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQL-------------------------.----------------------------------.----------------------------...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
Q84815_PLRV/1-490                ...................vd--SG.S.EPGPS--------PQPTPTPTPQ.KHERFIA.YVGIPMLTIQARENDDQIILGSLGSQRMKYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNADS.DYWNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP-TDGRFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEH.LEGTGS....ANRVRRP.PREGHT.YMASPRE...PEGKPVGNKprd.....................................etpiQTQERQPDQTPSDDVS.DAGS...............................................VNS.GGST.E.S.LQLEFGINSDSTYD..ATVDG...............TDWPKIPPPRHP.....PEPR.....VS.....GNSRTVTDFS--.....................................PKADLLENWDAEhFDPGYSKEDVAAATII....AHGSIQDGRSMLEKREEn..vKNKTSSwkppspkavspa..iaklrsirksqplE------.-.-Ggtlkk.............................................datdgVSSIGSGSLTGGTLKRKATI.EERLLQ.TLTTEQRLWYENLKKT-NPLAATQWLFEY-q.......................................
D4P4W7_9LUTE/198-664             ..................vxd----.A.PPTPTPIPT---PPAPTPAPA--.--SKYLG.YQGVPSNIVKTRGNSEYLDVGPLENVTMYLWQDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYKTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-RQGYFSLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVnDGAYSR....SKWDKTA.AMSARLpTQVSAPS...EVYTPETPE............................................QPTDEGTESMPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLTPTSADTLR.....QADK.....VR.....RALMANASRAAS.....................................PPPXTTEVPVLG.AXDTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPVRS.E.TS.......................................................--TLQGGSLSGGSLRGG---.NLRALP.EATREQRREYEHLKNSRGKTVAKAHAKEH-g.......................................
Q91QR1_9LUTE/1-519               .....................VDGE.P.GPKPGPDPAPQ--PTPTPEPTPA.KHERFIA.YTGTLSTLISARQSSDSISLYSIRSQRIRYIEDENSSWTNIDAKWYSQNSVEAIPMFVYPVPEGTW.SIEISCEGYQAASSTSDPHRGKCDGMIAYDDDSS.KVWNVGQQNNVTITNNKADNDWKYGHPD...LTINGDRFDQNQVVEKDGIISFHLVTTGPNASFFLVAPAVKKTAKYNFCVSYGDWTDRDMEFGMVSVVLDEH.LEGARS....SQYVRKT.PRSGHV.GVNRSHR...LQDNFVPTEyvs.....................................dedsSSNSSIVSNRPSTPDN.DSDAkfaesmkg..............................klpsqtklpPKG.FLSQ.L.S.TKEKKEISNSKPSN..VEGLV...............GPLVAAY--GYP.....SQTG.....VH.....DAAREILQAKEAaenlaelerdlkeink....leppdvivqeeipdfvpPSEKILKEDDPD.YVPPIWHNADQAVLVS....SYEPPDWSRPAYE----....SGDPPK...........................KTGTLKG.T.LSkl...................................................ggSLRSGESSLRGSLRKTQDQTdLDNKLS.KLSVIQRSRYQRILNNLGKMRARTYIDGL-d.......................................
Q7T6K4_9LUTE/1-415               .....................----.-.-----------------------.-------.-------------------------VTMYLWQDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYKTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFSLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVnDGAYSR....SKWDKTA.AMSARLpTQVSAPS...EVYTPETPE............................................QPTDEGTESMPPAPNP.ALGPdnpatkepts...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLTPTSADTLR.....QADK.....VR.....RALMANASRAAS.....................................PPPTTAEVPILG.AXDTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPVRS.E.TS.......................................................--TLQGGSLSGGSLRGG---.NLRALP.EATREQRREYERLKNSQGKTVAKAHAKEH-g.......................................
D4P4W1_9LUTE/198-664             ..................vsd----.A.PPTPTPTPT--P-PALTPAPA--.--SKYLG.YQGVPSNIVKTRGNSEYLDVGPLENVTMYLWQDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYKTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFSLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVnDGAYSR....SKWDKTA.AMSARLpTQVSAPS...EVYTPETPE............................................QPTDEGTESMPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLTPTSADTLR.....QADK.....VR.....RALMANASRAAS.....................................PPPXTTEVPVLG.AADTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPVRS.E.TS.......................................................--TLQGGSLSGGSLRGG---.NLRALP.EATREQRREYEXLKNSXGKTVAKAHAKEH-g.......................................
Q91IC7_BYDVP/1-449               ..............vdsstpe--PK.P.APEPTPTPQPTPAPQPAPEPTPApVPKRFFE.YIGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGMIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTFDESdVEAKRI....TRHAETS.IRSKHI.LVSERYE...EPLPTITNQ............................................---GLCDVKTPEQEQT.L---...............................................---.----.V.D.EEDRQTVS------..-----...............TEPDIALQEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPLDTSGNI.IPK--SKEPEVLGTYQ....GQNIYPEDVPPLARQRLr..eAAKAPS...........................TLLYERT.P.KK.......................................................SNNFLTRFVEANRSPTTPAApTVSTTS.NMTREQLAEYTRIRKSLGLTAAKEYKAQF-q.......................................
F8RUI6_9LUTE/198-418             ..................vgd----.A.PPTPTPTPT---PPALTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLKNVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCIISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVAHANFTDKILEWGSISVAI---.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
Q2L3F9_9LUTE/198-664             ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLPAGYRVNNRERAIPFVLFPIDKGRY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTVSNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKIMEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYNPETPE............................................ESENEXTESTPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLTPTSADTLR.....QADK.....VR.....RALMANASRSAS.....................................PPPSTTEVPVLG.ATDTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPARS.E.TS.......................................................--TLQGGSLGGGSLRGG---.NLQVLP.EATREXRREYERLKNSQGKTVARAHAREH-g.......................................
B0FKU2_BYDVP/201-646             .....................VDSStP.EPKPTPAPTPAPTPEPKPEPTPApPPKRFFE.YVGTPIGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEASGKDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEALRM....TRHSECP.TRVNNI.LIDEGFC...QPLSTTTDQ............................................---GLCDVQTPGQEQE.VV--...............................................---.----.-.-.EEDRQTVS------..-----...............TGSDIALMEYEA.....ATAE.....IP.....DAEEDALPSREQ.....................................LSSKPVDTSGEE.IPKPRPPNNEVLGVYQ....GQPIYAEDVPPGTRQKLr..dAAKAPS...........................TLLYDKT.P.KR.......................................................SKSILSRFIEGNRSSVESAApSTATTS.NLTREQLREYTRIRNTLGLTAAKAYKAQF-s.......................................
Q9IZG0_BYDVP/202-650             ..............vdsstpe--PK.P.APEPTPTPQPEPAPQPAPEPTPApVPKRFFE.YIGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSTG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEAERI....TRHAETP.IRSKHI.LVSEQYE...QPLPTIIDQ............................................---GLCDVQTPEQEQT.L---...............................................---.----.V.D.EEDKQTVS------..-----...............TEPDIALMEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPVDTSGYK.IPK--PKEPEVLGTYQ....GQNIYPEDVPPIARQKLr..eAANAPS...........................TLLYERA.P.KK.......................................................SHNFLTRFVEANRSPTTPAApTVSTVS.NMTREQLAEYTRIRKSLGLTAAKEYKAQF-q.......................................
F8RUC3_9LUTE/198-664             ....................v-DD-.A.PPTPTPTPTP---PAPTPAPA--.--SKYLG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNNGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYTPETPE............................................QPANEGTESMPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLTPTSADTLR.....QADK.....VR.....RALMANASRATS.....................................PPPTTAEVPILG.ATDTASRSGSLRGGSL....RGNLGFRPSLPRV----....ADSPPR...........................SVSPVRS.E.TS.......................................................--TLQGGSLSGGSLRGG---.NLQVLP.EATREQRREYERLKNSQGKTVAKAHAKD--hg......................................
B0FKZ0_BYDVP/201-646             .....................VDSStP.EPKPTPAPTPAPTPEPKPEPTPApPPKRFFE.YVGTPIGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEASGKDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEALRM....TRHSECP.TRANNI.LIDEGFC...QPLSTITDQ............................................---GLCDVQTPGQEQE.VV--...............................................---.----.-.-.EEDRQTVS------..-----...............TESDIALKEYEA.....ATAE.....IP.....DAEEDALPSREQ.....................................LSSKPVDTSGEE.IPKPRPPSNEVLGVYQ....GQPIYADDVPPGTRQKLr..dAAKAPS...........................TLLYDKT.P.KR.......................................................SKSILSRFIEGNRSSVESAApSTATTS.NLTREQLREYTRIRNTLGLTAAKAYKAQF-s.......................................
C8CBB0_9LUTE/203-692             ...................vd--D-.G.PPPPGPSP------PPSPSPPPP.VPSRFWG.YEGNPQCKILTAENNRNIDSRPLNFVSMYKWEDEKWDKVNLQAGYSRNDRRCMETYFVIPASRGKF.HVYLEADGEFVVKHIGGDCDGNWLGNIAYDVSQ-.RGWNIGDYKGCRISNYQSNTVFVAGHPD...AEMNGKHFDAARAVEVDWFASFELTCDDEDGAWRIYPPPIQKDSSYNYTVSYGDYTEKYCEWGAVSVSIDE-.--DNST....GTKSRIK.PHKGVM.MWSYPEK...ENSEGESES............................................ETDQGKDLKTPDATTL.VDFEsddnsssksaesipdntdlnpwnavvssksdrpfkqeddrvstssrlS--.----.-.-.--------------..-----...............---------GNL.....RRPG.....SG.....NPQLRSPLGREKapepsesdldaarikglpppreqlpgfkptrsistfnPEPDLVEAWRPG.TGPGYSKEDVAAATIL....AHGSIADGRSMLDKRDQ....------...........................EVLRSRS.S.WG.......................................................----TGGFLKKMKTSSSD--.KAEKLA.KLSTAERREYELIKNSSGKTQAALFLEQ--kv......................................
Q8JZ09_9LUTE/204-661             .....................VDEE.P.GPSPG--------PSPSPQPTPQ.KKYRFIV.YTGVPVTRIMAQSTDDAISLYDMPSQRFRYIEDENMNWTNLNSRWYSQNNLKAIPMIIVPVPQGEW.TVEISMEGYQPTSSTTDPNKDKQDGLIAYNDDLN.EGWNVGIYNNVEITNNKADNTLKYGHPD...MELNNCHFNQGQCLERDGDLTCHVKTTGDNASFFIVGPAVQKQSKYNYAVSYGAWTDRMMEIGMIAIALDEQ.--GSSG....STRTQRP.KRAGHS.MAVSTWE...TINYPEKENse........................................itETSQRQDFKTPLHISE.SSDPlevgkg...................................gmplpaDEN.IPDF.V.G.DDPWFEISTRKSQE..EEAMS...............HSSVLKP---QL.....KPPG.....LP.....KPQPVRTIRDFD.....................................PKPDLVEAWRPD.VNPGYSKEDVAAATVM....YGGSVHEGRSMIDKRDK....------...........................AVLDGRK.R.WG.......................................................--SSLASSLTGGTLKASA--.KSEKLA.KLTSSERAQFERIKRQQGATRASEFLEQL-l.......................................
B5L2B9_9LUTE/204-661             .....................VDKE.P.GPSPG--------PSPSPQPAPS.KKYRFIV.YTGVPVTRIMAQSTDDAISLYDMPSQRFRYIEDENMNWTNLDSRWYSQNSLKAIPMIIVPVPQGEW.TVEISMEGYQPTSSTTDPNKDKQDGLIAYNDDLK.EGWNVGVYNNVEITNNKADNTLKYGHPD...MELNSCHFNQGQCLERDGDLTCHVKTTGDNASFFVVGPAVQKQSKYNYAVSYGAWTDRMMEIGMIAIALDEQ.--GSSG....SAKIERP.KRVGHS.MAVSTWE...TINLPEKENse........................................efKTDQRQDLKTHPAAGG.SSDMld...........................................ivQGG.LPLP.V.E.EDIPDSIMDDPWSN..IPAKS...............SQEDEAMTSKSG.....FKPQ.....LK.....PPGLPRPQPVRTir................................nfdPEPDLVEAWRPD.VNPGYSKEDVAAATVM....YGGSVKEGRSMIDKRDK....------...........................AVLDGRK.S.WG.......................................................--SSLASSLTGGTLKASA--.KSEKLA.KLTSSERAQFERIKRQQGATRASEFLEQL-l.......................................
Q65849_BYDVP/1-449               ..............vdsstpe--PK.P.APEPTPTPQPTPAPQPAPEPTPApVYKRFFE.YIGTPTGTISTRENSDSISVSKLGGQSMQYIENEICETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEAERI....TRHAETP.IRSKHI.LVSEQYE...QPLPTIIDQ............................................---GLCDVQTPEQEQT.L---...............................................---.----.V.D.EEDKQTVS------..-----...............TEPDIALMEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSFRPVDTSGNK.IPK--PREPEVLGTYQ....GQNIYPEDVPPIARQKLr..eAANAPS...........................TLLYERT.P.KK.......................................................SSNFLTRFVEANRSPTTPAApTVSTAS.NMTREQLAEYTRIRRSLGLTAAKEYKAQF-q.......................................
B0FKM0_BYDVP/201-644             .....................VDSStP.EPKPTPAPTPPPQPEPKPEPTPApPPKRFFE.YVGTPTGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVQASGKDACFYIMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEALRM....SRHSESP.TRVNNI.LIDEGYH...QTLSPIQNL............................................---GLCDVQTPGQDEV.EE--...............................................---.----.-.-.-DDKQTVS------..-----...............TEPDIALQEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPVDTSGEV.IPKPPPKDNEILGVYQ....GQPIYSDDVPPIARQKLr..dAAKAPS...........................TLLYDKA.P.KS.......................................................-KSFLSRFVEGNRSKTETTApSTATTS.NLTREQLREYTRIRKTLGLTAAREYKAQF-s.......................................
Q70FV0_9LUTE/1-417               ....................e----.-.-----------------------.-------.------------------------NVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYTPEAPE............................................QPTNEGTESMPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLVPTHADTLR.....QADK.....VR.....RALMANASRSAS.....................................PPPTSTEVPVLG.ATDTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPARS.E.TS.......................................................--TLQGGSLSGGSLRGG---.NLQALP.EATREQRREYERLKNSQGKTVARAHAKEH-g.......................................
B0FKQ6_BYDVP/201-644             .....................VDSStP.EPKPTPAPTPPPQPEPKPEPTPApPPKRFFE.YVGTPIGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVQASGKDACFYIMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEALRM....SRHSESP.TRVNNI.LIDEGYH...QTLSPIQNL............................................---GLCDVQTPGQDEV.EE--...............................................---.----.-.-.-DDKQTVS------..-----...............TESDIALQEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPVDTSGEE.IPKPPPRDNEILGVYQ....GQPIYADDVPPIARQKLr..dAAKAPS...........................TMLYDKA.P.KS.......................................................-KSFLSRFVEGNRSKVENTApSTATTS.NLTREQLREYTRIRNSLGLTAAREYKAQF-s.......................................
D0EX81_9LUTE/198-265             ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQL-------------------------.----------------------------------.----------------------------...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
Q45ZZ5_BYDVP/202-650             ..............vdsstpe--PK.P.APEPTPTPQPTPAPQPAPEPTPApVPKRFFE.YIGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SINISCEGFQSVDHIGGNEDGYWIGMIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTFDESdVEAKRI....TRHAETP.IRSKHI.LVSERYE...EPLPTITNQ............................................---GLCDVKTPEQEQT.L---...............................................---.----.V.D.EEDRQTVS------..-----...............TEPDIALQEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPLDTSGNI.IPK--SKEPEVLGTYQ....GQNIYPEDVPPLARQRLr..eAAKAPS...........................TLLYERT.P.KK.......................................................SENFLTRFVEANRSPTTPAApTVSTTS.NMTREQLAEYTRIRKSLGLTAAKEYKAQF-q.......................................
G8Z1X3_9LUTE/201-663             .....................VDGS.S.PPPPSPSPTPPPPPPPQPQPQPC.AQ-RFWG.YEGNPQNKILTAENSRNIDSRPLNFVQMYKWEDEKWDKVNLQAGYSRNDRRCMETYLTIPADKGKF.HVYLEADGEFVVKHIGGELDGSWLGNIAYDVSQ-.RGWNIGNYKGCKIKNYQSNTTFVAGHPD...ATMNSKSFDSARAVEVDWYASFELECDDEEGSWAIYPPPIQKDSSYNYTVSYGNYTEKYCEWGAISVSIDED.----NN....GSAPRRI.PRKGAM.-AWSTPE...PSFSGDESQ............................................----RQDSKTPSPEER.GSDTlesetkke..............................eanlqvafeEEN.IPDV.E.D.EDIWKGISRGSETE..TTEDD...............RASTSSRLRGNL.....KPQG.....LP.....KPQPTRTITQFN.....................................PNPDLVEAWRPD.LAPGYSKADVAAATVI....AGGSIHEGRDMLRRREE....------...........................SVMDSRK.K.WG.......................................................-VLSSASTLTSGSLKKLS-A.QSEKLA.KLTTGERREYERIKNSQGKTVAAEYLE---lvl.....................................
F8RUC9_9LUTE/198-664             ..................vgd----.A.PPTPTPTPT---PPAPTPAPA--.--SKYLG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYTPETPE............................................QPADEGTESMPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLTPTSADTLR.....QADK.....VR.....RALMANASRATS.....................................PPPTTAEIPIHG.ATDTASQSGSLRGGPL....RGNLGFRPSLPRV----....ADSPPR...........................SVSPVRS.E.TS.......................................................--TLQGGSLSGGSLRGG---.NLQVLP.EATREQRREYERLKNSQGKTVAKAHAKEH-g.......................................
Q8QYR8_PLRV/210-699              ...................vd--SG.S.EPGPS--------PQPTPTPTPQ.KHERFIA.YVGIPMLTIQARENDDQIILGSLGSQRMKYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNADS.DYWNVGEADGVKISKLCNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP-TDGRFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEH.LEGTGS....AYRVRRP.PREGHT.YMASPRE...PEGKPVGNKprd.....................................etpiQTQERQPDQTPSDDVS.DAGS...............................................VNS.GGST.E.S.LQLEFGPNSDSTYD..ATVDG...............TDWPRIPPPRHP.....PKPR.....VS.....GDSRTVTDFS--.....................................PKADLLENWDAEhFDPGYSKEDVAAATII....AHGSIQDGRSMLEKREEn..vKNKTSSwkpplpkavspaiaklrsirksqplegG------.-.-Tlkkd...............................................atdgVSSIGSGSLTGGTLKRKVTI.EERLLQ.TLTTEQRLWYENLKKT-NPPAAIQWLHEY-q.......................................
Q8QYR3_PLRV/210-699              ...................vd--SG.S.EPGPS--------PQPTPTPTPQ.KPKRFIA.YVGIPMLTIQARENDDQIILGSLGSQRMEYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPRGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNADS.DYWNVGEADGVKISKLRNDNTYRQGHPD...LEINSCHFREGQLLERDATISFHVEAP-TDGRFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEH.LEGTGS....ANRVRRP.PREGHT.YMASPRK...PEGKPVGNKprd.....................................etpiQTQERQPDQTPSDDVS.DAGS...............................................VNS.GGST.E.S.LRLEFGVNSDSTYD..ATVDS...............TDWPRIPPPRHP.....PEPR.....VS.....GNSRTVTDFS--.....................................PKADLLENWDAEhFDPGYSKEDVAAATII....AHGSIQDGRSMLEKREGn..vKNKTSSwklplpkaespa..iaklrsirksqplE------.-.-Ggtlkk.............................................dttdgVSSIGSGSLTGGTLKRKATI.EEHLLQ.TLTTEQRLWYENLKKT-NPLAATQWLFKY-q.......................................
C7AXX0_BYDVP/21-187              ..............vdsstpe--PK.P.APEPTPTPQPAPAPQPAPEPTPApVPKRFFE.YIGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGH--...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
Q84829_PLRV1/1-490               .................vdsg----.S.EPSPS--------PQPTPTPTPQ.KHERFIA.YVGIPMLTIQARENDDQIILGSLGSQRMKYIEDENQNYTKFSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNADS.DYWNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP-TDGRFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEH.LEGTGS....ANRVRRP.PREGHT.YMASPHE...PEGKPVGNKprd.....................................etpiQTQERQPDQTPSDDVS.DAGS...............................................VNS.GGPT.E.S.LRLEFGVNSDSTYD..ATVDG...............TDWPRIPPPRHP.....PEPR.....VS.....GNSRTVTDFS--.....................................SKADLLENWDAEhFDPGYSKEDVAAATII....AHGSIQDGRSMLEKREEn..vKNKTSSwkppslkavspaiaklrsirksqplegGTLNKDA.T.DG.......................................................VSSIGSGSLTGGTLKRKATI.EERLLQ.TLTTEQRLWYENFKKT-NPPAATQWLFEY-q.......................................
H9NAE6_9LUTE/198-265             ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQL-------------------------.----------------------------------.----------------------------...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
A5A2T8_BYDVP/205-650             .................stpe--PK.P.APEPTPTPQPTPAPQPTPEPTPApVPKRFFE.YIGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYSNKRMEFGTISVTCDESdVEAERI....TRHAETP.IRSKHI.LVSEQYE...QPLPTIIDQ............................................---GLCDVQTPEQEQT.L---...............................................---.----.V.D.EEDKQTVS------..-----...............TEPDIALMEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPVDTSGNK.IPK--PKEPEVLGTYQ....GQNIYPDDVPPIARQKLr..eAAKAPS...........................TLLYEKT.P.KK.......................................................SNNFLTRFVEANRSPTTPAApTVSTVS.NMTREQLAEYTRIRKSLGLTAAKEYKAQF-q.......................................
MCAPS_BWYVG/203-660              .....................VDEE.P.GPSPG--------PSPSPQPTPQ.KKYRFIV.YTGVPVTRIMAQSTDDAISLYDMPSQRFRYIEDENMNWTNLDSRWYSQNSLKAIPMIIVPVPQGEW.TVEISMEGYQPTSSTTDPNKDKQDGLIAYNDDLS.EGWNVGIYNNVEITNNKADNTLKYGHPD...MELNGCHFNQGQCLERDGDLTCHIKTTGDNASFFVGRPAVQKQSKYNYAVSYGAWTDRMMEIGMIAIALDEQ.--GSSG....SAKTKRP.KRVGHS.MAVSTWE...TINLPEKENse........................................eiQTSQRQDFKTPPTAGG.GSDMld...........................................veEGG.LPLS.V.E.EEIPDFVGDNPWSN..ITTEN...............SQEEEAMSSKSG.....LTPQ.....LKppglpKPQPIRRLKSFD.....................................ATPDLVEAWRPD.VNPGYSKADWAVATII....AGGSIKDGRSMIDKRDK....------...........................AVLDGRK.S.WG.......................................................--SSLASSLTGGTLKASA--.KSEKLA.KLTTSERARFEQIKRQQGSVRASEFLEQI-l.......................................
A5A2S0_BYDVP/207-650             ....................p-EQK.P.APEPTPTPQPTPAPQPAPEPTPApVPKRFFE.YIGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...FKLNDCQFTDGQIVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEAERI....TRHAETP.IRSKHI.LVSEQYE...QPLPTIIDQ............................................---GLCDVQTPEQEQT.L---...............................................---.----.V.D.EEDKQTVS------..-----...............TEPDIALMEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPLDTSGNK.IPK--PKEPEVLGTYQ....GQNIYPEDVPPIARQKLr..eAAKAPS...........................TLLYEKT.P.KK.......................................................SNNFLTRFVEANRSPTTPAApTVSTVS.NMTREQLAEYTRIRKSLGLTAAKEYKAQF-q.......................................
MCAPS_TYYVF/204-661              .....................VDEE.P.GPSPG--------PSPSPQPTPQ.KKYRFIV.YTGVPVTRIMAQSTDDAISLYDMPSQRFRYIEDENMNWTNLDSRWYSQNSLKAIPMIIVPVPQGEW.TVEISMEGYQPTSSTTDPNKDKQDGLIAYNDDLS.EGWNVGIYNNVEITNNKADNTLKYGHPD...MELNGCHFNQGQCLERDGDLTCHIKTTGDNASFFVVGPAVQKQSKYNYAVSYGAWTDRMMEIGMIAIALDEQ.--GSSG....SVKTERP.KRVGHS.MAVSTWE...TIKLPEKGNse........................................gyETSQRQDSKTPPTASG.GSDTldveeg...................................glplpvEEE.IPDF.V.G.DNPWSDLSTKNSQE..EEAMS...............SESGLRP---QL.....KPPG.....LP.....KPQPIRTIRNFD.....................................PTPDLVEAWRPD.VNPGYSKADVAAATII....AGGSIKDGRSMIDKRNK....------...........................AVLDGRK.S.WG.......................................................--SSLASSLTGGTLKASA--.KSEKLA.KLTTSERARYERIKRQQGSTRASEFLESL-l.......................................
Q91GX6_BYDVP/1-449               ..............vdsstpe--PK.P.APEPAPTPQPTPAPQPAPEPTPApVPKRFFE.YIGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTFDESdVEAKRI....TRHAETP.IRSKHI.LVSERYE...EPLPTITNQ............................................---GLCDVKTPEQEQT.L---...............................................---.----.V.D.EEDRQTVS------..-----...............TEPDVALQEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPLDTSGNI.IPK--SKEPEVLGTYQ....GQNIYPEDVPPLARQRLr..eAAKAPS...........................TLLYERT.P.KK.......................................................SNNFLTRFVEANRSPTTPAApTVSTTS.NMTREQLAEYTRIRKSLGLTAAKEYKAQF-q.......................................
F2X6V5_9LUTE/198-664             ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYIPEAPE............................................QPTNEGTESMPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.IPVVEEVLRESPIY..APPPP...............PSLVPTHADTLR.....QADK.....VR.....RALMANASRSAS.....................................PPPTNTEVPVLG.ATDTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPARS.E.TS.......................................................--TLQGGSLSGGSLRGG---.NLQALP.EATREQRREYERLKNSQGKTVAKAHAKEH-g.......................................
A5A2W9_9LUTE/206-511             .....................VDAE.P.GPSPGPSPDPPPPPSPSPEPAPA.KEERFIV.YSGVAHTTISAQSTDDSIIVRDIPDQRFRYVENENFYWFQIAAQWYSNTNTKAVPMFVFPVPIGEW.SVEISTEGYQATSSTTDPNKGRIDGLIAYDNSS-.EGWNIGAGSNVTITNNKADNSWKYGHPD...LEINSCHFNQNQVLEKDGIISFHVKATEKEANFFLVAPPVQKTSKYNYAVSYGAWTDRDMEFGLITVTLDEK.---RGS....GSPTRKS.LRAGHA.EVTTTTD...LVALPEMEN............................................--FGIETSETPLAPVT.SSKA...............................................PLP.TV--.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------sdseseddplsaapdvg.......................
C7AXW8_BYDVP/21-187              ..............vdsstpe--PK.P.APEPTPTPQPTPAPQPAPEPTPApVPKRFFE.YIGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.ENWGVGNYKGCSSPIVLATNTWRPGH--...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
B0FKK2_BYDVP/201-644             .....................VDSStP.EPKPTPTPTPPPQPEPKPEPTPApPPKRFFE.YVGTPTGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIVSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVQASGKDACFYIMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEALRM....SRHSESP.TRVNNI.LIDEGYH...QTLPPIQNL............................................---GLCDVQTPGQDEV.EE--...............................................---.----.-.-.-DDKQTVS------..-----...............TEPDIALQEYEA.....ATAK.....IP.....DAEEDVLPSKEQ.....................................LSSKPVDTSGEE.IPKPPPRDNEILGVYQ....GQPIYADDVPPIARQKLr..dAAKAPS...........................TLLYDKA.P.KS.......................................................-KSFLSRFVEGNRSKTETTApSTATTS.NLTREQLREYTRIRNSLGLTAAKEYKAQF-l.......................................
B3GQA5_PLRV/1-107                .....mlekreenvknktssw----.-.-----------------------.-------.------------------------------------------------------------------.----------------------------------.----------------------------...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-KPPLPKAVSPAIAKLRs..iRKSQPLe.........................gGTLKKDA.T.DG.......................................................VSSIGSGSLTGGTLKRKATI.EERLLQ.TLTTEQRLWYENLKKT-NPLAATQWLFEY-q.......................................
D7EZI4_9LUTE/204-660             ...................vd--AE.P.SPSPG--------PSPSPQPTPQ.KKYRFIV.YTGVPVTRIMAQSTDDAISLYDMPSQRFRYIEDENMNWTNLDSRWYSQTSLKAVPMIIVPVPQGEW.TVEISMEGYQPTSSTTDPNKDKQDGLIAYNDDFK.EGWNVGVYNNVEITNNKADNTLKYGHPD...MELNGCHFNQGQCLERDGDLTCHLKTTGDNASFFIVGPAVQKQSKYNYAVSYGAWTDRMMEIGMIAIALDEQ.--GSSG....SAKIKRP.KRAGHS.MAVSTCE...TISFPKNENfe........................................esNTSQRQDFNTPLTHGE.GSDNlevgv....................................gglplpVEN.IPDF.D.G.DDPWSNISTRKPQE..DEAMT...............SKSGFKP---QL.....KPPG.....LP.....RPQPVRTIRNFN.....................................PEPDLVEAWRPD.VNPGYSKEDVAAATVM....YGGSVHEGRSMLAKRDQ....------...........................AVLDGRK.S.WG.......................................................--SSLASTLTGGTLRASA--.QSEKLA.QLTSSERAMFERTKRQQGRTAASELLEEL-l.......................................
B0FKT0_BYDVP/201-646             .....................VDSStP.EPKPTPAPTPAPTPEPKPEPTPApPPKRFFE.YVGTPIGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNLSG.DNWGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFRVEASGKDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEALRM....TRHSECP.TRVNNI.LIDEGYC...QPLSTITDQ............................................---GLCDVQTPGQDQE.VV--...............................................---.----.-.-.EEDRQTVS------..-----...............TESDIALKEYEA.....ATAE.....IP.....DAEEDALPSREQ.....................................LSSKPVDTSGEE.IPKPRPPSNEVLGVYQ....GQPIYADDVPPGTRQKLr..dAAKAPS...........................TLLYDKT.P.KR.......................................................SKSILSRFIEGNRSSVESAApSTATTS.NLTREQLREYTRIRNSLGLTAAKEYKARL-s.......................................
B7TWD1_9LUTE/202-640             .....................VDGG.P.GPKPGPDPTPP--PAPPPEPTPA.KHERFIV.YTGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQN.KVWNVGVQNNVTISNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTGPNASFFLVGPPVKKIAKYNYCISYGAWTDRDMEFGMVSVVLDEH.LEGVRG....SQYVRKT.LRPGHI.SVNRTHR...LQEMPPMRE............................................DFSEEDNSSSDSNTY-.KTDN...............................................SPL.TVHL.V.K.AGDEENYTTDRSDD..VEPTL...............HDADVMK-----.....FSGF.....VG.....AKDRFTLQGADPi...................................gPGDRSVRRFRPS.ATLKSAFH--------....-----------------....SGPTPD...........................ELYNAGA.E.QAdhd.................................................fehFVSRGKEKLQDEDPMAKLER.EAEDLK.PDSDYEDNDYDRTVPVFNPADGDPW-----sgik....................................
B5L2B5_9LUTE/204-661             .....................VDKE.P.GPSPG--------PSPSPQPTPQ.KKYRFIV.YTGVPVTRIMAQSTDDAISLYDMPSQRFRYIEDENMNWTNLDSRWYSQNSLKAIPMIIVPVPQGEW.TVEISMEGYQPTSSTTDPNKDKQDGLIAYSDDLK.EGWNVGVYNNVEITNNKADNTLKYGHPD...MELNGCHFNQGQCLERDGDLTCHVKTTGDNASFFIVGPAVQKQSKYNYAVSYGAWTDRMMEIGMIAIALDEQ.--GSSG....SAKTERP.KRVGHS.MAVSTWE...TINLPEKENse........................................efKTDQRQDLNTPPTTGG.SFDMld...........................................ivQGG.LPLP.V.E.ENIPDSIMDDPWSN..IPAKS...............SQEDEAVSSKSG.....FKPQ.....LK.....PPGLPRPQPVRTir................................nfdPNPDLVEAWRPD.VNPGYSKEDVAAATVM....YGGSIKEGRSMIDKRDK....------...........................AVLDGRK.S.WG.......................................................--SSLASSLTGGTLKASA--.KSEKLA.KLTSSERAQFERIKRQQGATRASEFLEQL-l.......................................
F8RUH7_9LUTE/198-418             ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAI---.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
Q70FV2_9LUTE/1-417               ....................e----.-.-----------------------.-------.------------------------NVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYTPEAPE............................................QPTNEGTESMPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLVPTHADTLR.....QADK.....VR.....RALMANASRSAS.....................................PPPTNTEVPVLG.ATDTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPARS.E.TS.......................................................--TLQGGSLSGGSLRGG---.NLQALP.EATREQRREYERLKNSQGKTVAKAHAKEH-g.......................................
B1A422_9LUTE/202-640             .....................VDGE.P.GPKPGPDPTPP--PAPPPEPTPA.KHERFIV.YTGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQN.KVWNVGVQNNVTISNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTGPNASFFLVGPPVKKIAKYNYCISYGAWTDRDMEFGMVSVVLDEH.LEGVRG....SQYVRKT.LRPGHI.SVNRSHR...LQEMPPMRE............................................DFSEEDSSSSD-NNTY.KTDN...............................................SPL.TVHL.V.K.AGDEENYTTDRSDD..VEPTL...............HDADVMK-----.....FSGF.....VG.....AKDRFVLQGADPi...................................gPGDRSVRRFRPS.ATLKSAFH--------....-----------------....SGPTPD...........................ELYNAGA.E.QAdhd.................................................fehFVSRGKEKLQDEDPMAKLER.EAEDLK.PDSDNEDNDYDRTAPVFNPADGDPWS----gin.....................................
Q45ZZ0_BYDVP/202-650             ..............vdsstpe--PK.P.APEPTPTPQPTPAPQPAPEPTPApVPKRFFE.YIGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SINISCEGFQSVDHIGGNEDGYWIGMIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTFDESdVEAKRI....TRHAETP.IRSKHI.LVSERYE...EPLPTITNQ............................................---GLCDVKTPEQEQT.L---...............................................---.----.V.D.EEDRQTVS------..-----...............TEPDVALQEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPLDTSGNI.IPK--SKEPEVLGTYQ....GQNIYPEDVPPLARQRLr..eAAKAPS...........................TLLYERT.P.KK.......................................................SNNFLTRFVEANRSPTTPAApTVSTTS.NMTREQLAEYTRIRKSLGLTAAKEYKAQF-q.......................................
Q2L3H1_9LUTE/198-664             ..................vgd----.A.PPTPTPTPT---PPAPTPAPA--.--SKYLG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWQDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYTPXTPE............................................QPTDEGTESMPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLTPTSADTLR.....QADK.....VR.....RALMANASRAAS.....................................PPPMTTEVPILG.AADTASLSGSLXGGSL....RGNLGSRPSLPRV----....XDSPPR...........................SVSPVRS.E.TS.......................................................--TLQGGSLSGGSLRGG---.NLQALP.EATREQRREYERLKNSQGXTVARAHAKEH-g.......................................
B0FEU2_PLRV/210-699              ...................vd--SG.S.EPGPS--------PQPTPTPTPQ.KHERFIA.YVGIPMLTIQARENDDQIILGSLGSQRMKYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNADS.DYWNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP-TDGRFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEH.LEGTGS....ANRVRRL.PREGHT.HMASPHE...PEGKPVGNKprd.....................................etpiQTQERQPDQTPSDDVS.DAGS...............................................VNS.GGST.E.S.LQLEFGANSDSTYD..ATVDG...............TDWPRIPPPRHP.....PEPR.....VS.....GNSRTVTDFS--.....................................PKADLLENWDAEhFDPGYSKEDVAAATII....AHGSIQDGRSMLEKREEn..vKNKTSSwkpplsea..........vspaiaklrSIRKSQP.L.EGgtlkk.............................................dvtdgVSSIGSGSLTGGTLKRKETI.EERLLQ.TLTTEQRLWYENLKKT-NPPAAIQWLYEY-q.......................................
A5A2P7_9LUTE/206-511             .....................VDAE.P.GPSPGPSPDPPPPPSPSPEPAPV.KEERFIV.YSGVAHTIISAQSTDDSIIVRDIPDQRFRYVENENFYWFQIAAQWYSNTNTKAVPMFVFPVPIGEW.SVEISTEGYQATSSTTDPNKGRIDGLIAYDNSS-.EGWNIGAGSNVTITNNKADNSWKYGHPD...LEINSCHFNQNQVLEKDGIISFHVKATEKEANFFLVAPPVQKTSKYNYAVSYGAWTDRDMEFGLITVTLDEK.---RGS....GSPTRKS.LRAGHA.GVTTTTD...LVTLPEKEN............................................--SGIETSETPSAPVT.SSKA...............................................PLP.TV--.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------sdseseddplsaapdvg.......................
C7AXW7_BYDVP/21-187              ..............vdsstpe--PK.P.APEPTPTPQPTPAPQPAPEPTPApVPKRFFE.YIGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.GVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGH--...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
F8RUH4_9LUTE/198-418             ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNREHAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAI---.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
Q7T6J8_9LUTE/1-415               .....................----.-.-----------------------.-------.-------------------------VTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSSVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANITDKILEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYTPEAPE............................................QPTNEGTESMPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLVPTHADTLR.....QADK.....VR.....RALMANASRSAS.....................................PPPTNTEVPVLG.ATDTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPARS.E.TS.......................................................--TLQGGSLSGGSLRGG---.NLQALP.EATREQRREYERLKNSQGKTVARAHAKEH-g.......................................
Q7T6K2_9LUTE/1-415               .....................----.-.-----------------------.-------.-------------------------VTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPIDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTVSNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKIMEWGSISVAVDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYNPETPE............................................ESENEGTESTPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLTPTSADTLR.....QADK.....VR.....RALMANASRSAS.....................................PPPSTTEVPVLG.ATDTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPARS.E.TS.......................................................--TLQGGSLGGGSLRGG---.NLQVLP.EATREQRREYERLKNSQGKTVARAHAREH-g.......................................
D2K8X5_9LUTE/198-265             ..................vgd----.A.PPTPTPIPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQL-------------------------.----------------------------------.----------------------------...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
Q8BA01_PLRV/210-699              ...................vd--SG.S.EPGPS--------PQPTPTPTPQ.KHERFIA.YVGIPMLTIQARENDDQIILGSLGSQRMKYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGVIAYSNADS.DYWNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP-TDGRFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEH.LEGTGS....ANRVRRP.PREGHT.YMASPRE...PEGKPVGNKprd.....................................etpiQTQERQPDQTPSDDVS.DAGS...............................................VNN.SGST.E.S.LQLEFGVNSDSTYD..ATVDG...............TDWPRIPPPRHP.....PEPR.....VS.....GNSRTVIDFS--.....................................PKADLLENWDAEhFDPGYSKEDVAAATII....AHGSIQDGRSMLEKREEs..vKNKTSSwkpplskavspa..iaklrsirksqplE------.-.-Ggtlkk.............................................datdgVSSIGSGSLTGGTLKRKVTI.EERLLQ.TLTTEQRLWYENLKKT-NPPAAIQWLYEY-q.......................................
B0ZT87_9LUTE/201-655             .....................VDSStP.EPTPQPQPEPKPDPQPTPKPQ--.-HKRFFE.YVGTPYAIIQTRESSDSIAVKSMNDQSFQYIENETSEQRTVQAWWTSNNGVQAQAAFVFPIPAGEY.SVNISCEGLQSVDHIGGNRDGYWIGLIAYQNQSG.DYWGVGNYAGCDITNLLGTNTWRPGHED...LELNGCKFTNGQIVERDAVISFHVKAQGADPKFYLMAPKTMKSDKYNYVVSYGGYTDKRMEFGSISVTVDESdVEAQRY....NRHTSTV.RKTEN-.-RDYGWM...SVLPPYDPN............................................--------QMPEQEEE.QPMV...............................................DKEmDPRS.P.V.EPPSPTSDTEAERA..FDLRE...............EELTRARLEYEA.....ATES.....IP.....DAAPDILPSKSE.....................................MSSRPIDHDGRS.LPK--PQSKEVLGTYQ....GQNITPDDVPPVIAEKLr..eVNRAPS...........................TLLYDRQ.P.KT.......................................................PKSFLSRFVETNKTSLASPG.SQSSTS.GMTREQASEYTRIRKSMGLTAAKEYKASL-a.......................................
E3UIL9_PEMV1/190-472             ...................xg--DD.A.PPSPGPDPGPQPPPPPPPSPTPV.-GARFWG.YEGVPESRMISERNDHDIDVKPLSFITMYKWEDESWTSVKLSASYLQNDQVEATPYFLIPSSKGKF.SVYIECEGFQAVKSIGGKSDGCWGGLIAYNRKK-.DGWQARAYTGTVLSNYRSTTTVINGHPD...CEVNDCKFRPDRGVESDLICSFHLEAE-EDSYWALQAPPIQKSSDYNYVVSYGGYTEKSIEWGSVSISIDEV.-NQTAS....ASPWRGR.ARK---.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------lailqetavpppfppggvmdyrlgnregdqtgtsek....
D2K8V5_9LUTE/198-265             ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQL-------------------------.----------------------------------.----------------------------...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
B0FKL4_BYDVP/202-650             ..............vdsstpe--PK.P.APEPTPTPQPTPAPQPAPEPTPApVPKRFFE.YIGTPTGTISTRENSDSISVSKLGGQPMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEAERI....TRHAETP.IRSKHI.LVSERYV...EPMPTIIDQ............................................---GLCDVKTPEQEQT.L---...............................................---.----.V.D.EEDKQTVS------..-----...............TEPDIALQEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPMDTSGNK.IPK--PKEPEVLGTYQ....GMNIYPEDVPPLARQKLr..eAAKAPT...........................TLLYERT.P.KK.......................................................SSNILTRYLESNRSPTTPAApSVSTVS.NMTREQLAEYTRIRRSLGLTAAKEYKAQF-q.......................................
B1A440_9LUTE/202-640             .....................VDGE.P.GPKPGPDPTPP--PAPPPEPTPA.KHERFIV.YTGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQN.KVWNVGVQNNVTISNNKADADWKYGHPN...LTINGERFDQNQVVEKDGTVSFHLVTTGPNASFFLVGPPVKKIAKYNYCISYGAWTDRDMEFGMVSVVLDEH.LEGVRG....SQYVRKT.LRPGHI.SVNRSHR...LQEMPPMRE............................................DFSEEDSSSSD-NNTY.KTDN...............................................SPL.TVHL.V.K.AGDEENYTTDRSDD..VEPTL...............HDADVMK-----.....FSGF.....VG.....AKDRFTLQGADPi...................................gPGDRSVRRFRPS.ATLKSAFH--------....-----------------....SGPTPD...........................ELYNAGV.E.QAdhd.................................................fehFVSRGKEKLQDEDPMAKLER.EAEDLK.PDSDNEDNDYDRTAPVFNPADGDPWS----gik.....................................
E0A2S1_9LUTE/1-137               ....................g----.-.-----------------------.-------.------------------------------------------------------------------.----------------------------------.ATWNVGEYNNVKITKLLNTSSWKKGHKD...VVLNGCHFNDGQVIERDSTMSFHCEVGHGGGTILLVAPPVCKSDKYNYVVSYGEYTTKHMEFGSIAICFDEK.NDGARA....GKFLGAPfPRAGHV.VREQQTE...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------iarfpagsd...............................
Q2L3I9_9LUTE/198-664             ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFPCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAMDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYTPEAPE............................................QPTNEGTESMPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..ASPPP...............RLLVPTHADTLR.....QADK.....VR.....RALMANASRSAS.....................................PPPMNTEVPXLG.ATDTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPARS.E.TS.......................................................--TLQGGSLSGGSLRGG---.NLXALP.XATREQRREYERLKNSQGKTVAKAHAKEH-g.......................................
Q7T6J5_9LUTE/1-415               .....................----.-.-----------------------.-------.-------------------------VTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYTPEAPE............................................QPTNEGTESMPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLVPTHADTLR.....QADK.....VR.....RALMANASRSAS.....................................PPPTNTEVPVLG.ATDTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPARS.E.TS.......................................................--TLQGGSLSGGSLRGG---.NLQALP.EATREQRREYERLKNSQGKTVAKAHAKEH-g.......................................
Q8B6L8_9LUTE/1-519               .....................VDGE.P.GPKPGPDPAPQ--PTPTPEPTPA.KHERFIA.YTGTLSTLISARQSSDSISLYSIRSQRIRYIEDENSSWTNIDAKWYSQNSVEAIPMFVYPVPEGTW.SIEISCEGYQAASSTSDPHRGKCDGMIAYDDDSS.KVWNVGQQNNVTITNNKADNDWKYGHPD...LTINGDRFDQNQVVEKDGIISFHLVTTGPNASFFLVAPAVKKTAKYNFCVSYGDWTDRDMEFGMVSVVLDEH.LEGARS....SQYVRKT.PRSGHV.GVNRSHR...LQDNFVPTEyvs.....................................dedsSSNSSIVSNRPSTPDN.DSDAqfaesmkg..............................klpsqtklpPKG.FLSR.L.S.TKEKKEISNSKPSN..VEGLV...............GPLVVAY--GYP.....SQTG.....VY.....DAAREILQAKEAaenlaelerdlkeink....leppdvivqeeipdfvpPSEKILKEDDPD.YVPPIWQNADQAVLVS....SYEPPDWSRPAYG----....SGDPPK...........................KTGTLKG.T.LSkl...................................................ggSLRSGESSLRGSLRKTQDQTdLDNKLS.KLSVIQRSRYQRILNNLGKMRARAYIDGL-d.......................................
Q2L3I3_9LUTE/198-664             ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYTPEAPE............................................QPTNEGTESMPPAPNP.ALEPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLVPTHADTLR.....QADK.....VR.....RALMANASRSAS.....................................PPPTNTEVPVLG.ATDTASLSGSLRGGSL....RGNLGFRPSLPRV----....ADSPPR...........................SVSPARS.E.TS.......................................................--TLQGGSLSGGSLRGG---.NLQALP.EATREQRREYERLKNSQGKTVAKAHAKEH-g.......................................
Q8B6M0_9LUTE/1-519               .....................VDGE.P.GPKPGPDPAPQ--PTPTPEPTPA.KHERFIA.YTGTLSTLVSARQSSDSISLYSIRSQRIRYIEDENSSWTNIDAKWYSQNSVEAIPMFVYPVPEGTW.SIEISCEGYQAVSSTSDPHRGKCDGMIAYDDDSS.KVWNVGQQNNVTITNNKADNDWKYGHPD...LTINGDKFDQNQVVEKDGIISFHLVTTGPNASFFLVAPAVKKTAKYNFCVSYGDWTDRDMEFGMVSVVLDEH.LEGARS....SQYVRKS.PRSGHV.GVNRSHR...LQDNFVPTEyvs.....................................dedsNSSSSIVSNRPSTPDN.DSDAqfaesikg..............................klpsqtklpPKG.FLSR.L.S.VKEKEEISNSKPSN..VEGLV...............GPLVAAY--GYP.....SQTG.....VY.....DAAREILQAKEAaenlaelerdlkeink....leppdvivqeeipdfvpPSEKTLKEDDPY.YVPPIWQNADQAVLVS....TYEPPDWSRPAYESGDP....LKKT-G...........................TLKGTLS.K.SG......................................................gSLRSGESSLRGSLRKTQDQTdLDNKLS.KLSVIQRSQYQRILNNLGKTRARAYIDGL-d.......................................
G3E226_9LUTE/1-258               .....................----.-.-----------------------.-------.-----------------------------------MNWTNVDARWYSSNNVKAVPMYVFPVPEGTW.SVEISTEGYQPTASTTDPNKGKVDGMIAYSDDQS.EVWNVGINQNCNITNLKADNSWKYGHPD...MEINNCHFNQGQVLEMDGTISFHVETTGSDASFFLVGPAVQKQSKYNYAVSYGAWTDRDMELGLISVSLDEK.-DG-SR....GSAMKRP.RREGHS.KAVSTWE...TINLPEKENse........................................ksITSQRQDSKTQPQ---.----...............................................-QG.FSDA.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------gsednkewdftpgtrmflpedfeepreaqnddllrdr...
Q70FV8_9LUTE/1-417               ....................e----.-.-----------------------.-------.------------------------NVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYTPEAPE............................................QPTNEGTESMPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLVPTHADTLR.....QADK.....VR.....RALMANASRSAS.....................................PPPTSTEVPVLG.ATDTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPARS.E.TS.......................................................--TLQGGSLSGGSLRGG---.NLQALP.EATREQRREYERLKNSQGKTVARAHAKEH-g.......................................
Q8QYQ6_PLRV/210-699              ...................vd--SG.S.EPGPS--------PQPTPTPTPQ.KHERFIA.YVGIPMLTIQARENDDQITLGSLGNQRMKYIEDENQSYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNADS.DYWNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP-TDGRFFLVGPAIQKTAKYNYTISYGDWMDRDMELGLITVVLDEH.LEGTGS....ANRVRRP.PREGHT.YMASPRE...PEGKPVGNKprd.....................................etpiQTRERQLDQTPSDDVS.DAGS...............................................VNN.GGSA.E.S.LQLEFGVNSDSTYD..ATVDS...............TDWPRIPPPRHP.....PEPR.....VS.....GNSRTVTDFS--.....................................PKADLLENWDAEhFDPGYSKEDVAAATII....AHGSIQDGRSMLEKREEn..vKNKTSSwkpplpkavspaiaklrsirksqplegGILKKDA.T.DG.......................................................VSSIGSGSLTGGTLKRKVTI.EERLLQ.TLTTEQRLWYENLKKT-NPLAATQWLFEY-q.......................................
F8RUI0_9LUTE/198-418             ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAI---.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
Q91QQ1_9LUTE/1-363               .....................VDGE.P.GPKPGPDPAPQ--PTPTPEPTPA.KHERFIA.YTGTLSTLISARQSSDSISLYSIRSQRVRYIEDENSSWTNIDAKWYSQNSVEAIPMFVYPVPEGTW.SIEISCEGYQAASSTSDPHRGKCDGMIAYDDDSS.KVWNVGQQNNVTITNNKADNDWKYGHPD...LTINGDKFDQNQVVEKDGIISFHLVTTGPNASFFLVAPAVKKTAKYNFCVSYGDWTDRDMEFGMVSVVLDEH.LEGARS....SQYVRKT.LRPGHI.SVNRSHR...LQEMPPTRE............................................DFSEEDNSSSDNNTYK.-TDN...............................................SPM.TVHL.V.K.AGDEESYATDQTDD..VEPIL...............LDADVMK-----.....FSGF.....VG.....ARDRFTLQGAEPi...................................gPGDRTSRRFRPS.GT--------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------lkaafhs.................................
Q8QYR0_PLRV/3-107                ekregnvknktsswklplpka----.-.-----------------------.-------.------------------------------------------------------------------.----------------------------------.----------------------------...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-------ESPAIAKLRS...iRKSQPLe.........................gGTLKKDT.T.DG.......................................................VSSIGSGSLTGGTLKRKATI.EEHLLQ.TLTTEQRLWYENLKKT-NPLAATQWLFKY-q.......................................
Q2L3H7_9LUTE/198-664             ..................vgd----.A.PPTPTPTPT---PPAPTPAPA--.--SKYLG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWQDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYTPETPE............................................QPTDEGTESMPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLTPTSADTLR.....QADK.....VR.....RALMANASRAAS.....................................PPPMTTEVPILG.AADTASLSGSLXGGSL....RGNLGSRPSLPRV----....XDSPPR...........................SVSPVRS.E.TS.......................................................--TLQGGSLSGGSLRGG---.NLQALP.EATREQRREYERLKNSQGXTVARAHAKEH-g.......................................
Q65872_BYDV1/1-455               .....................VDSStP.EPSPQPQPEPKPDPQPTPEPR--.-QKRFFE.YVGTPYVVIQTRESSDSIAVKAMNDQSFQYIENETSEQRTVKAWWNSNNSVQAQAAFIFPIPAGEY.SVNISCEGLQSVDHIGGNRDGYWIGLIAYQSQSG.DYWGVGNYVGCDITNLLGTNTWRPGHED...LELNSCKFTDGQIVERDAVISFHVKARGADPKFYLMAPKTMKADKYNYVVSYGGYTDKRMEFGTISVTVDESdVEAERY....SRHTSTV.RRTEN-.-RDYGWM...NVLPPYNPD............................................----QVPEQEDEQPVV.DKEM...............................................-DA.GSPI.D.T.ASLTSDT--EAEKA..FDLKE...............EELTRAILEYEA.....ATVS.....IP.....DAAPDILPSKSE.....................................MSSKPIDRDGRS.LPK--SQTKEVLGTYQ....GQNITSDDVPPVIAEKLr..eVNRAPS...........................TLLYDRQ.P.KQ.......................................................PKNPLTRFVLSNKTSTASPG.SQSSTA.GMTREQASEYTRIRKSLGLTAAKQYKASL-d.......................................
B1A419_9LUTE/202-640             .....................VDGE.P.GPKPGPDPTPP--PAPPPEPTPA.KHERFIV.YTGTLSTLISARQNSDSISLYPIRDQRVRYIEDENANWAYIKAQWYSQNSVEAVPMFIYPVPQGTW.SVEISCEGYQATSSTTDPHRGKSDGMIAYDDDQT.KVWNVGLQNNVTITNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTGPNASFFLAGPAVKKIAKYNFCISYGAWTDRDMEFGLVSVVLDEH.LEGVRG....SQYVRKT.LRPGHI.SVNRPHR...LQIMPPTRE............................................DDSDGYSSSSDS-NTY.KTDN...............................................SPL.TVHL.V.K.AGDEENCTTDRSDD..VEPIL...............HDADVMK-----.....FSGF.....VG.....AKDRFMLQGADPi...................................gPGDRSVRRFKPS.ATLKSAFH--------....-----------------....SGPTPD...........................ELYNAGT.E.QAdhd.................................................fehFVSRGKEKLQDEDPMAKLER.EAGDLK.PDSDNEDNDYDRTAPVFNPADGDPWS----gin.....................................
B1A443_9LUTE/202-640             .....................VDGE.P.GPKPGPDPTPP--PAPPPEPTPA.KHERFIV.YTGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQT.KVWNIGVQNNVTISNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTGPNASFFLAGPAVKKIAKYNYCISYGAWTDRDMEFGMVSVVLDEH.LEGVRG....SQYIRKT.LRPGHI.SVNRTHR...LQEMPPMRE............................................DFSEEDNSSSDSNTY-.KTDN...............................................SPL.TVHF.V.K.AGDEENYTTDRSDD..VEPTL...............HDADVMK-----.....FSGF.....VG.....AKDRFTLQGADPi...................................gPGDRSVRRFRPS.ATLKSAFH--------....-----------------....SGPTPD...........................ELYNAGA.E.QAdhd.................................................fehFVSRGKEKLQDEDPMAKLER.EAEDLK.PDSDNEDNDYDRTAPMFNPADGDPWS----gik.....................................
A5A2S6_BYDVP/206-650             ..................tpe--PK.P.APEPTPTPQPTPAPQPAPEPTPApVHKRFFE.YIGTPTGTISTRENTDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEAERI....TRHAETP.IRSKHI.LVSEQYE...QPLPTIIDQ............................................---GLCDVQTPEQEQT.MV--...............................................---.----.-.D.EEDKQTVS------..-----...............TEPDIALMEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPVDTSGNK.IPK--PKEPEVLGTYQ....GQNIYPEDVPPIARQKLr..eAANAPS...........................TLLYERT.P.KK.......................................................SNNFLTRFVEANRSPTTPAApTVSTVS.NMTREQLAEYTRIRKSLGLTAAKEYKAQF-q.......................................
Q8V2F5_BLRV/198-650              .....................VDGE.PdPPGPGPDP-PPPTPAPTPQPQPTpKHERFIV.YTGVPESRISAQSTDDSISVYSLQNQRLRYIEDENANWTNIEARWYSNNNVKATPMFIFPVPQGKW.SVEISTEGYQPTSSTTDPNNGKCDGLIAYSDDDKtDVWNVGVQKNITLSNNKADNTWKYGHPD...LEINNCKFNNRQVLERDAYISFHVETTGPNASFFLVAPPVQKTARYNYAVSYGAWTDRMLEFGSVTVALDEH.LEGGNS....SRYIRRS.PRPGHL.ESTRTYD...LHLLPHMDDliaanttavvdgygs.............sisidrqvlvavdnhiVDSGDETDDLPGYSSS.SSEApklpav...................................nqtklpPKG.FLSR.L.R.ESEIEEIADKPTEI..TTPEV...............RQLADAT-HQPF.....AAGM.....YN.....DAFERLSINEKK.....................................RNFDSVKDDIAE.IERTLPKEE-------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------yrvpklprikpasevdndhygesqqtlaeierrnvwaskd
Q2L3G5_9LUTE/198-664             ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLPAGYRVNNRERAIPFVLFPIDKGRY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTVSNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKIMEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYNPETPE............................................ESENEGTESTPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLTPTSADTLR.....QADK.....VR.....RALMANASRSAS.....................................PPPSTTEVPVLG.ATDTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPARS.E.TS.......................................................--TLQGGSLGGGSLRGG---.NLQVLP.EATREQRREYERLKNSQGKTVARAHAREH-g.......................................
E0A2S0_9LUTE/1-137               ....................g----.-.-----------------------.-------.------------------------------------------------------------------.----------------------------------.ATWNVGEYNNVKITKLLNTSSWKKGHKD...VVLNGCHFNDGQVIERDSTMSFHCEVGHGGGTILLVAPPVCKSDKYNYVVSYGEYTTKHMEFGSIAICFDEK.HDGARA....GKFLGAPfPRAGHV.VCEQQTE...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------iarfpagsd...............................
B0FKK8_BYDVP/201-646             .....................VDSStP.EPKPTPAPTPAPTPEPKPEPTPApPPKRFFE.YVGTPIGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEASGKDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEALRM....TRHSECP.TRVNNI.LIDEGYC...QPLSTITDQ............................................---GLCDVQTPGQDQE.VV--...............................................---.----.-.-.EEDRQTVS------..-----...............TESDIALKEYEA.....AIAE.....IP.....DAEEDALPSREQ.....................................LSSKPVDTSGEE.IPKPRPPSNEVLGVYQ....GQPIYADDVPPGTRQKLr..dAAKAPS...........................TLLYDKT.P.KR.......................................................SKSILSRFIEGNRSSVESAApPTATTS.NLTREQLREYTRIRNTLGLTAAKEYKARL-s.......................................
B0FKV4_BYDVP/201-646             .....................VDSStP.EPKPTPAPTPAPTPEPKPEPTPApPPKRFFE.YVGTPIGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEASGKDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEALRI....IRHSECP.TRVNNI.LIDEGYI...QPLSTITDQ............................................---GLCDVQTPGQDQE.VV--...............................................---.----.-.-.EEDRQTVS------..-----...............TESDIALKEYEA.....AIAE.....IP.....DAEEDALPSREQ.....................................LSSKPVDTSGEE.IPKPRPPSNEVLGVYQ....GQPIYPEDVPSGTRQKLr..dAAKAPS...........................TLLYDKT.P.KR.......................................................SKSILSRFIEGNRSSVESSApSTATTS.NLTREQLREYTRIRNTLGLTAAKEYKARL-l.......................................
Q91QQ6_9LUTE/1-514               .....................VDGE.P.GPKPGPSPAPP--PAPPPEPTPA.KHERFIV.YTGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTNIKAHWYSQSSVEAIPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQT.KVWNVGVQNNVTISNNKADADWKYGHPN...LTINGERFDQNQVVEKDGTISFHLVTTGPNASFFLVGPAVKKIAKYNYCISYGAWTDRDMEFGLVSVVLDEH.LEGVRG....SQYVRKT.LRPGHI.SVNRSHR...LQDSFTPVEyvs.....................................dedsSSNSSIVSNRPSTPDN.DSDTqplkvkl.................................psqtqlpPKG.FLSR.L.S.AKEKEQISSSKPSN..VENQV...............GPLVAAY--GYP.....SQTG.....VY.....DAAREILRAKEAaenlaelerdlkeink.....leppdviiqeeipdfvPPSEKVHQESPE.YVPPVWRNADQAVTVS....SYEPPDWSRPANE----....SGDPPKk.........................gSLKGTLS.K.LG......................................................gSLRSGESSLRGSLRKTQDQSdLDYKLS.KLNVLQRSQYQRILNNSGKTRARAYLDGL-d.......................................
Q8QYM7_PLRV/2-107                ..........lekreenvknk----.-.-----------------------.-------.------------------------------------------------------------------.----------------------------------.----------------------------...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.-------------TSS....WKPPLSKAVSPAIAKLRsirkSQPLEG...........................GTLNKDA.T.DG.......................................................VSSIGSGSLTGGTLKRKVTI.EDRLLQ.TLTTEQRLWFENLKKT-NPPAATQWLYEY-q.......................................
F8RUE1_9LUTE/198-664             ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KSFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFSLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYTPEAPE............................................QPTNEGTESMPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLVPTHADTLR.....QADK.....VR.....RALMANASRSAS.....................................PPPTNTEVPVLG.ATDTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPARS.E.TS.......................................................--TLQGGSLSGGSLRGG---.NLQALP.EATREQRREYERLKNSQGKTVAKAHAKEH-g.......................................
G3E244_9LUTE/1-257               .....................----.-.-----------------------.-------.-----------------------------------MNWTNVDARWYSSNNVKAVPMYVFPVPEGTW.SVEISTEGYQPTASTTDPNKGKVDGMIAYSDDQS.EVWNVGINQNCNITNLKADNSWKYGHPD...MEINNCHFNQGQVLEMDGTISFHVETTGSDASFFLVGPAVQKQSKYNYAVSYGAWTDRDMELGLISVSLDEK.-DG-SR....GSAMKRP.RREGHL.KAVSTWE...TINLPEKENse........................................ksITSQRQDFKTQPQQGF.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------sdagsednkewdftpgtrmflpedfeeprevqnddllrd.
B0FKW0_BYDVP/201-644             .....................VDSStP.EPKPTPAPTPPPQPEPKPEPTPApPPKRFFE.YVGTPIGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVQASGKDACFYIMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEALRM....SRHSESP.TRVNNI.LIDEGYH...QTLPPIQNL............................................---GLCDVQTPGQDEV.EE--...............................................---.----.-.-.-DDKQTVS------..-----...............TEPDIALQEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPVDTSGEE.IPKPPPRDNEILGVYQ....GQPIYADDVPPIARQKLr..dAAKAPS...........................TMLYDKA.P.KS.......................................................-KSFLSRLVEGNRSKVETTApSTATTS.NLTREQLREYTRIRNSLGLTAAKEYKAQF-s.......................................
H1D1M3_9FIRM/93-163              .....................VEPA.P.EPEPLPEPEPEPEPEPEPEPEPA.PASKYTA.DQGDTANEIDSDGTYDGMTYTS--------------------------------------------.----------------------------------.----------------------------...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------tkadenalrvsmay..........................
E0A2S3_9LUTE/1-137               ....................g----.-.-----------------------.-------.------------------------------------------------------------------.----------------------------------.ATWNVGEYNNVKITKLLNTSSWKKGHKD...VVLNGCHFNDGQVIERDSTMSFHCEVGHGGGTILLVAPPVCKSDKYNYVVSYGEYTTKHMEFGSIAICFDEK.NDGARA....GKFLGAPfPRAGHV.VREQQTE...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------iarfpagsd...............................
F8RUJ5_9LUTE/198-418             ..................vgd----.A.PPAPTPTPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSNANFTDKILEWGSISVAI---.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
Q8QYP9_PLRV/210-699              ...................vd--SG.S.EPGPS--------PQPTPTPTPQ.KHERFIA.YVGIPMLTIQARENDDQIILGSLGSQRMKYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNADS.DYWNVGEADGVKISKLCNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP-TDGRFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEH.LEGTGS....AYRVRRP.PREGHT.YMASPRE...PEGKPVGNKprd.....................................etpiQTQERQPDQTPSDDVS.DAGS...............................................VNS.GGST.E.S.LQLEFGPNSDSTYD..ATVDG...............TDWPRIPPPRHP.....PKPR.....VS.....GDSRTVTNFS--.....................................PKADLLENWDAEhFDPGYSKEDVAAATII....AHGSIQDGRSMLEKREEn..vKNKTSSwkpplpkavspaiaklrsirksqplegG------.-.-Tlkkd...............................................atdgVSSIGSGSLTGGTLKRKVTI.EERLLQ.TLTTEQRLWYENLKKT-NPPAAIQWLHEY-q.......................................
Q7T6K8_9LUTE/1-415               .....................----.-.-----------------------.-------.-------------------------VTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYTPEAPE............................................QPTNEGTESMPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLVPTHADTLR.....QADK.....VR.....RALMANASRSAS.....................................PPPMNTEVPVLG.ATDTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPARS.E.TS.......................................................--TLQGGSLSGGSLRGG---.NLQALP.EATREQRREYERLKNSQGKTVAKAHAKEH-g.......................................
B0FKX2_BYDVP/201-643             .....................VDS-.S.TPEPTPAPAPQPTPQPAPEPTPApAPKRFFE.YIGTPMGVISTRENTDSISVSQLGGQSMQYIENEKCETRTIDSFWSTNNNVAAQAAFVYPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGIIAYSNSSD.DNWGIGNYRGCSFKNYLATNTWRPGHKD...LKLNDCQFTGGQIVERDSIISFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEAIRI....AKHSATP.NRANHI.LVSERYQ...DVLPTIENQ............................................---GLCDVETPGQETS.I---...............................................---.----.V.E.EDDKQSVS------..-----...............TEPEIAVKEYEA.....AVAE.....IP.....DAEEDVLPSKEQ.....................................LSSRPVDTSGNT.IPR--TKEPEVLGTYQ....GQNIYPEDVPPAARQALr..eAARAPS...........................TMLYDKA.P.KG.......................................................AKSILSRFVEGNRSKTTPAApSVSTTS.NMTREQLKEYTRIRNSLGVTAAKEYKAQLQ........................................
B1A437_9LUTE/202-640             .....................VDGE.P.GPKPGPDPTPP--PAPPPEPTPA.KHERFIV.YTGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVAQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQN.KVWNVGVQNNVTISNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTGPNASFFLVGPPVKKIAKYNYCISYGAWTDRDMEFGMVSVVLDEH.LEGVRG....SQYVRKT.LRPGHI.SVNRSHR...LQEMPPMRE............................................DFSEEDNSSSDSNTY-.KTDN...............................................SPL.TVHL.V.K.AGDEENYTTDRSDD..VEPTL...............HDADVMK-----.....FSGF.....VG.....AKDRFTLQGADPi...................................gPGDRSVRRFRPS.ATLKSAFH--------....-----------------....SGPTPD...........................ELYNAGA.E.QAdhd.................................................fehFVSRGKEKLQDEDPMAKLER.EAEDLK.PDSDNEDNDYDRTAPVFNPADGDPWS----gik.....................................
Q91AV7_9LUTE/1-422               ....................m----.-.-----------------------.-------.----------AQSTDDAISLYDMPSQRFRYIEDENMNWTNLDSRWYSQNSLKAIPMVIVPVPQGEW.TVEISMEGYQPTSSTTDPNKDKQDGLIAYNDDLK.EGWNVGVYNNVEITNNKADNTLKYGHPD...MELNSCHFNQQQCLERDGDLTCHIKTTGDNASFFIVGPAVQKQSKYNYAVSYGAWTDRMVEIGMIAIALDEQ.--GSSG....SARTERP.KRVGHS.MAVSTWE...TINLPEKEDse........................................klKTGQRQDLKTPFTISG.SSDVkg...........................................ieKRD.LPLP.A.D.EDIPDFIGNDPWSN..VSIRK...............LQEEEAMTSKSGlrpqlKPPG.....LP.....KPQPVRTIGNFN.....................................PTPELVESWRPD.VNPGYSKEDVAAATIL....YGGSIKDGRSMIDKRDK....------...........................AVLDGRK.H.WG.......................................................--SSLASSLTGGTLKASA--.KSEKLA.KLTSRERAEFERIKRQQGTTQASEYLE---fil.....................................
Q7T6J6_9LUTE/1-415               .....................----.-.-----------------------.-------.-------------------------VTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGANDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYTPEAPE............................................QPTNEGTESMPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLVPTHADTLR.....QADK.....VR.....RALMANASRSAS.....................................PPPTNTEVPVLG.ATDTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPARS.E.TS.......................................................--TLHGGSLSGGSLRGG---.NLQALP.EATREQRREYERLKNSQGKTVAKAHAREH-g.......................................
Q5UUW8_9LUTE/197-651             .....................VDSStP.EPTPQPQPEPKPDPQPTPEPQ--.-HKRFFE.YVGTPYVIIQTRESSDSIAVKSMNDQSFQYIENETSEQRTVQAWWTSNNGVQAQAAFVFPIPAGEY.SVNISCEGLQSVDHIGGNRDGYWIGLIAYQNQSG.DYWGVGNYAGCDITNLLGTNTWRPGHED...LELNGCKFTNGQIVERDAVISFHVKAQGADPKFYLMAPKTMKSDKYNYVVSYGGYTDKRMEFGSISVTVDESdVEAQRY....NRHTSTV.RKTEN-.-RDYGWM...SVLPPYDPN............................................--------QVPEQEEE.QPMV...............................................DKE.MDSR.SpV.EPPSPTSDTEAERA..FDLRE...............EELTRARLEYEA.....ATES.....IP.....DAAPDILPSKSE.....................................MSSRPIDHDGRS.LPK--PQSKEVLGTYQ....GQNITPDDVPPVIAEKLr..eVNRAPS...........................TLLYDRQ.P.KT.......................................................PKSFLSRFVETNKTSLASPG.SQSSTS.GMTREQASEYTRIRKSMGLTAAKEYKASL-a.......................................
C7AXX2_BYDVP/21-187              ..............vdsstpe--PK.P.APEPTPTPQPTPAPQPAPEPTPApVPKRFFE.YIGTPTGVISTRENSDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGH--...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
O09708_PEMV1/190-471             ...................xg--DD.A.PPSPGPDPGPQPPPPPPPSPTPV.-GARFWG.YEGVPESRMISERNDHDIDVKPLSFITMYKWEDESWTSVKLSASYLQNDQVEATPYFLIPSSKGKF.SVYIECEGFQAVKSIGGKSDGCWGGLIAYNRKK-.DGWQARAYTGTVLSNYRSTTTVINGHPD...CEVNDCKFKPDHGVESDLICSFHLEAE-EDSYWALQAPPIQKSSDYNYVVSYGGYTEKSIEWGSVSISIDEV.-NQTAS....ASPWRGR.AR----.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------klailqetvvplpfppggamdyrlgdregdqtgtse....
Q84820_PLRV/1-490                ...................vd--SG.S.EPGPS--------PQPTPTPTPQ.KHERFIA.YVGIPMLTIQARENDDQIILGSLGSQRMKYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNADS.DYWNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP-TDGRFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEH.LEGTGS....ANRVRRP.PREGHT.YMASPRE...PEGKPVGNKprd.....................................etpiQTQERQPDQTPSDDVS.DAGS...............................................VNS.GGST.E.S.LQLEFGVNSDSTYD..ATVDG...............TDWPRIPPPRHP.....PEPR.....VS.....GNSRTVTDFS--.....................................PKADLLENWDAEhFDPGYSKEDVAAATII....AHGSIQDGRSMLEKREEn..vKNKTSSwkppspkavspa..iaklrsirksqplE------.-.-Ggtlkk.............................................datdgVSSIGSGSLTGGTLKRKATI.EERLLQ.TLTTEQRLWYENLKKT-NPSAATQWLFEY-q.......................................
E2DRQ5_9LUTE/203-692             ...................vd--D-.G.PPPPGPSP------PPSPSPPPP.VPSRFWG.YEGNPQCKILTAENNRNIDSRPLNFVSMYKWEDEKWDKVNLQAGYSRNDRRCMETYFVIPASRGKF.HVYLEADGEFVVKHIGGDRDGNWLGNIAYDVSQ-.RGWNIGDYKGCRISNYQSNAVFVAGHPD...AEMDGKHFDAARAVEVDWFASFELTCDDEDGAWRIYPPPIQKDSSYNYTVSYGDYTEKYCEWGAVSVSVDE-.--DNST....GTKSRIK.PHKGVM.MWSHPEK...ENSEGESES............................................ETDQGKDLKTPDATTLvDFDSddns.......................................ssksAES.IPDN.T.D.LNPWNAVVSSKSDRpfKQEDD...............RVSTSSRLSGNL.....RRPG.....SG.....NPQLRSPLGREKapepsesdldaarikglpppreqppgfkptrsistfnPEPDLVEAWRPG.TGPGYSKEDVAAATIL....AHGSIADGRSMLDKRDQ....------...........................EVLRSRS.S.WG.......................................................----TGGFLKKMKTSSSD--.KAEKLA.KLSTAERREYELIKNSSGKTQAALFLEQ--kv......................................
Q65848_9LUTE/198-637             .....................VDPS.P.SPAPTPTPTPTPQPQPSPQPQPEpTKPRFYAnYSGTPIVNISTRETTDSISVKKLGLQTLMYNSDEVHENRQIRSWWYSDNNVESQAAFVFPVPEGEF.SVQVTAEGLQSVDHIGGNYDGYWIGLIAYGNDTS.DNWGIGIYNRCSITDLINTASWRPGHKD...MELNGCKFSD-QVVERDAIMSFKIHAQ-KDASFYLVAPKTKKSDKYNYVVSYGGYTEKRMEFGTISVTIDER.NDEARS....QWHTQQL.FRPGQSeILHERANp.lSTFVPVPDT............................................-NFERNEDTNPPVSVS.SPEP...............................................---.EVNL.N.L.EDISHELTEKGREP..TPDPQ...............DDLARRLEEYER.....AASE.....VP.....DFALTQD-----.....................................GEETPSISLAPP.KPPGLPKSPEPAQTYR....-----------------....--PDPV...........................TIPNYTK.S.KA.......................................................NSRLLSRFLEGNRSNKIADG.STATTS.RLTSEQNLEYYRIRRSQGKTAADKYKTEC-l.......................................
Q9J1A7_9LUTE/202-650             ..............vdsstpe--PK.P.APEPTPAPQPTPTPQPTPEPTPApVPKRFFE.YVGTPTGVISTRENSDSISVSKLGGQSMQYIENEKCESKVIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGIGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDGVISFHVDATGTDACFYLAAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTFDESdVEAERI....ARHSETP.ARHNHI.LLSESYE...EPLPTIIDQ............................................---GLCDVKTPEQEIV.KVDE...............................................---.----.-.-.-EDRQTVS------..-----...............TEPDIALQEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSVKPVDSSGTP.LPK--SKEPEVLGTYQ....GMNIYPEDVPPVARQKLr..eAAKAPS...........................TMLYDKA.P.KG.......................................................SKSILSRFVEGNRSKATPAApTVSTTS.NMTREQLREYTRIRNSLGVTAAKEYKAQF-q.......................................
Q65862_9LUTE/1-306               .....................VDAE.P.GPSPGPSPDPPPPPSPSPEPAPA.KEERFIV.YSGVAHTIISAQSTDDSIIVRDIPDQRFRYVENENFYWFQIAAQWYSNTNTKAVPMFVFPVPIGEW.SVEISTEGYQATSSTTDPNKGRIDGLIAYDNSS-.EGWNIGAGSNVTITNNKADNSWKYGHPD...LEINSCHFNQNQVLEKDGIISFHVKATEKEANFFLVAPPVQKTSKYNYAVSYGAWTDRDMEFGLITVTLDEK.---RGS....GSPTRKS.LRAGHA.GVTTTTD...LVALPEMEN............................................--SGIETSETPSAPVT.SSKA...............................................PLP.TV--.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------sdseseddplsaapdvg.......................
D2K8U5_9LUTE/198-265             ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQL-------------------------.----------------------------------.----------------------------...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
A5A2X4_BYDVP/202-651             ..............vdsstpe--PK.P.APEPTPTPQPTPAPQPAPEPTPApVPKRFFE.YIGTPTGTISTRENTDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGKDASFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEAERI....TRHAETP.IRSKHI.LVSERYA...EPLPTIVNQ............................................---GLCDVKTPEQEQT.----...............................................---.---L.V.D.EDDRQTVS------..-----...............TESDIALQEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPMDTSGNL.IPK--PKEPEVLGTYQ....GQNIYPEDVPPMARQKLr..eAANAPS...........................TLLYERRtP.KK.......................................................SSNFLSRLVQANRSPTTPSApSVSTTS.NMTREQLREYTRIRNSSGITAAKAYKAQF-q.......................................
A5A334_BYDVP/202-650             ..............vdsstpe--PK.P.APEPTPAPQPTPAPQPTPEPTPTpVPKRFFE.YVGTPTGVISTRENSDSISVSKLGGQSMQYIENEKCESKVIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGIGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDGVISFHVDATGTDACFYLAAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTFDESdVEAERI....ARHSETP.ARLNHI.LVSEAYE...EPLPTIIDQ............................................---GLCDVKTPEQETL.EVDE...............................................---.----.-.-.-DDKQTVS------..-----...............TEPDIALQEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSVKPVDSSGTL.LPK--PKEPEVLGTYQ....GMNIYPEDVPPVARQKLr..eAAKAPS...........................TMLYDRA.P.RG.......................................................TKSILSRFIEGNKSKGTSAApSVSTYS.NMTREQLREYTRIRNSLGITAAKEYKASLQ........................................
Q17S69_9LUTE/202-684             .....................VDDS.S.PPGPSPTP-PPPPPAPAPEPQPC.KKYRFWG.YEGVPQNKIVTAQNDRNIDVRGLNYVKFYKWEDDNWTEVNLQANYSVNNSQYAEPYMIIPASKGKF.HVYLECDGQMAVKSVGGKADNSWRGLIAYDTSR-.RMWNVGNYKGCTIENYRKTDSFVLGHPD...VEVNDCKFDKARGVEADWYASFQLTCDDDEGSWILYAPPIPKDSLYNYTVSYGEYTENMCEWGAVSISIDE-.-DNSST....GNEVKIK.PGRGHL.VHRALPE...GTLEQQPLE............................................DVQVKEYFWKENQSET.TSDSdgesfiskik...........................gklpmttklpPKG.FLSR.L.K.PSEKEETARSKESE..VKPED...............VDNLVRAAGKEF.....QYGI.....YD.....DARERLHNKEFN.....................................QNMEELESDLEE.INRLEPPDIDVWRGKD....TAETVAVFEDPWEFFRK...qEDPNPP...........................KLKGTLS.K.IG.......................................................-SSIGGGSLSGGNLRRAAESvNEDSMKfKLSTTERNQYERIRKSKGETAARVYLRS--rf......................................
B3GQB0_PLRV/210-699              ...................vd--SG.S.EPGPS--------PQPTPTPTPQ.KHERFIA.YVGIPMLTIQARENDDQIILGSLGSQRMKYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNADS.DYWNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP-TDGRFFLVGPAIQKTARYNYTISYGDWTDRDMELGLITVVLDEH.LEGTGS....ANRVRRP.LREGHT.YMASPRE...PEGKPVGNKprd.....................................etpiQTQERQPDQTPSDDVS.DAGS...............................................VNS.GGST.E.S.LRLEFGVNSDSTYD..ATVDG...............TDWPRIPPPRHP.....PEPR.....VS.....GNSRTVTDFS--.....................................PKADLLENWDAEhFDPGYSKEDVAAATII....AHGSIQDGRSMLEKREEn..vKNKTSSwkpplpkavspaiaklrsirksqplekGTLKEDA.T.DG.......................................................VSSIGSGSLTGGTLKRKATI.EERLLQ.TLTTEQRLWYENLKKT-NPLAATQWMFEY-q.......................................
B1A413_9LUTE/202-640             .....................VDGE.P.GPKPGPDPTPP--PAPPPEPTPA.KHERFIV.YTGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVPQGTW.SVEISCEGYQATSSTTDPHRGKSDGMIAYDDDQT.KVWNVGVQNNVTITNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTGPNASFFLAGPAVKKIAKYNFCISYGAWTDRDMEFGLVSVVLDEH.LEGVRG....SQYVRKT.LRPGHI.SVNRTHR...LQEMPPMRE............................................DFSEEDNSSSDSNTY-.KTDN...............................................SPL.TVHL.V.K.AGDEENYTTDRSDD..VEPTL...............HDADVMK-----.....FSGF.....VG.....AKDRFTLQGADPi...................................gPGDRSVRRFRPS.ATLKSAFH--------....-----------------....SGPTPD...........................ELYNAGA.E.QAdhd.................................................fehFVSRGKEKLQDEDPMAKLER.EAEDLK.PDSDNEDNDYDRTAPVFNPVDGDPW-----sgik....................................
A7XUE7_9LUTE/202-640             .....................VDGE.P.GPKPGPDPTPP--PAPPPEPTPA.KHERFIV.YTGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQN.KVWNVGVQNNVTISNNKADADWKYGHPN...LTINGERFDQNQVVEKDGTVSFHLVTTGPNASFFLVGPPVKKIAKYNYCISYGAWTDRDMEFGLVSVVLDEH.LEGVRG....SQYVRKT.LRPGHI.SVNRSHR...LQEMPPMRE............................................DFSEEDNSSSDSNTY-.KTDN...............................................SPL.TVHI.V.K.AGDEENYTTDRSDD..VEPTL...............HDADVMK-----.....FSGF.....VG.....AKDRFTLQGADPi...................................gPGDRSVRRFKPS.ATLKSAFH--------....-----------------....SGPTPD...........................ELYNAGA.E.QAdhd.................................................fehFVSRGKEKLQDEDPMAKLER.EAEDLK.PDSDNEDNDYDRTAPVFNPADGDPWS----gik.....................................
Q7T6J4_9LUTE/1-415               .....................----.-.-----------------------.-------.-------------------------VTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYTPEAPE............................................QPTNEGTESMPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLVPTHADTLR.....QADK.....VR.....RALMANASRSAS.....................................PPPTNTEVPVLG.ATDTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPARS.E.TS.......................................................--TLQGGSLSGGSLRGG---.NLQALP.EATREQRREYERLKNSQGKTVAKAHAKEH-g.......................................
A5A316_BYDVP/203-650             ...............dsstpe--PK.P.APEPTPTPQPTPAPQPSPEPTPApVPKRFFE.YIGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEAERI....TRHAETP.IRSKHI.LVSEQYE...QPLPTIIDQ............................................---GLCDVQTPEQEQT.L---...............................................---.----.V.D.EEDKQTVS------..-----...............TEPDIALMEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPMDTSGNK.IPK--PKEPEVLGTYQ....GQNIYPEDVPPIARQKLr..eAANAPS...........................TLLYERT.P.KK.......................................................GNNFLTRFLEANRSPTTPAApTVSTVS.NMTREQLAEYTRIRKSLGLTAAKEYKAQF-q.......................................
B7TWC8_9LUTE/202-640             .....................VDGE.P.GPKPGPDPTPP--PAPPPEPTPA.KHERFIV.YTGTMSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKSQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQN.KVWNVGVQNNVTISNNKADADWKYGHPN...LTINGERFDQNQVVEKDGTVSFHLVTTGPNASFFLVGPPVKKIAKYNYCISYGAWTDRDMEFGMVSVVLDEH.LEGVRG....SQYVRKT.LRPGHI.SVNRSHR...LQEMPPMRE............................................-DFSEEDSSSSNDNTY.ETDN...............................................SPL.TIHL.V.K.AGDEENHTTDRSDD..VEPTL...............HDADVMK-----.....FSGF.....VG.....AKDRFTLQGADPi...................................gPGDRSVRRFRPS.ATLKSAFH--------....-----------------....SGPTPD...........................ELYNAGA.E.QAdhd.................................................fehFVSRGKEKLQDEDPMAKLER.EAEDLK.PDSDNEDNDYDRTAPVFNPADGDPWS----gik.....................................
Q8B6K4_9LUTE/1-518               .....................VDGE.P.GPKPGPDPAPQ--PTPTPEPTPA.KHERFIA.YTGTLSTLISARQSSDSISLYSIRSQRIRYIEDENSSWTNIDAKWYSQNSVEAIPMFVYPVPEGTW.SIEISCEGYQAASSTSDPHRGKCDGMIAYDDDSS.KVWNVGQQNNVTITNNKADNDWKYGHPD...LTINGDRFDQNQVVEKDGIISFHLVTTGPNASFFLVAPAVKKTAKYNFCVSYGDWTDRDMEFGMVSVVLDEH.LEGARS....SQYVRKS.PRSGHV.GVNRSHR...LQDNFVPAEyvs......................................dedSSSSSIVSNRPSTPDN.DSDAqfaesmkg..............................klpsqtklpPKG.FLSR.L.S.AKERKEISNSKPSN..VEGLV...............GPLVAAY--GYP.....SQTG.....VY.....DAAREILQAKEAaenlaelerdlkeink....lepqdvivqeeipdfvpPSEKILKEDDPD.YVPPIWQNADQAVLVS....SYEPPDWSRPAYESGNL....LKKAG-...........................ILKGTLS.K.LG......................................................gSLRSGESSLRGSLRKTQDQTdLDNKLS.KLSVIQRSQYQRILNNLGKMRARAYIDGL-d.......................................
H9NAD9_9LUTE/198-265             .................vgda----.-.PPTPTLTPT---PPAPTPAPA--.--SKYLG.YQGVPKNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQL-------------------------.----------------------------------.----------------------------...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
B0FKR8_BYDVP/201-644             .....................VDSStP.EPKPTPAPTPPPQPEPKPEPTPApPPKRFFE.YVGTPIGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWTGLIAYSNSSG.DNWGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVQASGKDACFYIMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEALRM....SRHSESP.TRVNNI.LIDEGYH...QTLPPIQNL............................................---GLCDVQTPGQDEV.EE--...............................................---.----.-.-.-DDKQTVS------..-----...............TEPDIALQEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPVDTSGEV.TPKPPPKDNEILGVYQ....GQPIYADDVPPIARQKLr..dAAKAPS...........................TLLYDKA.P.KS.......................................................-KSFLSRFVEGNRSKTETTApSTATTS.NLTREQLREYTRIRNSLGITAAREYKAQF-s.......................................
G0YSX3_9LUTE/1-490               ...................vd--D-.G.PPPPGPSP------PPSPSPPPP.VPSRFWG.YEGNPQCKILTAENNRNIDSRPLNFVSMYKWEDEKWDKVNLQAGYSRNDRRCMETYFVIPASRGKF.HVYLEADGEFVVKHIGGDCDGNWLGNIAYDVSQ-.RGWNIGDYKGCRISNYQSNTVFVAGHPD...AEMNGKHFDAARAVEVDWFASFELTCDDEDGAWRIYPPPIQKDSSYNYTVSYGDYTEKYCEWGAVSVSIDE-.--DNST....GTKSRIK.PHKGVM.MWSYPEK...ENSEGESES............................................ETDQGKDLKTPDATTL.VDFEsddnsssksaesipdntdlnpwnavvssksdrpfkqeddrvstssrlS--.----.-.-.--------------..-----...............---------GNL.....RRPG.....SG.....NPQLRSPLGREKapepsesdldaarikglpppreqlpgfkptrsistfnPEPDLVEAWRPG.TGPGYSKEDVAAATIL....AHGSIADGRSMLDKRDQ....------...........................EVLRSRS.S.WG.......................................................----TGGFLKKMKTSSSD--.KAEKLA.KLSTAERREYELIKNSSGKTQAALFLEQ--kv......................................
B1A410_9LUTE/202-640             .....................VDGE.P.GPKPGPDPTPP--PAPPPEPTPA.KHERFIV.YTGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVPQGTW.SVEISCEGYQATSSTTDPHRGKSDGMIAYDDDQT.KVWNVGVQNNVTITNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTGPNASFFLAGPAVKKIAKYNFCISYGAWTDRDMEFGLVSVVLDEH.LEGVRG....SQYVRKT.LRPGHI.SVNRTHR...LQEMPPMRE............................................DFSEEDNSSSDSNTY-.KTDN...............................................SPL.TVHL.V.K.AGDEENYTTDRSDD..VEPTL...............HDADVMK-----.....FSGF.....VG.....AKDRFTLQGADPi...................................gPGDRSVRRFRPS.ATLKSAFH--------....-----------------....SGPTPD...........................ELYNAGA.E.QAdhd.................................................fehFVSRGKEKLQDEDPMAKLER.EAEDLK.PDSDNEDNDYDRTAPVFNPADGDPWS----gik.....................................
C7AXW6_BYDVP/21-187              ..............vdsstpe--PK.P.APEPTPTPQPTPAPQPAPEPTPApVPERFFE.YIGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNSNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAHSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGH--...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
Q8QYQ3_PLRV/2-107                ...lekreenvknktsswkpp----.-.-----------------------.-------.------------------------------------------------------------------.----------------------------------.----------------------------...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....----LPKAVSPAIAKLRsirkSQPLEG...........................GILKKDA.T.DG.......................................................VSSIGSGSLTGGTLKRKVTI.EERLLQ.TLTTEQRLWYENLKKT-NPLAATQWLFEY-q.......................................
B0ZT69_9LUTE/201-655             .....................VDSStP.EPTPQPQPEPKPDPQPTPEPQ--.-HKRFFE.YVGTPYVIIQTRESSDSIAVKSMNDQSFQYIENETSEQRTVQAWWTSNNGVQAQAAFVFPIPAGEY.SVNISCEGLQSVDHIGGNRDGYWIGLIAYQNQSG.DYWGVGNYAGCDITNLLGTNTWRPGHED...LELNGCKFTNGQIVERDAVISFHVKAQGADPKFYLMAPKTMKSDKYNYVVSYGGYTDKRMEFGSISVTVDESdVEAQRY....NRHTSTV.RKTEN-.-RDYGWM...SVLPPYDPN............................................--------QVPEQEEE.QPMV...............................................DKE.MYSR.SpV.EPPSPTSDTEAERA..FDFRE...............EELTRARLEYEA.....ATES.....IP.....GAAPDILPSKSE.....................................MSSRPIDHDGRS.LPK--PQSKEVLGTYQ....GQNITPDDVPPVIAEKLr..eVNRAPS...........................TLLYDRQ.P.KT.......................................................PKSSLSRFVETNKTSLASPG.SQSSTS.GMTREQASEYTRIRKSMGLTAAKEYKASL-a.......................................
Q91AV3_9LUTE/1-422               ....................m----.-.-----------------------.-------.----------AQSTDDAISLYDMPSQRFRYIEDENMNWTNLNSRWYSQNNLKAIPMIIVPVPQGEW.TVEISMEGYQPTSSTTDPNKDKQDGLIAYNDDLN.EGWNVGIYNNVEITNNKADNTLKYGHPD...MELNNCHFNQGQCLERDGDLTCHVKTTGDNASFFIVGPAVQKQSKYNYAVSYGAWTDRMMEIGMIAIALDEQ.--GSSG....STRTQRP.KRAGHS.MAVSTWE...TINYPEKENse........................................itETSQRQDFKTPLHISE.GSDPlevgeg...................................gvplpvDEN.IPDF.V.G.DDPWFKISTRKPQE..EEAMS...............QSSVLKP---QL.....KPPG.....LP.....RPQPVRTIRDFD.....................................PKPDLVEAWRPD.VNPGYSKEDVAAATVM....YGGSVHEGRSMIDKRDK....------...........................AVLNGRK.R.WG.......................................................--SSLASSLTGGTLKASA--.KSEKLA.TLTSSERAQFERIKRQQGATRASEFLEQL-l.......................................
F8RUJ2_9LUTE/198-418             ..................vgd----.A.PPTPITTP--T-PPAPTPAPAP-.---KYFG.YQGVPSNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAI---.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
Q65874_9LUTE/1-306               .....................VDAE.P.GPSPGPSPDPPPPPSPSPEPAPA.KEERFIV.YSGVAHTIISAQSTDDSIIVRDIPDQRFRYVENENFYWFQIAAQWYSNTNTKAVPMFVFPVPIGEW.SVEISTEGYQATSSTTDPNKGRIDGLIAYDNSS-.EGWNIGAGSNVTITNNKADNSWKYGHPD...LEINSCHFNQNQVLEKDGIISFHVKATEKEANFFLVAPPVQKTSKYNYAVSYGAWTDRDMEFGLITVTLDEK.---RGS....GSPTRKS.LRAGHA.GVTTTTD...LVALPEMEN............................................--SGIETSETPSAPVT.SSKA...............................................PLP.TV--.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------sdseseddplsaapdvg.......................
Q70FV4_9LUTE/1-417               ....................e----.-.-----------------------.-------.------------------------NVTMYLWKDESWSIEQLPAGYRVNNRERAIPFVLFPIDKGRY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTVSNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKIMEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYNPETPE............................................ESKDEGTESTPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLTPTSADTLR.....QADK.....VR.....RALMANASRSAS.....................................PPPSTTEVPVLG.ATDTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPARS.E.TS.......................................................--TLQGGSLGGGSLRGG---.NLQVLP.EATREQRREYERLKNSQGKTVARAHAKEH-g.......................................
A5A2Y6_BYDVP/202-650             ..............vdsstpe--PK.P.APEPTPTPQPTPAPQPAPEPTPApAPKRFFE.YIGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCLFTDGQIVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYRGYTNKRMEFGTISVTCDESdVEAERT....TRHAETP.IRSKHI.LVSEQYE...QPLPTIIDQ............................................---GLCDVQTPEQEQT.L---...............................................---.----.V.D.EEDKQTVS------..-----...............TEPDIALMEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPVDTSGNK.IPK--PKEPEVLGTYQ....GQNIYPEDVPPIARQKLr..eAANAPS...........................TLLYEKT.P.KK.......................................................SNNFLTRFVEANRSPTTPAApSVSTVS.NMTREQLAEYTRIRKSLGLTAAKEYKAQF-q.......................................
H9NAC9_9LUTE/198-265             ..................vgd----.A.PPTPTPTPTPS---APTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQL-------------------------.----------------------------------.----------------------------...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
Q6STE1_BYDVP/181-421             ....................s-DPK.P.APEPTPTPQPTPAPQPAPEPTPApIPKRFFE.YIGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVE----....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------el......................................
O93184_PEMV1/190-474             ...................xg--DD.A.PPSPGPDPGPQPPPPPPPSPTPV.-GARFWG.YEGVTETRMVSERNDHDIDVKPLSFITMYKWEDESWTSVKLAASYLQNDQVEATPYFLIPSSKGKF.SVYIECEGFQAVKSIGGKSDGCWGGLIAYNRKK-.DGWQARAYAGTLLSNYRSTTTVIDGHPD...CEVNDCKFLPDRGVESDLICSFHLEAE-DDSYCLLQAPPIQKSSDYNYVVSYGGYTEKSIEWGSVSVSIDEV.-NQTAS....ASPWRGR.ARKL--.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------ailqesavpppsppggvmdyrlgnregdqtgtsekgl...
Q65877_BYDVR/5-449               ..................tse--PQ.P.APEPTPTPQPTPAPQPAPEPTPApVPKRFFE.YIGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEAERI....TRHAETP.IRFKHI.LVSEQYE...QPLPTIIDQ............................................---CLCDVQTPEQEQT.L---...............................................---.----.V.D.EEDKQTVS------..-----...............TEPDIALMEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPVDTSGNK.IPK--PKEPEVLGTYQ....GQNIYPEDVPPIARQKLr..eAAKTPS...........................TLLYEKT.P.KK.......................................................SNNFLTRFVEANRSPTTPAApTVSTVS.NMTREQLAEYTRIRKSLGLTAAKEYKAQF-q.......................................
Q5UUX6_9LUTE/201-655             .....................VDSStP.EPTPQPQPEPKPDPQPTPEPQ--.-HKRFFE.YVGTPYVIIQTRESSDSIAVKSMNDQSFQYIENETSEQRTVQAWWTSNNGVQAQAAFVFPIPAGEY.SVNISCEGLQSVDHIGGNRDGYWIGLIAYQNQSG.DYWGVGNYAGCDITNLLGTNTWRPGHED...LELNGCKFTNGQIVERDAVISFHVKAQGADPKFYLMAPKTMKSDKYNYVVSYGGYTDKRMEFGSISVTVDESdVEAQRY....NRHTSTV.RKTEN-.-RDYGWM...SVLPPYDPN............................................--------QVPEQEEE.QPMV...............................................DKE.MDSR.SpV.EPPSPTSDTEAERA..FDLRE...............EELTRARLEYEA.....ATES.....IP.....DAAPDVLPSKSE.....................................MSSRPIDHDGRS.LPK--PQSKEVLGTYQ....GQNITPDDVPPVIAEKLr..eVNRAPS...........................TLLYDRQ.P.KT.......................................................PKSFLSRFVETNKTSLASPG.SQSSTS.GMTREQASEYTRIRKSMGLTAAKEYKASL-a.......................................
Q70FV9_9LUTE/1-414               ....................e----.-.-----------------------.-------.------------------------NVTMYLWKDESWSIEQLPAGYRVNNRERAIPFVLFPVDKGRY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTVSNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGHFGLEAPPIEKSDHFNFVVSYANFTDKIMEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYTPEAPE............................................ESENEGTESTPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLTPTSADTLR.....QADK.....VR.....RALMANASRSAS.....................................PPPSTTEVPVLG.ATDTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPARS.E.TS.......................................................--TLQGGSLGGGSLRGG---.NLQVLP.EATREQRREYERLKNSQGKTVARAHA----r.......................................
B0FKN2_BYDVP/201-646             .....................VDSStP.EPKPTPAPTPAPAPEPKPEPTPApPPKRFFE.YVGTPVGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEASGKDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEALRM....TRHSECP.TRVNNI.LIDEGFC...QPLSTTTDQ............................................---GLCDVQTPGQEQE.VV--...............................................---.----.-.-.EEDRQTVS------..-----...............TGSDIALMEYEA.....ATAE.....IP.....DAEEDALPSREQ.....................................LSSKPVDTSGEE.IPKPRPPNNEVLGVYQ....GQPIYAEDVPPGTRQKLr..dAAKAPS...........................TLLYDKT.P.KR.......................................................SKSILSRFIEGNRSSVESAApSTATTS.NLTREQLREYTRIRNTLGLTAAKAYKAQF-s.......................................
Q7T6K1_9LUTE/1-415               .....................----.-.-----------------------.-------.-------------------------VTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGRY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTVSNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSHANFTDKIMEWGSISVAVDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVFNPETPE............................................ESKNEGTESTPPAPNP.ALGPdnpatkeptp...........................kivdnpdprvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLTPTSADTLR.....QADK.....VR.....RALMANASRSAS.....................................PPPSTTEVPVLG.ATDTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPARS.E.TS.......................................................--TLQGGSLGGGSLRGG---.NLQVLP.EATREQRREYERLKNSQGKTVARAHAKEH-g.......................................
Q8QYP3_PLRV/210-699              ...................vd--SG.S.EPGPS--------PQPTPTPTPQ.KHERFIA.YVGIPMLTIQARESDDQIILGSLGSQRMKYIEDENQNYTNISSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNADS.DYWNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP-TDGRFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEH.LEGTGS....ANRVRRP.PREGHT.YMASPRE...PEGKPVGNKprd.....................................etpiQTQERQPDQTPSNDVS.DAGS...............................................VNT.GGST.E.S.LQLEFGVNSDSTYD..ATVDG...............TDWPRIPPPRHP.....PEPR.....VS.....GNSRTVNDFS--.....................................PKADLLENWDAEhFDPGYSKEDVAAATII....AHGSIQDGRSILEKREEn..vKNKTSSwklplpkavspaiatlrsirksqplegG------.-.-Tlkkd...............................................atdgVSSIGSGSLTGGTLKRKVTI.EERLLQ.TLTTEQRLWYENLKKT-NPLAATQWLYEY-q.......................................
B3FHC0_9LUTE/221-670             ..................xrd----.A.APAPSPSP-PSPTPAPTPAPTP-.QPERFFV.YAGVPGVDIQTRETDDSIIVGRLNSERLRYVEDEQQTLVDIRADWYSNNSVEAVPMLLFDLEEGSW.SVDAECQGYQAVTAVGGSEDSNWLGFIAYNNANG.ATWNVGEYNNVKITKLLNTSSWKKGHKD...VVLNGCHFNDGQIIERDSTMSFHCEVGHGGGTILLVAPPVCKSDKYNYVVSYGEYTTKHMEFGSIAICFDEK.NDGARA....GKFLGAPfPRAGHV.VREQQTE...IARFPAGSDv.........................................piVKISDNDFATSTQPAA.HILP...............................................VPS.SVQL.P.D.DPVSKKVR----SW..IENSS...............EDLRLAR-----.....EAEQ.....TD.....SDWEPLPPPAPP.....................................PGPRQLPTDTSG.ATQAIRNQILRDHTQP....---YSGPGTPPVF----....-DDIED...........................TRSTTRT.E.SS.......................................................RRSFLSGVLRPQLKPKSNLRpTSSLPR.KLTADQEARVKAVRESFGSAAAKRLR----defl....................................
Q84819_PLRV/1-490                ...................vd--SG.S.EPGPS--------PQPTPTPTPQ.KHERFIA.YVGIPMLTIQARENDDQIILGSLGSQRMKYIEDENQNYTNVNSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNADS.DYWNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP-TDGRFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEH.LEGTGS....ANRVRRP.PREGHT.YMASPRE...PEGKPVGNKprd.....................................etpiQTQERQPDQTPSDDVS.DAGS...............................................VNS.GGST.E.S.LQLEFGVNSDSTCD..ATVHG...............TDWPRIPPPRHP.....PEPR.....VS.....GNSRTVTDFS--.....................................PKADLLENWDAEhFDPGYSKEDVAAATII....AHGSIQDGRTMLEKREEn..iKNKTSSwkpplpkavspa..iaklrsirksqplE------.-.-Ggtlkk.............................................dttdgVSSIGSGSLTGGTLKRKVTI.EENLLQ.TLTTEQRLWYENLKKT-NPLAATQWLFEY-q.......................................
Q45GB7_9LUTE/204-661             .....................VDKE.P.GPSPG--------PSPSPQPTPS.KKYRFIV.YTGVPVTRIMAQSTDDAISLYDMPLQRFRYIEDENMNWTNLDSRWYSQNSLKAIPMIIVPVPQGEW.TVEISMEGYQPTSSTTDPNKDKQDGLIAYNDDLK.EGWNVGVYNNVEITNNKADNTLKYGHPD...MELNSCHFNQGQCLERDGDLTCHVRTTGDNASFFIVGPAVQKQSKYNYAVSYGAWTDRMMEIGMIAIALDEQ.--GSSG....SAKIERP.KRVGHS.MAVSTWE...TINLPEKENse........................................efKTDQRQDLKTPPAAGG.SSDMld...........................................ivQGG.LPLP.V.E.EDIPDSIMDDPWSN..IPAKS...............SQEGEAMTSKSG.....FKPQ.....LK.....PPGLPKPQPVRTir................................nfdPKPDLVEAWRPD.VNPGYSKEDVAAATVM....YGGSVKEGRSMIDKRDK....------...........................AVLDGRK.S.WG.......................................................--SSLASSLTGGTLKASA--.KSEKLA.KLTSSERAQFERIKRQQGATRASEFLEQL-l.......................................
Q7T6K6_9LUTE/1-415               .....................----.-.-----------------------.-------.-------------------------VTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpAQVSAPS...EVYTPEAPE............................................QPTNEGTESMPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLVPTHADTLR.....QADK.....VR.....RALMANASCSAS.....................................PPPTNTEVPVLG.ATDTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPARS.E.TS.......................................................--TLQGGSLSGGSLRGG---.NLRALP.EATREQRREYERLKNSQGKTAAKAHAKEH-g.......................................
Q19A29_BYDVP/3-243               ....................s-DPK.P.APAPTPTPQPTPAPQPAPEPTPApVPKRFFE.YIGTPTGVISTRENSDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGSNACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTLSVTCDDSdVE----....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------el......................................
F8RUK7_9LUTE/198-418             ..................vgd----.A.PPTPTPIPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPLVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFDLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAI---.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
B0FL20_BYDVP/201-646             .....................VDSStP.EPKPTPAPTPAPAPEPKPEPTPApPPKRFFE.YVGTPVGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCVFTNFLATNTWRPGHKG...LKLNDCQFTDGQIVERDAVMSFHVEASGKDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEALRM....TRHSECP.TRVNNI.LIDEGYC...QPLSTITDQ............................................---GLCDVQTPGQDQE.VV--...............................................---.----.-.-.EEDRQTVS------..-----...............TESDIALKEYEA.....ATAE.....IP.....DAGEDALPSREQ.....................................LSSKPVDTSGEE.IPKPRPPSNEVLGVYQ....GQPIYAEDVPPVARQKLr..dAAKAPS...........................TLLYDKT.P.KR.......................................................SKSILSRFIEGNRSSVESAApSTATTS.NLTREQLREYTRIRNTLGLTAAKAYKAQF-s.......................................
Q84822_PLRV/1-490                ...................vd--SG.S.EPGPS--------PQPTPTPTPQ.KHERFIA.YVGIPMLTIQARENDDQIILGSLGSQRMKYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNADS.DYWNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP-TDGRFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEH.LEGTGS....ANRVRRP.PREGHT.YMASPRE...PEGKPVGNKprd.....................................etpiQTQERQPDQTPSDDVS.DAGS...............................................VNG.GGST.E.S.LQLEFGINSDSTYD..ATVDG...............TDWPKIPPPRHP.....PEPR.....VS.....GNSRTVTDFS--.....................................PKADLLENWDAEhFDPGYSKEDVAAATII....AHGSIQDGRSMLEKREEn..vKNKTSSwkppspkavspa..iaklrsirksqplE------.-.-Ggtlkk.............................................datdgVSSIGSGSLTGGTLKRKATI.EERLLQ.TLTTEQRLWYENLKKT-NPSAATQWLFEY-q.......................................
C7AXW9_BYDVP/21-187              ..............vdsstpe--PK.P.APEPTPTPQPTPAPQPAPEPTPApVPKRFFE.YIGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGH--...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
B1A416_9LUTE/202-640             .....................VDGE.P.GPKPGPDPTPP--PAPPPEPTPA.KHERFIV.YTGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAIPMFIYPVPQGTW.SVEISCEGYQATSSTTDPHRGKSDGMIAYDDDQT.KVWNVGVQNNVTITNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTGPNASFFLAGPAVKKIAKYNFCISYGAWTDRDMEFGLVSVVLDEH.LEGVRG....SQYVRKT.LRPGHI.SVNRTHR...LQEMPPMRE............................................DFSEEDNSSSDSNTY-.KTDN...............................................SPL.TVHL.V.K.AGDEENYTTDRSDD..VEPTL...............HDADVMK-----.....FSGF.....VG.....AKDRFTLQGADPi...................................gPGDRSVRRFRPS.ATLKSAFH--------....-----------------....SGPTPD...........................ELYNAGA.E.QAdhd.................................................fehFVSRGKEKLQDEDPMAKLER.EAEDLK.PDSDNEDNDYDRTAPVFNPADGDPWS----gik.....................................
E0A2S5_9LUTE/1-137               ....................g----.-.-----------------------.-------.------------------------------------------------------------------.----------------------------------.ATWNVGEYNNVKITKLLNTSSWKKGHKD...VVLNGCHFNDGQVIERDSTMSFHCEVGHGGGTILLVAPPVCKSDKYNYVVSYGEYTTKHMEFGSIAICFDEK.NDGARA....GKFLGAPfPRAGHV.VREQQTE...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------iarfpagsd...............................
G3E238_9LUTE/1-259               .....................----.-.-----------------------.-------.-----------------------------------MNWTNVDARWYSSNNVKAVPMYVFPVPEGTW.SVEISTEGYQPTASTTDPNKGKVDGMIAYSDDQS.EVWNVGINQNCNITNLKADNSWKYGHPD...MEINNCHFNQGQVLEMDGTISFHVETTGSDASFFLVGPAVQKQSKYNYAVSYGAWTDRDMELGLISVSLDEK.-DG-SR....GSAMKRP.RREGHS.KAVSTWE...TINLPEKENse........................................ksITSQRQDSKTQPQ---.----...............................................-QG.FSDA.G.S.ED------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------nkerdftpgtrmflpedfeeprevqnddllrdrg......
Q9QQN6_9LUTE/1-467               ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYTPEAPE............................................QPTNEGTESMPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLVPTHADTLR.....QADK.....VR.....RALMANASRSAS.....................................PPPTNTEVPVLG.ATDTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPARS.E.TS.......................................................--TLQGGSLSGGSLRGG---.NLQALP.EATREQRREYERLKNSQGKTVAKAHAKEH-g.......................................
Q7T6K9_9LUTE/1-415               .....................----.-.-----------------------.-------.-------------------------VTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTN-QLVERDFSCSFYLEVP-QQGYFGLEAPPIEKSDHFNFVVSHANFTDKILEWGSISVAIDEVnDGAYNR....SKWDKTA.AMSARLpTQVSALS...EVYTPETPE............................................QPTDEGTESMPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLTPTSADTLR.....QADK.....VR.....RALMANASRAAS.....................................PPPTATEVPVLG.AADTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPVRS.E.TS.......................................................--TLQGGSLSGGSLRGG---.NLRALP.EATREQRREYERLKNSQGRTVAKAHAQEH-g.......................................
A5A2T2_BYDVP/202-644             .....................VDSStP.EPKPAPEPT--PAPQPAPEPTPApVPKRFFE.YIGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEAERI....TRHAETP.IRSKHI.LVSEQYE...RPLPTIINQ............................................---GLCDVQTPEQEQT.L---...............................................---.----.V.D.EEDKQTVS------..-----...............TEPDIALMEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPVDTSGNK.IPK--PKEPEVLGTYQ....GQNIYPEDVPPIARQKLr..eAANAPS...........................TLLYEKT.P.KK.......................................................SNNFLTRFVEANRSPTTPAApTVSTVS.NMTREQLAEYTRIRKSLGLTAAKEYRAQF-q.......................................
Q8B6K6_9LUTE/1-519               .....................VDGE.P.GPKPGPDPAPQ--PTPTPEPTPA.KHERFIA.YTGTLSTLISARQSSDSISLYSIRSQRIRYIEDENSSWTNIDAKWYSQNSVEAIPMFVYPVPEGTW.SIEISCEGYQAASSTSDPHRGKCDGMIAYDDDSS.KVWNVGQQNNVTITNNKADNDWKYGHPD...LTINGDRFDQNQVVEKDGIISFHLVTTGPNASFFLVAPAVKKTAKYNFCVSYGDWTDRDMEFGMVSVVLDEH.LEGARS....SQYVRKS.PRPGHF.GVNRSHR...LQDSFTPVEyvs.....................................eddsSSSSSIVSNRPSTPVS.DSDAqfaeslkg..............................klptqsklpPKG.FLSR.L.S.AKEKEEISKSRPSN..VESQV...............EPLVKAY--GYP.....SQTG.....VY.....DAAREILQAKEAaenlaelerdlkeinr....leprdvivqeeipdfvpPSEKVVQEDNPE.YTPPIWRNADQAVTVS....SYEPPDWSRPAYE----....SGDPPK...........................KAGTLKG.T.LSki...................................................ggSLRSGESSLRGSLRKTRDQSdLDNKLS.KLSVIQRSQYQRILNNLGKTRAREYIDGL-d.......................................
E0A2S2_9LUTE/1-137               ....................g----.-.-----------------------.-------.------------------------------------------------------------------.----------------------------------.ATWNVGEYNNVKITKLLNTSSWKKGHKD...VVLNGCHFNDGQVIERDSTMSFHCEVGHGGGTILLVAPPVCKSDKYNYVVSYGEYTTKHMEFGSIAICFDEK.HDGARA....GKFLGAPfPRAGHV.VREQQTE...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------iarfpagsd...............................
Q8QYN6_PLRV/210-699              ...................vd--SG.S.EPGPS--------PQPTPTPTPQ.MHERFIA.YVGIPMLTIQARENDDQIILGSLGNQRMKYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNADS.DYWNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP-TDGRFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEH.LEGTGS....ANRVRRP.PREGHT.YMASPRE...PEGKPVENKprd.....................................etpiQTQERQPDQTPSDDVS.DAGS...............................................VNS.GGST.E.S.LRLEFGVNSDSTYD..ATVDG...............TDWPRIPPPRHP.....PEPR.....VS.....GNPRTVTDFS--.....................................TKADLLENWDAEhFDPGYSKEDVAAATII....AHGSIQDGRSMLEKREEn..vKNKTSSwkpplpka..........vspaiaklrSIRKSQS.L.EGgtlkk.............................................datdgVSSIGSGSLTGGTLKRKATI.EERLLQ.TLTTEQRLWYENLKKT-NPLAATQWLFEY-q.......................................
E0YC37_9LUTE/201-329             .....................VDD-.S.SPPPAPTPPPPPPPSPSPEPKPC.KKDRFWG.YEGVPQNKISAARNNQFIDVKTLNYVQMYKWEDDRWDRVNMQASYARNDRNYAEPYMVIPANKGKF.HVYVECDGQMAVKSIGGKADNSWNGLIAY-----.----------------------------...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
F8RUG8_9LUTE/198-418             ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-HLVERDFSCSFHLEVP-QQGLFGLEAPPIEKNDHFNFVVSCANFTDKILEWGSISVAI---.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
Q9IZF4_9LUTE/206-510             .....................VDAE.P.GPSPGPSPDPPP-PSPSPEPAPA.KEERFIV.YSGVAHTVITAQGTDDSIIVKDIPDQRFRYVENENFYWFQIAAQWYSNTNTKAVPMFVFPVPIGEW.SVEISTEGYQATSSMTDPNKGRIDGLIAYDNSN-.EGWNIGAGSNVTITNNKADNSWKYGHPD...LEINSCHFNQNQVLEKDGLISFHIKATEKEANFFLVAPPVQKTSKYNYAVSYGAWTDRDMEFGLISVTLDEK.---RSS....GSPTRKS.LRAGHT.QVASTTD...LVASPEKDN............................................--SGIQTSETPAVPVT.SSKA...............................................PIP.MVS-.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------dseseddplsaapdvg........................
D2K8U0_9LUTE/198-265             ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KFFG.YQGVPNNVVKTRGNSEYLDVGPLENVTMYRWKDESWSIEQL-------------------------.----------------------------------.----------------------------...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
Q460A0_BYDVP/202-650             ..............vdsstpe--PK.P.APEPTPTPQPTPAPQPAPEPTPApVPKRFFE.YIGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGMIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQVVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTFDESdVEAKRI....TRHAETP.IRSKHI.LVSERYE...EPLPTITNQ............................................---GLCDVKTPEQEQT.L---...............................................---.----.V.D.EEDRQTVS------..-----...............TEPDVALQEYEA.....AIAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPLDTSGNI.IPK--SKEPEVLGTYQ....GQNIYPEDVPPLARQRLr..eAAKAPS...........................TLLYERT.P.KK.......................................................SNNFLTRFVEANRSPTTPAApTVSTTS.NMTREQLAEYTRIRKSLGLTAAKEYKAQF-q.......................................
Q80FH7_9LUTE/198-664             ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYTPEAPE............................................QPTNEGTESMPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLVPTHADTLR.....QADK.....VR.....RALMANASRSAS.....................................PPPTNTEVPVLG.ATDTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPARS.E.TS.......................................................--TLQGGSLSGGSLRGG---.NLQALP.EATREQRREYERLKNSQGKTVAKAHAKEH-g.......................................
B0FL26_BYDVP/201-646             .....................VDSStP.EPKPTPAPTPAPTPEPKPEPTPApPPKRFFE.YVGTPIGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEASGKDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEALRM....TRHSECP.TRVNNI.LIDEGYC...QPLSTITDQ............................................---GLCDVQTPGQDQE.VV--...............................................---.----.-.-.EEDRQTVS------..-----...............TESDIALKEYEA.....ATAE.....IP.....DAEEDALPSREQ.....................................LSSKPVDTSGEE.IPKPRPPSNEVLGVYQ....GQPIYAEDVPPGTRQKLr..dAAKAPS...........................TLLYDKT.P.KR.......................................................SKSILSRFIEGNRSSVESAApSTATTS.NLTREQLREYTRIRNTLGLTAAKEYKARL-l.......................................
Q7T6K3_9LUTE/1-415               .....................----.-.-----------------------.-------.-------------------------VTMYLWQDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYKTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFSLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVnDGAYSR....SKWDKTA.AMSARLpTQVSAPS...EVYTPETPE............................................QPTDEGTESMPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLTPTSADTLR.....QADK.....VR.....RALMANASRAAS.....................................PPPTTTEVPVLG.AXDTASQSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPVRS.E.TS.......................................................--TLQGGSLSGGSLRGG---.NLRALP.EATKEQRREYERLKNSQGKTVAKAHAKEH-g.......................................
E7FL73_9LUTE/208-720             .....................VEGS.T.PPPPPPSG-PEP-PPPPPQPEPC.KKNRFWG.YEGNPQSKILTAENDRNIDSRPLNFVSMYKWEDEKWDKVNLQAGYSRNDRRCMETYLTIPADKGKF.HVYLEADGEFVVKHIGGDLDGSWLGNIAYDVSQ-.RGWTVGNYKGCKIKNYQTNITFVAGHPE...AKMNGKAFDSARAVEVDWFASFELECDDEEGSWMIYPPPIQKDSSYNYTVSYGNYTEKYCEWGAISVSIDED.----NE....GYAPRRI.PRKGEM.-AWSYPE...KDYSENKPQkenwdt...............................epldtgeMQRERQLVKTPSPDVS.DSGSefgad....................................pipqdlI--.----.-.-.----DKVNRGEALD..P----...............--MQQLEYDKYR.....FQEN.....VI.....ELSESQDQSSEYpklpppvphkp...............lplgrtekffrPRADLLEAWDKDhFDPGYTKEEVAAATII....SHGSITDGRAAIEERDN...kI-QRARvswphd...............ksttspSIAKLRE.E.TSekkalfgg.......................................slrrgseaASSLGGGSITGGTLKSKRTV.EEGIVP.KLTTTQRLRYEQLKAR-SQTAANEYLWS--ve......................................
A5A2U4_BYDVP/202-650             ..............vdsstpe--PK.P.APEPTPTPQPTPAPQPAPEPTPApVPKRFFE.YIGTPTGIISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAVFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEAERI....TRHAETP.IRSKHI.LVSEQYE...QPLPTIIDQ............................................---GLCDVQTPEQEQT.L---...............................................---.----.V.D.EEDKQTVS------..-----...............TEPDIALMEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPVDTSGNK.IPK--SKEPEVLGTYQ....GQNIYPEDVPPIVRQKLr..eAAKAPS...........................TLLYEKT.P.KK.......................................................SNNFLTRFVEANRSPTTPAApTVSTAS.NMTREQLAEYTRIRKSLGLTAAKEYKAQF-q.......................................
Q9JH75_9LUTE/2-467               ..................xda----.-.PPTPTPTP--TP-PAPTPAPA--.--XKYXG.YQGVPXNIVKTRGNSEYLDVGPLENVTMYLWXDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYXTSDSNVPGHPD...MKVNGGSFTD-QLVERDXSCSFHLEVP-QQGYFXLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVnDGAYSR....SKWDKTX.AMSARLpTQVSAXS...EVYTPEAPE............................................QPTNEGTESMPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLXPTXADTLR.....QADK.....VR.....RALMANASRXAS.....................................PPPTXXEVPXLG.AXDTASXSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPXRS.E.TS.......................................................--TLQGGSLSGGSLXGG---.NLXALP.EATXEQRREYERLKNSQGXTVAKAHAKEH-g.......................................
A7XUE2_9LUTE/202-640             .....................VDGE.P.GPKPGPDPTPP--PAPPPEPTPA.KHERFIV.YTGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQT.KVWNIGVQNNVTISNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTGPNASFFLAGPAVKKIAKYNFCISYGAWTDRDMEFGMVSVVLDEH.LEGVRG....SQYVRKT.LRPGHI.SVNRTHR...LQEMPPMRE............................................DFSEEDNSSSDSNTY-.KTDN...............................................SPL.TVHF.V.K.AGDEENYTTDRSDD..VEPTL...............HDADVMK-----.....FSGF.....VG.....AKDRFTLQGADPi...................................gPGDRSVRRFRPS.ATLKSAFH--------....-----------------....SGPTPG...........................ELYNAGA.E.QAdhd.................................................fehFVSRGKEKLQDEDPMAKLER.EAEDLK.PDSDNEDNDYDRTAPXFNPADGDPWS----gik.....................................
B0FKQ0_BYDVP/201-643             ....................v-DS-.S.TPEPTPAPAPQPAPQPAPEPTPApVPKRFFE.YIGTPMGVISTRENTDSISVSQLGGQSMQYIENEKCETRTIDSFWSTNNNVAAQAAFVYPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGIIAYSNSSD.DNWGIGNYRGCSFKNYLATNTWRPGHKD...LKLNDCQFTGGQIVERDSIISFHVEATGADACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEAIRI....AKHSATP.NRANHL.LVSEQYQ...DALPTIENQ............................................---GLCDVETPGQQTN.----...............................................---.---V.V.E.EDDKQSVS------..-----...............TEPEIAVKEYEA.....AVAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPVDTSGNT.IPR--TKEPEILGTYQ....GQNIYPEDVPPVARQALr..eAAKAPS...........................TMLYDRA.P.KG.......................................................AKSILSRFVEGNRSKAAPVApSVSTTS.NMTREQLKEYTRIRNSLGVTAAKEYKAQF-l.......................................
G3E232_9LUTE/1-257               .....................----.-.-----------------------.-------.-----------------------------------MNWTNVDARWYSSNNVKAVPMYVFPVPEGTW.SVEISTEGYQPTASTTNPNKGKVDGMIAYSDDQS.EVWNVGINQNCNITNLKADNSWKYGHPD...MEINNCHFNQGQVLEMDGTISFRVETTGSDASFFQVGPAVQKQSKYNYAVSYGAWTDRDMELGLISVSLDEK.-DG-SR....GSAMKRP.RREGHS.KAVSTWE...TINLPEKENse........................................rsITSQRQDSKTQPQQ--.----...............................................--G.FS--.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------dagsednkewdftpgtrmflpedfeeprevqnddllrd..
B0FKX8_BYDVP/202-650             ..............vdsstpe--PK.P.APEPTPTPQPTPAPQPAPEPTPApVPKRFFE.YIGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYRGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEAERI....TRHAETP.IRSKHI.LVSEQYG...QPLPTIIDQ............................................---GLCDVQTPEQEQT.L---...............................................---.----.V.D.EEDKQTVS------..-----...............TEPDIALMEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPVDTSGNK.IPK--SKEPEVLGTYQ....GQNIYPEDVPPITRQKLr..eAAKAPS...........................TLLYEKT.S.KK.......................................................SNNFLTRFVEANRSPTTPAApTVSTAS.NMTREQLAEYTRIRKSLGLTAAKEYKAQF-q.......................................
Q99AS9_BYDVM/201-655             .....................VDSStP.EPTPQPQPEPKPDPQPTPEPQ--.-HKRFFE.YVGTPYVIIQTRESSDSIAVKSMNDQSFRYIENETSEQRTVQAWWTSNNGVQAQAAFVFPIPAGEY.SVNISCEGLQSVDHIGGNRDGYWIGLIAYQNQSG.DYWGVGNYAGCDITNLLGTNTWRPGHED...LELNGCKFTNGQIVERDAVISFHLKAQGADPKFYLMAPKTMKSDKYNYVVSYGGYTDKRMQFGTISVTVDESdVEAQRY....NRHTSAV.RKTENL.--DYGWM...SVLPPYDPN............................................--------QVPEQEEE.QPMV...............................................DKG.MDSR.S.PvEPPSPTSDTEAERA..FDLRE...............EKLTRARLEYEA.....ATES.....IP.....DAAPDILPSKSE.....................................MSSRPIDHDGRS.LPK--PQSKEVLGTYQ....GQNITPDDVPPVIAEKLr..eVNRAPS...........................TLLYDRQ.P.KT.......................................................PKSFLSRFVETNKTSLASPG.SQSSTS.GMTREQASEYTRIRKSMGLTAAKEYKASL-a.......................................
MCAPS_BYDVP/206-650              ...................pe--PK.P.APEPTPTPQPTPAPQPTPEPTPApVPKRFFE.YIGTPTGTISTRENTDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...LKLTDCQFTDGQIVERDAVMSFHVEATGKDASFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEAERI....TRHAETP.IRSKHI.LVSERYA...EPLPTIVNQ............................................---GLCDVKTPEQEQT.----...............................................---.---L.V.D.EDDRQTVS------..-----...............TESDIALLEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPMDTSGNI.IPK--PKEPEVLGTYQ....GQNIYPEDVPPMARQKLr..eAANAPS...........................TLLYERR.TpKK.......................................................SGNFLSRLVEANRSPTTPTApSVSTTS.NMTREQLREYTRIRNSSGITAAKAYKAQF-q.......................................
A0YD71_9GAMM/51-142              .................dntp---E.P.TPAPTPTPTPTPEPAPEPEPEPE.PERTFVS.VTGMA---VKGPLKDAIVSVYKIDTSSV--------------------------------------.----------------------------------.----------------------------...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------gykgqliaegvtdeaahlmldidsqyltdnl.........
Q5CC80_BYDVP/201-649             ..............vdssppe--PK.P.APEPTPTPQPTPAPQPTPEPTPApAPKRFFE.YVGTPTGTISTRENSDSISVSKLGGQSMQYMENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYRGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGNDACFYLMAPKTMITDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEAKHI....TRHAETP.IRSKHI.LVSERYV...EPLPTITDQ............................................---GLCDVKTPEQEQT.L---...............................................---.----.V.D.EEDRQTVS------..-----...............TEPDIALQEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPLDTSGNI.IPK--SKEPEVLGTYQ....GQNIYPEDVPPMARQRLr..eAAKAPS...........................TLLYERT.P.KK.......................................................SNNFLTRFMEANRSPTTPAApTVSTTS.NMTREQLAEYTRIRKSLGLTAAKEYKAQF-q.......................................
B0FKP4_BYDVP/201-646             .....................VDSStP.EPKPTPAPTPAPAPEPKPEPTPApPPKRFFE.YVGTPVGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEASGKDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEAFRM....TRHSECP.TRVNNI.LIDEGYC...QPLSTITDQ............................................---GLCDVQTPGQDQE.VV--...............................................---.----.-.-.EEDRQTVS------..-----...............TESDIALKEYEA.....AIAE.....IP.....DAEEDALPSREQ.....................................LSSKPVDTSGEE.IPKPRPLSNEVLGVYQ....GQTIYADDVPPGTRQKLr..dAAKAPS...........................TLLYDKT.P.KR.......................................................SKSILSRFLEGNRSSVESAApSTATTS.NLTREQLREYTRIRNTLGLTAAKEYKARL-s.......................................
Q670I2_9LUTE/210-687             .....................VDAE.P.GPSPGPSP-PP-LPTPTPEPTPK.QHERFIV.YVGSPTMDIQARENDDIITLTEPGPQNWRRIQDEDMNEVSLDSRFWTNSDLKAKPMFYFPVPAGSW.SVDITCEGYQPTSDPTKQGDNRSDGLIAYSADNNdNLWNVGQTGSLKISNLRGINTFKAGHPK...LVVNGCNFNDGQVMERDGTLSFHVQTE-KDGSFFLTGPPVQKQGRYNYTVSYGEWTKRILEFGLITVVLDEH.LDN-SG....SNKFKRP.PRNGHQ.WAGLVTD...TVMENTVSDk.........................................tpDPPKSKRKLEPEKANS.DNKL..............................................pEPQ.KRKL.V.I.DPKLDEVEVESIPD..APEDF...............NWATLGIPRGKG.....PASL.....AG.....FNDTELARGKDQss.................................ddELPSHFSAPGLD.EIPAKPQPVDLSQTSF....DYGTHIPNTDDLGMFDRp..gDKPVVS...........................GILDKQR.V.KSfgkr...............................................llpaLSGSTTSSLQGGTLRQKY--.SDATRK.YMSSEEVVKANKIRTSLGKTALANYLKSL-n.......................................
Q7T6K0_9LUTE/1-415               .....................----.-.-----------------------.-------.-------------------------VTMYLWKDESWSIEQLPAGYRVNNRERAIPFVLFPVDKGRY.SVFVQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTVSNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKIMEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYNPETPE............................................ESENEGTESTPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLTPTSADTLR.....QADK.....VR.....RALMANASRSAS.....................................PPPSTTEVPVLG.ATDTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPARS.E.TS.......................................................--TLQGGSLGGGSLRGG---.NLQVLP.EATREQRREYERLKNSQGKTVARAHAREH-g.......................................
Q80J50_9LUTE/201-655             .....................VDSStP.EPTPQPQPEPKPDPQPTPEPQ--.-HKRFFE.YVGTPYVIIQTRESSDSIAVKSMNDQSFQYIENETSEQRTVQAWRTSNNGVQAQAAFVFPIPAGEY.SVNISCEGLQSVDHIGGNRDGYWIGLIAYQNQSG.DYWGVGNYAGCDITNLLGTNTWRPGHED...LELDGCKFTNGQIVERDAVISFHVKAQGADPKFYLMAPKTMKSDKYNYVVSYGGYTDKRMEFGSISVTVDESdVEAQRY....NRHTSTV.GKAEN-.-RDYGWM...SVLPPYDPN............................................--------QVPEQEEE.QPMV...............................................DKE.MDSRpP.V.EPPSPTSDTEAERA..FDLRE...............EELTRARLEYEA.....ATES.....IP.....DAAPDVLPSKSE.....................................MSSRPIDHDGRS.LPK--PQSKEVLGTYQ....GQNITPDDVPPVIAEKLr..eVNRAPS...........................TLLYDRQ.P.KT.......................................................PKSFLSRFVETNKTSLASPG.SQSSTS.GMTREQASEYTRIRKSMGLTAAKEYKASL-a.......................................
Q8B6L0_9LUTE/1-517               .....................VDGE.P.GPKPGPSPTPP--PAPPPEPTPA.KHERFIV.YTGTVSTLISARQNSDSISLYSIRDQRVRYIEDENANWTNIKAQWYSQSSVEAIPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQT.KVWNVGVQNNVTISNNKADADWKYGHPN...LTINGERFDQNQVVEKDGTISFHLVTTGPNASFFLVGPAVKKIAKYNYCISYGAWTDRDMEFGLVSVVLDEH.LEGARG....SQYVRKT.LRPGHI.SVNRSHR...LQDSFTPVEyvs.....................................dedsSSNSSIVSNRPSTPDN.DSDTqfaeslrg..............................klpsqtqlpPKG.FLSR.L.S.AKEKEQISSSKPSN..VEKQV...............GPLVAAY--GYP.....SQTG.....VY.....DAAREILQAKEAaenlaelerdlkeink.....leppdvivqeeipdfvPPSERVFQESPE.YVPPVWRNADQAVTVS....SYEPPNWSRPANE----....SGDPPKk.........................gSLKGTLS.K.LG......................................................gSLRSGESSLRGSLRKTQDQSdLDYKLS.KLNVLQRSQYQRMLNNSGKTRARAYLDGL-d.......................................
B0FKY4_BYDVP/202-650             ..............vdsstpe--PK.P.APEPTPTPQPTPAPQPAPEPTPApVPKRFFE.YIGTPIGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYRGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEAERI....TRHTETP.IRSKHI.LVSEQYG...QPLPTIIDQ............................................---GLCDVQTPEQEQT.L---...............................................---.----.V.D.EEDKQTVS------..-----...............TEPDIALMEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPVDTSGNK.IPK--SKEPEVLGTYQ....GQNIYPEDVPPIARQKLr..eAAKAPS...........................TLLYEKT.S.KK.......................................................SNNFLTRFVEANRSPTTPAApTVSTAS.NMTREQLAEYTRIRKSLGLTAAKEYKAQF-q.......................................
Q8B6L4_9LUTE/1-519               .....................VDGE.P.GPKPGPDPAPQ--PTPTPEPTPA.KHERFIA.YTGTLSTLISARQSSDSISLYSIRSQRIRYIEDENSSWTNIDAKWYSQNSVEAIPMFVYPVPEGTW.SIEISCEGYQAASSTSDPHRGKCDGMVAYDDDSS.KVWNVGQQNNVTITNNKADNDWKYGHPD...LTINGDRFDQNQVVEKDGIISFHLVTTGPNASFFLVAPAVKKTAKYNFCVSYGDWTDRDMEFGMVSVVLDEH.LEGARS....SQYVRKT.PRSGHV.GVNRSHR...LQDNFVPTEyvs.....................................dedsSSNSSIVSNRPSTPDN.DSDAqfaesmkg..............................klpsqtklpPKG.FLSR.L.S.AKEKKEISNSKPSN..VEGLV...............GPLVAAY--GYP.....SQTG.....VY.....DAAREILQAKEAaenlaelerdlkeink....leppdvivqeeipdfvpPSERIFKEDDPD.YVPPIWQNADQAVLVS....SYEPPDWSRPAYE----....PGDPPK...........................KTGTLKG.T.LSkl...................................................ggSLRSGESSLRGSLRKTQDQTdLDNKLS.KLSVIQRSQYQRILNNLGKMRARAYIDGL-d.......................................
B0ZT81_9LUTE/201-655             .....................VDSStP.EPTPQPQPEPKPDPQPTPKPQ--.-HKRFFE.YVGTPYAIIQTRESSDSIAVKSMNDQSFQYIENETSEQRTVQAWWTSNNGVQAQAAFVFPIPAGEY.SVNISCEGLQSVDHIGGNRDGYWIGLIAYQNQSG.DYWGVGNYAGCDITNLLGTNTWRPGHED...LELNGCKFTNGQIVERDAVISFHVKAQGADPKFYLMAPKTMKSDKYNYVVSYGGYTDKRMEFGSISVTVDESdVEAQRY....NRHTSTV.RKTEN-.-RDYGWM...SVLPPYDPN............................................----QMPEQEEEQPMV.DKEM...............................................--D.PRSP.V.E.PPSP-TSYTEAERA..FDLRE...............EELTRARLEYEA.....ATGS.....IP.....DAAPDILPSKSE.....................................MSSRPIDHDGRS.LPK--PQSKEVLGTYQ....GQNITPDDVPPVIAEKLr..eVNRAPS...........................TLLYDRQ.P.KT.......................................................PKSFLSRFVETNKTSLASPG.SQSSTS.GMTREQASEYTRIRKSMGLTAAKEYKASL-a.......................................
F8RUM5_9LUTE/197-418             ..................xeg---D.A.PPTPTPTPT---PPAPTPAPGP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAI---.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
D2K8W5_9LUTE/198-265             ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQL-------------------------.----------------------------------.----------------------------...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
C7AXW5_BYDVP/21-187              ..............vdsstpe--PK.P.APEPTPTPQPTPAPQPAPEPTPApVPKRFFE.YIGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGH--...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
Q70FV3_9LUTE/1-417               ....................e----.-.-----------------------.-------.------------------------NVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYTPEAPE............................................QPTNEGTESMPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLVPTHADTLR.....QADK.....VR.....RALMANASRSAS.....................................PPPTNTEVPVLG.ATDTASLSGSLHGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPARS.E.TS.......................................................--TLQGGSLSGGSLRGG---.NLQALP.EATREQRREYERLKNSQGKTVARAHAREH-g.......................................
Q65972_9LUTE/201-662             .....................VDGS.S.PPPPSPSPTPPPPPPPQPQPQPC.AQ-RFWG.YEGNPQNKILTAENSRNIDSRPLNFVQMYKWEDEKWDKVNLQAGYSRNDRRCMETYLTIPADKGKF.HVYLEADGEFVVKHIGDELDGSWLGNIAYDVSQ-.RGWNVGNYKGCKITNYQSNTVFVAGHPD...ATMNGKSFDTARAVEVDWFASFELECDDEEGSWAIYPPPIQKDSSYNYTVSYGNYTEKYCEWGAISVSIDE-.---DNN....GNEPRRI.PRRGVM.-AWSTPE...PSFSGDDSQ............................................----RQDFNTPSLEER.GSDAleseekke...............................ednlldleEEN.IPDV.D.D.DDLWKGISRASEAG..TAEDD...............RASTSSRLRGNL.....KPKG.....LP.....KPQPTRTITEFN.....................................PGPDLIEVWRPD.LAPGYSKADVAAATVL....AGGSVHEGRDMLERREA....------...........................KVMDSRK.K.WG.......................................................-ILSSTSSLTSGALKKLS-A.QSEKLA.TLTTGERVQYQRLKNSMGSTVAAEYLEKV-l.......................................
D2K8X0_9LUTE/198-265             ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQL-------------------------.----------------------------------.----------------------------...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
F8RUH1_9LUTE/198-418             ....................v-DD-.A.PPTPIPQPTP---PAPAPAPAP-.---KYFG.YQGVPNNIIKTRGNSEYLDVGQLDSVTMYLWKDESWSIEKLSAGYRVNNRDRAIPYLLIPVEKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFICDNVNL-.QGWRAYAYTGCSISNYKTADSNVPGLPD...MRVNNCSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTEKIMEWGSVSIAI---.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
O92521_9LUTE/1-454               ..............vdsstpe--PK.P.APEPTPTPQPTPAPQPAPEPTPApVPKRFFE.YIGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSYiSVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHAD...LKLNDCQFPDGQIVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVQAERKfsplTRHAETT.IRSKHI.LVSERYE...EPLPTVINQ............................................---GLCDVKTPEQEQT.L---...............................................---.----.V.D.EEDRQTVS------..-----...............TEPDIALQEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPLDTSVNI.IPK--PKEPEVLGTYQ....GQNIYPEDVPPLARQRLr..eAAKAPS...........................TLLYERT.P.KK.......................................................SGNFLTRFVEANRSPTTPAApTVSTVS.NMTREQLAEYTRIRKSLGLTAAKEYKAQF-q.......................................
A5A2Z2_BYDVP/202-650             ..............vdsstpe--PK.P.APEPTPTPQPTPAPQPAPEPTPApAPKRFFE.YIGTPTGTISTRGNSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEAERT....TRHAETP.IRSKHI.LVSEQYE...QPLPTIIDQ............................................---GLCDVQTPEQEQT.L---...............................................---.----.V.D.EEDKQTVS------..-----...............TEPDIALMEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPVDTSGNK.IPK--PKEPEVLGTYQ....GQNIYPEDVPPIARQKLr..eAANAPS...........................TLLYEKT.P.KK.......................................................SNNFLTRFVEANRSPTTPAApSVSTVS.NMTREQLAEYTRIRRSLGLTAAKEYKAQF-q.......................................
F8RUG5_9LUTE/198-418             ....................v-DD-.A.PPTPTPQPTP---PAPAPAPAP-.---KYFG.YQGVPNNIIKTRGNSEYLDVGQLDSVTMYLWKDESWSIEKLSAGYRVNNRDRAIPYLLIPVEKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFICDNVNL-.QGWRAYAYTGCSISNYKTADSNVPGHPD...MRVNNCSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTEKIMEWGSVSIAI---.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
F8RUF9_9LUTE/198-664             ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYTPEAPE............................................QPTNEGTESMPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLVPTHADTLR.....QADK.....VR.....RALMANASRSAS.....................................PPPTNTEVPVLG.ATDTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPARS.E.TS.......................................................--TLQGGSLSGGSLRGG---.NLQALP.EATREQRREYERLKNSQGKTVAKAHAKEH-g.......................................
A5A328_BYDVP/202-650             ..............vdsstpe--PK.P.APEPTPTPQPTPAPQPAPEPTPApAPKRFFE.YIGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEAERT....TRHAETP.IRSKHI.LVSEQYE...QPLPTIIDQ............................................---GLCDVQTPEQEQT.L---...............................................---.----.V.D.EEDKQTVS------..-----...............TEPDIALMEYES.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPVDTSGNK.IPK--PKEPEVLGTYQ....GQNIYPEDVPPIARQKLr..eAANAPS...........................TLLYEKT.P.KK.......................................................SNNFLTRFVEANRSPTTPAApSVSTVS.NMTREQLAEYTRIRRSLGLTAAKEYKAQF-q.......................................
A5A2R5_9LUTE/206-511             .....................VDAE.P.GPSPGPSPDPPPPPSPSPEPAPV.KEERFIV.YSGVAHTIISAQSTDDSIIVRDIPDQRFRYVENENFYWFQIAAQWYSNTNTKAVPMFVFPVPIGEW.SVEISTEGYQATSSITDPNKGRIDGLIAYDNSS-.EGWNIGAGSNVTITNNKADNSWKYGHPD...LEINSCHFNQNQVLEKDGIISFHVKATEKEANFFLVAPPVQKTSKYNYAVSYGAWTDRDMEFGLITVTLDEK.---RGS....GSPTRKS.SRAGHA.GVTTTTD...LVALPEKEN............................................--SGIETSETPSAPVT.SSKA...............................................PLP.TV--.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------sdseseddplsaapdvg.......................
A5A310_BYDVP/202-650             ..............vdsstpe--PK.P.APEPTPTPQPTPAPQPAPEPTPApAPKRFFE.YIGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHMGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEAERI....TRHAETP.IRSKHI.LVSEQYE...QPLPTIIDQ............................................---GLCDVQTPEQEQT.L---...............................................---.----.V.D.EEDKQTVS------..-----...............TEPDIALMEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPVDTSGNK.IPK--PKEPEVLGTYQ....GQNIYPEDVPPIARQKLr..eAAKAPS...........................TLLYEKT.P.KK.......................................................SYNFLTRFVEANRSPATPAApTVSTVS.NMTREQLAEYTRIRRSLGLTAAKEYKAQF-q.......................................
B0FKM6_BYDVP/201-644             .....................VDSStP.EPKPTPAPTPPPQPEPKPEPTPApPPKRFFE.YVGTPTGVISTRENTDSISVSKLGGQLMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVQASGKDACFYIMAPKTMKTDKYNYVVSYGGYANKRMEFGTISVTCDESdVEALRM....SRHSESP.TRVNNI.LIDEGYH...QTLSPIQNL............................................---GLCDVQTPGQDEV.EE--...............................................---.----.-.-.-DDKQTVS------..-----...............TEPDIALLEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPVDTSGEE.IPKPPPRDNEILGVYQ....GQPIYADDVPPIARQKLr..dAAKAPS...........................TMLYDKA.P.KS.......................................................-KSFLSRFVEGNRSKVENTApSTATTS.NLTREQLREYTRIRNSLGLTAAREYKAQF-s.......................................
B3FGU1_9LUTE/201-663             .....................VDGS.S.PPPPSPSPTPPPPPPPQPQPQPC.AQ-RFWG.YEGNPQNKILTAENSRNIDSRPLNFVQMYKWEDEKWDKVNLQAGYSRNDRRCMETYLTIPADKGKF.HVYLEADGEFVVKHIGGELDGSWLGNIAYDVSQ-.RGWNIGNYKGCKIKNYQSNTTFVAGHPD...ATMNSKSFDSARAVEVDWYASFELECDDEEGSWAIYPPPIQKDSSYNYTVSYGNYTEKYCEWGAISVSIDE-.---DNN....GNAPRRI.PRKGAM.-AWSTPE...PSFSGDESQ............................................----RQDFKTPSPEER.GSDAleseemke..............................eenlldrfeEEN.IPDV.D.D.EDIWKGISRGSESG..TAEDD...............RASTSSRLRGNL.....KPRG.....LP.....KPQPTRTITQFN.....................................PNPDLVEAWRPD.LAPEYSKADVAAATVI....AGGSIHEGRDMLRRRDE....------...........................KVMDSRK.K.WG.......................................................-VLSSASSLTSGSLRKLS-A.QSEKLA.KLTTGERTEYERIKNSHGKTVAAEYLEM--vl......................................
A5A2Z8_BYDVP/206-650             ..................tse--PK.P.APEPTPTPQPTPAPQPAPEPTPApVPKRFFE.YIGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEAERI....TRHAETP.IRSKHI.LVSEQYE...QPLPTIIDQ............................................---GLCDVQTPEQEQT.L---...............................................---.----.V.D.EEDKQTVS------..-----...............TEPDIALMEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPVDTSGNK.IPK--PKEPEVLGTYQ....GQNIYPEDVPPIARQKLr..eAANAPS...........................TLLYEKS.S.KK.......................................................SNNFLTRFVEANRSPTTPAApTVSTVS.NMTREQLAEYTRIRKSLGLTAAKEYKAQF-q.......................................
F8RUK1_9LUTE/198-418             ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHLNFVVSYANFTDKILEWGSISVAI---.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
B3FGT5_9LUTE/201-658             ....................v-EGT.S.PSAPTPTP--P-PPAPSPEPTPC.KGARFWG.YEGNPQSKIQTAENNRNIDSRPLNYVSMYRWEDEKWDQVNLQAGYSRNDRRCMETYFVIPANKGKF.HVYLEADGEFVVKHIGGDLDGSWLGNIAYDVSQ-.RGWNIGNYKGCSIKNYQSKTTFVAGHPD...ASMNGKNFDAARAVEVDWFASFELECDDDEGSWRIYPPPIQKDSSYNYTVSYGNYTEKYCEWGAVSISIDED.--NATG....RVPQKIK.PRKGVM.-TWSTPE...PERQPVEQTp.........................................vqEPSETSGLDAPPTTKQ.EDET...............................................TDD.LGGR.F.K.EPQIPEFSTPMHML..ARDLG...............GLTESSSRAPEG.....VASW.....VQ.....LEADPVNESE--.....................................-----YSSDNET.IASPPTTT--VSSPFT....SIPNTERVLQMPGVYQG....DRQIAS...........................SVLDEHR.K.RSfakr...............................................llpsLGGSRASALSGGTLRQKH--.SDLIKQ.YMTAAEHAEAQRIRNQLGKGAQTRYIESL-n.......................................
Q84817_PLRV/1-490                ...................vd--SG.S.EPGPS--------PQPTPTPTPQ.KHERFIA.YVGIPMLTIQARENDDQIILGSLGSQRMKYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNADS.DYWNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP-TDGRFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEH.LEGTGS....ASRMRRP.LREGHT.YMASPRE...PEGKPVGNKprd.....................................etpiQTQERQPDQTPSDDVS.DAGS...............................................VNS.GGST.E.S.LQLEFGVNSDSTYD..ATVDG...............TDWPRIPPPRHP.....PEPR.....VS.....GNSRTVTDFS--.....................................SKADLLENWDAEhFDPGYSKEDVAAATII....AHGSIQDGRSMLEKREEn..vKNKTSSwkpplpkavspaiaklrsirksqplegG------.-.-Tlkkd...............................................atdgVSSIGSGSLTGGTLKRKATI.EERLLQ.TLTTEQRLWYENLKKT-NPPAATQWLFEY-q.......................................
MCAPS_PLRVW/205-698              ..............qnpkyds----.-.G------PEPGPSPQPTPTPTPQ.KHERFIA.YVGIPMLTIQARESDDQIILGSLGSQRMKYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNADS.DYWNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP-TDGRFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEH.LEGTGS....ANRVRRP.PREGHT.YMASPRE...PEGKPVGNKprd.....................................etpiQTQERQPDQTPSDDVS.DAGS...............................................VNS.GGST.E.S.LQLEFGANSDSTYD..ATVDG...............TDWPRIPPPRHP.....PEPR.....VS.....GNSRTVTDFS--.....................................PKADLLENWDAKhFDPGYSKEDVAAATII....AHGSIQDGRSMLEKREEn..vKNKTSSwkpplpkavspaiaklrsirksqplegG------.-.-Tlkkd...............................................atdgVSSIGSGSLTGGTLKRKETI.EERLLQ.TLTTEQRLWYENLKKT-NPLAATQWLFEY-q.......................................
B0ZT99_9LUTE/201-655             .....................VDSStP.EPSPQPQPEPKPDPQPTPEPQ--.-HKRFFE.YVGTPYVIIQTRESSDSIAVKSMNDQSFQYIENETSEQRTVQAWWTSNNGVQAQAAFVFPIPAGEY.SVNISCEGLQSVDHIGGNRDGYWIGLIAYQNQSG.DYWGVGNYAGCDITNLLGTNTWRPGHED...LELNGCKFTNGQIVERDAVISFHVKAQGADPKFYLMAPKTMKSDKYNYVVSYGGYTDKRMEFGSISVTVDESdVEAQRY....NRHASTV.RKTEN-.-RDYGWM...SVLPPYDPN............................................----QVPEQEEEQPMV.DKEM...............................................---.DPRS.P.V.EPPSPTSDTEAERA..FDLRE...............EELTRARLEYEA.....ATES.....IP.....DAAPDILPSKSE.....................................MSSKPIDHDGRS.LPK--PQSKEVLGTYQ....GQNITPDDVPSVIAEKLr..eVNRAPS...........................TLLYDRQ.P.KT.......................................................PKSFLSRFVETNKTSLASPG.SQSSTS.GMTREQASEYTRIRKSMGLTAAKEYKASL-a.......................................
E0A2S4_9LUTE/1-137               ....................g----.-.-----------------------.-------.------------------------------------------------------------------.----------------------------------.ATWNVGEYNNVKITKLLNTSSWKKGHKD...VVLNGCHFNDGQVIERDSTMSFHCEVGHGGGTILLVAPPVCKSDKYNYVVSYGEYTTKHMEFGSIAICFDEK.HDGARA....GKFLGAPfPRAGHV.VCEQQTE...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------iarfpagsd...............................
B2BJG5_9LUTE/207-719             .....................VDAE.P.GPSPGPQ------PQPTPSPSPQ.KHERFIA.YVGIPMLTIQARENDDQILLRSMGLQRMKYIEDENQNYTNIDSQFYSQSNVNAVPMYYFNVPKGTW.SVDISCEGYQPTSSTTDPNRGRSDGLIAYSNSDS.DYWNVGEADGVKISNLRNDNTYRXGHPD...LEINSCHFRDGQLLERDATISFHVEAP-DDGRFFLIGPAIQKTAKYNYTISYGEWTDRDMELGLITVVLDEH.LEGSGS....GNLARRE.RRSLHQ.HCKSLYA...PEGPPENKPwdd......................................nqiIVGERQLRKTLSMDMS.EAGSdlregklesnps......................gdardelnytlnlS--.----.-.-.--------------..-----...............-DSEDELIDEPN.....FVPG.....MR.....MNLEAVPL--AN.....................................PADKDYILRDRG.ITTTLXEPAYMQGVAP....QDKIEEDPXKHVRDFKSa..hASKGPA...........................SVASGST.M.RGnlrggtlrgrsmppplpppaekvgdslpsgklqwdppgspltpfkdkelakppsdARSSISGRLTGGLLKSRV--.-DKDLA.SLTTAQRQQYEITRQTLGKIAAKEFLQRC-k.......................................
B1A452_9LUTE/202-640             .....................VDGG.P.GPKPGPDPTPP--PAPPPEPTPA.KHERFIV.YTGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQN.KVWNVGVQNNVTISNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTGPNASFFLVGPPVKKIAKYNYCISYGAWTDRDMEFGMVSVVLDEH.LEGVRG....SQYVRKT.LRPGHI.SVNRTHR...LQEMPPMRE............................................DFSEEDNSSSDSNTY-.KTDN...............................................SPL.TVHL.V.K.AGDEENYTTDRSDD..VEPTL...............HDADVMK-----.....FSGF.....VG.....AKDRFTLQGADPi...................................gPGDRSVRRFRPS.ATLKSAFH--------....-----------------....SGPTPD...........................ELYNAGA.E.QAdhd.................................................fehFVSRGKEKLQDEDPMAKLER.EAEDLK.PDSDNEDNDYDRTAPVFNPADGDPWS----gik.....................................
F8RUI9_9LUTE/198-418             ..................vgd----.A.PPTPTPTPT---PPALTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAI---.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
MCAPS_PLRV1/206-698              .............npkydsgs----.-.--------EPSPSPQPTPTPTPQ.KHERFIA.YVGIPMLTIQARENDDQIILGSLGSQRMKYIEDENQNYTKFSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNADS.DYWNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP-TDGRFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEH.LEGTGS....ANRVRRP.PREGHT.YMASPHE...PEGKPVGNKprd.....................................etpiQTQERQPDQTPSDDVS.DAGS...............................................VNS.GGPT.E.S.LRLEFGVNSDSTYD..ATVDG...............TDWPRIPPPRHP.....PEPR.....VS.....GNSRTVTDFS--.....................................SKADLLENWDAEhFDPGYSKEDVAAATII....AHGSIQDGRSMLEKREEn..vKNKTSSwkppslkavspaiaklrsirksqplegGTLNKDA.T.DG.......................................................VSSIGSGSLTGGTLKRKATI.EERLLQ.TLTTEQRLWYENFKKT-NPPAATQWLFEY-q.......................................
F8RUG2_9LUTE/198-418             ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KYFG.YHGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVPYANFTVKILEWGSISVAI---.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
F8RUI3_9LUTE/198-418             ..................vgd----.A.PPTPTPTPTP---PAPTPAPA--.--SKYLG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISSYRTPDSNVSGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAI---.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
D2K8V0_9LUTE/198-265             ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQL-------------------------.----------------------------------.----------------------------...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
D7EZJ0_9LUTE/201-663             .....................VDGS.S.PPPPSPSPTPPPPPPPQPQPQPC.AQ-RFWG.YEGNPQNKILTAENSRNIDSRPLNFVQMYKWEDEKWDKVNLQAGYSRNDRRCMETYLTIPADKGKF.HVYLEADGEFVVKHIGGELDGSWLGNIAYDVSQ-.RGWNIGNYKGCKIKNYQSNTTFVAGHPD...ATMNSKSFDSARAVEVDWYASFELECDDEEGSWAIYPPPIQKDSSYNYTVSYGNYTEKYCEWGAISVSIDED.----NN....GSAPRRI.PRKGAM.-AWSTPE...PSFSGDESQ............................................----RQDFKTPSPEER.GSDTleseetke..............................eenlldrfeEEN.IPDV.D.D.EDIWKGISRGSETG..TTEDD...............RASTSSRLRGNL.....KPQG.....LP.....KPQPTRTITKFN.....................................PNPDLVEAWRPD.LAPGYSKADVAAATVI....AGGSIHEGRDMLRRRDE....------...........................KVMDSRK.K.WG.......................................................-ILSSASSLTSGSLKKLS-A.QSEKLA.KLTTGERAEFERIKNSHGKTVAAEYLE---vvl.....................................
Q8B6M4_9LUTE/1-439               .....................VDGE.P.GPKPGPDPAPQ--PTPTPEPTPA.KHERFIA.YTGTLSTLISARQSSDSISLYSIRSQRIRYIEDENSSWTNIDAKWYSQNSVEAIPMFVYPVPEGTW.SIEISCEGYQAASSTSDPHRGKCDGMIAYDDDSS.KVWNVGQQNNVTITNNKADNDWKYGHPD...LMINGDKFDQNQVVEKDGIISFHLVTTGPNASFFLVAPAVKKTAKYNFCVSYGDWTDRDMEFGMVSVVLDEH.LEGARS....SQYVRKT.LRPGHI.SVNRSHR...LQEMPPTRE............................................DFSEEDNSSSDSNTY-.KTDN...............................................SRM.TVHI.V.K.AGDEESYATDQTDD..VEPTL...............LDADVMK-----.....FSGF.....VG.....ARDRFTLQGAEPi...................................gPGDRTSRRFRPS.ATLKAAFH--------....-----------------....SGPTPD...........................ELYNAGV.E.QAdhd.................................................fehFVSRGKEKLHGEDPMAKLER.EAEDLK.PDSDNEDNDYDRTASVFNPADGDPWS----gik.....................................
B0FL02_BYDVP/202-650             ..............vdsstpe--PK.P.APEPTPTPQPTPAPQPAPEPTPApVPKRFFE.YIGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEAERI....TRHAETP.IRSKHI.LVSERYV...EPMPTIIDQ............................................---GLCDVKTPEQEQT.L---...............................................---.----.V.D.EEDKQTVS------..-----...............TEPDIALQEYEA.....ATVE.....VP.....DAEEDVLPSKEQ.....................................LSSKPMDTSGNK.IPK--PKEPEVLGTYQ....GMHIYPEDVPPLARQKLr..eAAKAPT...........................TLLYERT.P.KK.......................................................SSNILTRYLESNRSPTTPAApSVSTVS.NMTREQLAEYTRIRKSLGLTAAKEYKAQF-q.......................................
Q8B6M2_9LUTE/1-519               .....................VDGE.P.GPKPGPDPAPQ--PTPTPEPTPA.KHERFIA.YTGTLSTLISARQSSDSISLYSIRSQRIRYIEDENSSWTNIDAKWYSQNSVEAIPMFVYPVPEGTW.SIEISCEGYQAASSTSDPHRGKCDGMIAYDDDSS.KVWNVGQQNNVTITNNKADNDWKYGHPD...LTINGDRFDQNQVVEKDGIISFHLVTTGPNASFFLVAPAVKKTAKYNFCVSYGDWTDRDMEFGMVSVVLDEH.LEGARS....SQYVRKT.PRSGHV.GVNRSHR...LQDNFVPTEyvs.....................................dedsSSNSSIVSNRPSTPDN.DSDAqfaesmkg..............................klpsqtklpPKG.FLSR.L.S.TKEKKEISNSKPSN..VEGLV...............GPLVAAY--GYP.....SQTG.....VY.....DAAREILQAKEAaenlaelerdlkeink....leppdvivqeeipdfvpPSEKILKEDDPD.YVPPIWQNADQAVLVS....TYEPPDWSRPAYE----....SGDPPK...........................KTGTLKG.T.LSkl...................................................ggSLRSGESSLRGSLRKTQDQTdLDNKLS.KLSVIQRSQYQRILNNLGKTRARAYIDGL-d.......................................
B0FEU6_PLRV/1-107                ...........mlekreenvk----.-.-----------------------.-------.------------------------------------------------------------------.----------------------------------.----------------------------...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.-----------NKTSS....WKPPLSEAVSPAIAKLRs..iRKSQPLe.........................gGTLKKDV.T.DG.......................................................VSSIGSGSLTGGTLKRKETI.EERLLQ.TLTTEQRLWYENLKKT-NPPAAIQWLYEY-q.......................................
F8RUN1_9LUTE/198-418             ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KSFG.SQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKGESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFPCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYLGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAI---.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
D7EZH8_9LUTE/204-660             ...................vd--AE.P.SPSPG--------LSPSPQPTPQ.KKYRFIV.YTGVPVTRIMAQSTDDAISLYDMPSQRFRYIEDENMNWTNLDSRWYSQTSLKAVPMIIVPVPQGEW.TVEISMEGYQPTPSTTDPNKDKQDGLIAYNDDFK.EGWNVGVYNNVEITNNKADNTLKYGHPD...MELNSCHFNQGQCLERDGDLTCHLKTTGDNASFFIVGPAVQKQSKYNYAASYGAWTDRMMEIGMIAIALDEQ.--GSSG....STKIKRP.KRAGHS.MAVSTWE...TISFPKNENfe........................................esSTSQRQDFNTPLTHGE.SPDNlevgv....................................gglplpVEN.IPDF.D.G.DDLWSNISTRKPQE..DEAMT...............SKSGFKP---QL.....KPPG.....LP.....RPQPVRTIRNFN.....................................PEPDLVEAWRPD.VNPGYSKEDVAAATVM....YGGSVHEGRSMLAKRDQ....------...........................AVLDGRK.S.WG.......................................................--SSLASTLTGGTLRASA--.QSEKLA.QLTSSERAMFERTKRQQGRTAASELLG---ell.....................................
B1A431_9LUTE/202-640             .....................VDGE.P.GPKPGPDPTPP--PAPPPEPTPA.KHERFIV.YTGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQT.KVWNIGVQNNVTISNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTGPNASFFLAGPAVKKIAKYNYCISYGAWTDRDMEFGMVSVVLDEH.LEGVRG....SQYIRKT.LRPGHI.SVNRTHR...LQEMPPMRE............................................DFSEEDNSSSDSNTY-.KTDN...............................................SPL.TVHL.V.K.AGDEENYTTDRSDD..VEPTL...............HDADVMK-----.....FSGF.....VG.....AKDRFTLQGADPi...................................gPGDRSVRRFRPS.ATLKSAFH--------....-----------------....SGPTPD...........................ELYNAGA.E.QAdhd.................................................fehFVSRGKEKLQDEDPMAKLER.EAEDLK.PDSDNEDNDYDRTAPMFNPADGDPWS----gik.....................................
F8RUK4_9LUTE/198-418             ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MRVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAI---.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
Q2L3F3_9LUTE/198-664             ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLPAGYRVNNRERAIPFVLFPIDKGRY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTVSNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKIMEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYNPEAPE............................................ESENEGTESTPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLTPTFCDTLR.....QADK.....VR.....RALMANASRSAS.....................................PPPSTTEVPVLG.ATDTASLSGXLRGGSX....RGNLGSRPSLPRV----....ADSPPR...........................SVSPARS.E.TS.......................................................--TLQGGSLGGGSLRGG---.NLQVLP.EATREQRREYERLKNSQGKTVARAHAKEH-g.......................................
C6GYU8_9LUTE/203-504             .....................VDAE.P.GPSPGPSPTPP---PPPPEPTPP.VEERFIV.YTGVAHTTILAQSTDDAISLRNIPDQRFRYIENENFYWFNIEAQWYSNTNIKAVPMFYFPIPEGQW.SVEISTEGYQATSSTTDPNKGRVDGLMAYDDSS-.EGWNIGIGNNVEITNNKADNTWKYGHPN...LEINSCHFKQQQCLERDGVISCHVKTIGPSATIFVVAPPVQKLSKYNYAVSYGAWTERDMEIGLITVTLDEK.---RDS....GSARKKI.LRSGLP.---EATN...FTLAAHPEK............................................ENFGIQTSESPLAPAI.SPKA...............................................--Q.LLTL.S.D.SDSED---------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------dplsaspdvg..............................
A5A2Q8_BYDVP/206-650             ..................tse--PK.P.APEPTPIPQPTPAPQPAPEPTPApVPKRFFE.YIGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEAERI....TRHAETP.IRSKHI.LVSEQYE...QPLPTVIDQ............................................---GLCDVQTPEQEQT.L---...............................................---.----.V.D.EEDKQTVS------..-----...............TEPDIALMEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPVDTSGNK.IPK--PKEPEVLGTYQ....GQNIYPEDVPPIARQKLr..eAAKAPS...........................TLLYEKT.P.KK.......................................................SNNFLTRFVEANRSPTTPAApTVSTAS.NMTREQLAEYTRIRKSLGLTAAKEYKAQF-q.......................................
A5A2V0_BYDVP/207-650             ....................p-EQK.P.APEPTPTPQPTPAPQPAPEPTPApVPKRFFE.YIGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEAERI....TRHAETP.IRSKHI.LVSEQYE...QPLPTIIDQ............................................---GLCDVQTPEQEQT.L---...............................................---.----.V.D.EEDKQTVS------..-----...............TEPDIALMEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPVDTSGNK.MPK--PKEPEVLGTYQ....GQNIYPEDVPPVARQKLr..eAANAPS...........................TLLYERT.P.KK.......................................................SNNFLTRFVEANRSPTTPAApTVSTAS.NMTREQLAEYTRIRKSLGLTAAKEYKAQF-q.......................................
B5KLA5_9LUTE/1-422               ....................m----.-.-----------------------.-------.----------AQSTDDAISLYDMPSQRFRYIEDENMNWTNLDSRWYSQNSLKAIPMVIVPVPQGEW.TVEISMEGYQPTSSTTDPNKDKQDGLIAYNDDLK.EGWNVGVYNNVEITNNKADNTLKYGHPD...MELNSCHFNQQQCLERDGDLTCHIKTTGDNASFFIVGPAVQKQSKYNYAVSYGAWTDRMMEIGMIAIALDEQ.--GSSG....SARTERP.KRVGHS.MAVSTWE...TINLPEKEDse........................................klKTGQRQDLKTPFTISE.SSDVkg...........................................ieKRD.LPLP.A.D.EDIPDFIGNDPWSN..VSIRK...............LQEEEAMTSKSGlrpqlKPPG.....LP.....KPQPVRTIGNFN.....................................PTPELVESWRPD.VNPGYSKEDVAAATIL....YGGSIKDGRSMIDKRDK....------...........................AVLDGRK.H.WG.......................................................--SSLASSLTGGTLKASA--.KSEKLA.KLTSRERAEFERIKRQQGTTQASEYLE---fil.....................................
E3UIM2_BLRV/198-650              .....................VDGE.PdPPGPGPDP-PPPTPAPAPQPQPTpKHERFIV.YTGVPESRISAQSTDDSISVYSLQNQRLRYIEDENANWTNIEARWYSNNNVKATPMFIFPVPQGKW.SVEISTEGYQPTSSTTDPNNGKCDGLIAYSDDDKtDVWNVGVQKNITLSNNKADNTWKYGHPD...LEINNCKFNNRQVLERDAYISFHVETTGPNASFFLVAPPVQKTARYNYAVSYGAWTDRMLEFGSVTVALDEH.LEGGYS....SHYIRRS.PRPGHL.ESTRTYD...LHLLPHMDDliaanttavvdgygssisidrqvlvavdnhivdsgdemddlpgyS---------------.---Sssseapkl..............................pavnqtklpPKG.FLSR.L.R.ESEIEEIADKPTEI..TTPEV...............RQLADAT-RQPF.....AAGM.....YN.....DAFERLSINEKK.....................................RNFDSVKDDIAE.IERTLPKEE-------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------yrvpklprikpasevdddhygesqqtlaeierrnvwaskd
D2K8T5_9LUTE/198-265             ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQL-------------------------.----------------------------------.----------------------------...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
B0FKN8_BYDVP/201-644             .....................VDSStP.EPKPTPTPTPPPQPEPKPEPTPApPPKRFFE.YVGTPTGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVQASGKDACFYIMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEALRM....SRHSESP.TRVNNI.LIDEGYH...QTLAPIQNL............................................---GLCDVQTPGQDEV.EE--...............................................---.----.-.-.-DDKQTVS------..-----...............TEPDIALQEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPVDTSGEE.IPKPPPRDNEILGVYQ....GQPIYADDVPPIARQKLr..dAAKAPS...........................TLLYDKA.P.KS.......................................................-KSFLSRFVEGNRSKTETTApSTATTS.NLTREQLREYTRIRNTLGLTAAKEYKAQF-t.......................................
F8RUL9_9LUTE/198-418             ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAI---.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
O92523_9LUTE/1-453               ..............vdsstpe--PK.P.APEPTPTPQPTPAPQPAPEPTPApVPERFFE.YIGTPTGTISTRENSDSVSVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEAERI....TRHAEKS.IRSKHT.LVSERYE...EPLPTVTDQ............................................---GLCDVKTPEQEQT.L---...............................................---.----.V.D.EEDRQTVS------..-----...............TEPDIALQEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPLDTSGNI.IPK--PKEPEVLGTYQgwkqGQNIYPEDVPPLARQRLr..eAAKAPS...........................TLLYERT.P.KK.......................................................SNNFLTRFVEANRSPTTPAApTVSTAS.NMTREQLAEYTRIRKSLGLTAAKEYKAQF-q.......................................
Q70FV6_9LUTE/1-417               ....................e----.-.-----------------------.-------.------------------------NVTMYLWKDESWSIEQLPAGYRVNNRERAIPFVLFPVDKGRY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCGNANL-.AGWRAYAYSGCTVSNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKIMEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYNPETPE............................................ESKDEGTESTPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLTPTSADTLR.....QADK.....VR.....RALMANASRSAS.....................................PPPSTTEVPVLG.ATDTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPARS.E.TS.......................................................--TLQGGSLGGGSLRGG---.NLQVLP.EATREQRREYERLKNSQGKTVARAHAREH-g.......................................
B3GQA1_PLRV/210-699              ...................vd--SG.S.EPGPS--------PQPTPTPTPQ.KHERFIA.YVGIPMLTIQARENDDQIILGSLGNQRMKYIEDENQNYTNISSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNADS.DYWNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP-TDGRFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEH.LEGTGS....ANRVRRP.PREGHT.YMASPRE...PEGKPVGNKprd.....................................etpiQTQERQPDQTPSDDVS.DAGS...............................................VNS.GGST.E.S.LRLEFGVNSDSTND..ATVDG...............THWPRIPPPRHP.....PEPR.....VS.....GNSRTVTDFS--.....................................PKADLLENWDAEhFDPGYSKEDVAAATII....AHGSIQDGRSMLEKREEn..vKNKTSSwkpplpkavspaiaklrsirksqplegG------.-.-Tlkkd...............................................atdgVSSIGSGSLTGGTLKRKATI.EERLLQ.TLTTEQRLWYENLKKT-NPLAATQWLFEY-q.......................................
Q8B6K0_9LUTE/1-437               .....................VDGE.P.GPKPGPDPAPQ--PTPTPEPTPA.KHERFIA.YTGTLSTLISARQSSDSISLYSIRSQRIRYIEDENSSWTNIDAKWYSQNSVEAIPMFVYPVPEGTW.SIEISCEGYQAASSTSDPHRGKCDGMIAYDDDSS.KVWNVGQQNNVTITNNKADNDWKYGHPD...LTINGDKFDQNQVVEKDGIISFHLVTTGPNASFFLVAPAVKKTAKYNFCVSYGDWTDRDMEFGMVSVVLDEH.LEGARS....SQYVRKT.LRPGHI.SVNRSHR...LQEMPPTRE............................................DFSEEDNSSSDSNTYK.-TDS...............................................--S.PMTV.H.L.AGDEENYTTDQSDD..VDPTL...............RDAEVMK-----.....FAGF.....VG.....AKDRFALQGAKPi...................................gPGDRSIHRFKPS.ATLKSAFH--------....-----------------....SGPTPD...........................ELYNAGA.E.QAdhd.................................................fehFVSRGKEKLQEEDPMAKLER.EAEDLK.PDSDNEDNDYDRTASVFNPADGDHWS----gik.....................................
B0FKS4_BYDVP/201-644             .....................VDSStP.EPKPTPAPTPPPQPEPKPEPTPApPPKRFFE.YVGTPIGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVQASGKDACFYIMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEALRM....SRHSESP.TRVNNI.LIDEGYH...QTLPPIQNL............................................---GLCDVQTPGQDEV.EE--...............................................---.----.-.-.-DDKQTVS------..-----...............TEPDIALQEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPVDTSGEE.IPKPPPRDNEILGVYQ....GQPIYADDVPPIARQKLr..dAAKAPS...........................TMLYDKA.P.KS.......................................................-KSFLSRFVEGNRSKLETTApSTATTS.NLTREQLREYTRIRNSLGLTAAKEYKAQF-s.......................................
Q70FV7_9LUTE/1-417               ....................e----.-.-----------------------.-------.------------------------NVTMYLWKDESWSIEQLPAGYRVNNRERAIPFVLFPIDKGRY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTVSNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFSLEAPPIEKSDHFNFVVSYANFTDKIMEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYNSETPE............................................ESENEGTESTPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLTPTSADTLR.....QADK.....VR.....RALMANASRSAS.....................................PPPSTTEVPVLG.ATDTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPTRS.E.TS.......................................................--TLQGGSLGGGSLRGG---.NLQVLP.EATREQRREYERLKNSQGKTVARAHAREH-g.......................................
B5L2B7_9LUTE/204-661             .....................VDKE.P.GPSPG--------PSPSPQPTPS.KKYRFIV.YTGVPVTRIMAQSTDDAISLYDMPSQRFRYIEDENMNWTNLDSRWYSQNSLKAIPMIIVPVPQGEW.TVEISMEGYQPTSSTTDPNKDKQDGLIAYNDDLK.EGWNVGVYNNVEITNNKADNTLKYGHPD...MELNSCHFNQGQCLERDGDLTCHVKTTGDNASFFIVGPAVQKQSKYNYAVSYGAWTDRMMEIGMIAIALDEQ.--GSSG....SAKIERP.KRVGHS.MAVSTWE...TINLPEKGNse........................................efKTDQRQDLKTPPAAGG.SSDMld...........................................ivQGG.LPLP.V.E.EDIPDSIMDDPWSD..IPAKS...............SQEDEAXSSKSG.....FKPQ.....LK.....PPGLPKPQPVRTix................................nfdPKPDLVEAWRPD.VNPGYSKEDVAAATVM....YGGSIKEGRSMIDKRDE....------...........................AVLDGRK.R.WG.......................................................--SSLASSLTGGTLKASA--.KSEKLA.KLTSSERARFERIKRQQGATAASEFLEQL-l.......................................
B1A425_9LUTE/202-640             .....................VDGE.P.GPKPGPDPTPP--PAPPPEPTPA.KHERFIV.YTGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQN.KVWNVGVQNNVTISNNKADADWKYGHPN...LTINGERFDQNQVVEKDGTVSFHLVTTGPNASFFLVGPPVKKIAKYNYCISYGAWTDRDMEFGMVSVVLDEH.LEGVRG....SQYVRKT.LRPGHI.SVNRSHR...LQEMPPMRE............................................-DFSEEDSSSSDXNTY.KTDN...............................................SPL.TVHL.V.K.AGDEENYTTDRSDD..VEPTL...............HDADVMK-----.....FSGF.....VG.....AKDRFTLQGADPi...................................gPGDRSVRRFRPS.ATLKSAFH--------....-----------------....SGPTPD...........................ELYNAGA.E.QAdhd.................................................fehFVSRGKEKLQDEDPMAKLER.EVEDLK.PDSDNEDNDYDRTAPXFNPADGDPWS----gik.....................................
F8RUJ8_9LUTE/198-418             ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRGRAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAI---.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
Q7T6L0_9LUTE/1-415               .....................----.-.-----------------------.-------.-------------------------VTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAAKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNDPGHPD...MKVNGGSITD-QLVERDFSCSLHLEVP-QQGYFGLEAPPIEKSDHFNLVVSYANFTDKILEWGSISVAIDEVnDGAYSR....SKWDKTA.AMSARLpTQVSALS...EVYTPETPE............................................QPTDEGTESMPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.G.KPVVEEVLRESPIY..APPPP...............PSLTPTSADTLR.....QADK.....VR.....RALMANASRAAS.....................................PPPTATEVPVLG.AXDTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPVRS.E.TS.......................................................--TLQGGSLSGGSLRGG---.NLRALP.EATREQRREYERLKNSQXKTVAKAHAQEH-g.......................................
F8RUM2_9LUTE/198-418             ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISAAI---.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
B0FKZ6_BYDVP/201-646             .....................VDSStP.EPKPTPAPTPAPTPEPKPEPTPApPPKRFFE.YVGTPIGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEASGKDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEALRM....TRHSECP.TRVNNI.LIDEGYC...QPLSTIIDQ............................................---GLCDVQTPGQSQE.VV--...............................................---.----.-.-.EEDRQTVS------..-----...............TESDIALKEYEA.....AIAE.....IP.....DAEEDALPSREQ.....................................LSSKPVDTSGEE.IPKPRPPSNEVLGVYQ....GQPIYADDVPPGTRQKLr..dAAKAPS...........................TLLYDKT.P.KR.......................................................SKSILSRFVEGNRSSVESAApSTATTS.NLTREQLREYTRIRNSLGLTAAKEYKARL-s.......................................
Q87035_9LUTE/1-522               .....................VDGE.P.GPKPGPDPAPQ--PTPTPKPTPA.KHERFIA.YTGTLSTLISARQSSDSISLYSIRNQRIRYIEDENSSWTNIDAKWYSQNSVEAIPMFVYPVPEGTW.SIEISCEGYQAASSTSDPHRGKCDGMIAYDDDSS.KVWNVGQQNNVTITNNKADNDWKYGHPDpldLMINGDRFDQNQVVEKDGIISFHLVTTGPNASFFLVAPAVKKTAKYNFCVSYGDWTDRDMEFGMVSVVLDEH.LEGARS....SQYVRKS.PRPGHF.GVNRSHR...LQDSFTPVEyvs.....................................dddsSSSSSIVSNRPSTPDN.DSDIqfanslkg..............................klpsqtklpPKG.FQSR.L.S.AREKEEISKSKPSN..VERQV...............GPLVDAY--GYP.....SQTG.....VY.....DAAREILQSKEAaenlaelekdlkeink....leppdtieqeeipdfvaPSERVIAEDDRD.YVPSIWRNADQAVVIS....SFEPTDWSRPAYE----....SGDPPK...........................KAGLLKG.T.LSkl...................................................ggSLRSGESSLRGNLRKTQDQSdLEYKLS.RLNVPQRSQYQRILANLGKVRARAYIDGL-d.......................................
B1A449_9LUTE/202-640             .....................VDGE.P.GPKPGPDPTPS--PTPPPEPTPA.KHERFIV.YTGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWAYIKAQWYSQNSVEAVPMFIYPVPQGTW.SVEISCEGYQATSSTTDPHRGKSDGMIAYDDDQT.KVWNVGVQNNVTITNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTGPNASFFLAGPAVKKIAKYNFCISYGAWTDRDMEFGLVSVVLDEH.LEGVRG....SQYVRKT.LRPGHI.SVNRSHR...LQEMPPMRE............................................DFSEEDNSSSDSNTY-.KTDN...............................................SPL.TVHL.V.K.AGDEENYTTDRSDD..VEPTL...............HDADVMK-----.....FSGF.....VG.....AKDRFTLQGADPi...................................gPGDRSVRRFRPS.ATLKSAFH--------....-----------------....SGPTPD...........................ELYNAGA.E.QAdhd.................................................fehFVSRGKEKLQDEDPMAKLER.EAEDLK.PDSDNEDNDYDRTAPVFNPADGDPWS----gik.....................................
E5GAB5_9LUTE/204-663             ...................vd-DSS.P.PPAPAPQPPPPPPPSPSPEPQPC.KKDRFWG.YEGVPQNKISAARNDQFIDVKSLNYVQMYKWEDDRWDRINMQANYSRNDRNYAEPYMIIPASKGKF.HVYVECNGQMAVKSIGGKADNSWNGMIAYDTSR-.RAWDVGNYKGCVITNYQKNNTFVAGHPD...VELNNCKFTSSRGVECDCYLSFQLTCDDDDGAWMLYAPPIPKDDKYNYSVSYGEYVDRNCEWGAVSISIDE-.--DNST....GNEIRMK.PMKGAM.HW----S...EPVDFARES............................................---QRQDFKTPSPPER.GTDD...............................................LES.EKKK.E.E.ENLLNELE-ERIPD..ANEDFwegmpirststtegdRASTGSRLRGTL.....KPPG.....LP.....KPQPTRTITEFR.....................................PNPDLVEAWRPD.LAPTYSKADVAAATVI....AGGSVHEGREHLKRREE....------...........................AVLNNRE.R.WG.......................................................-PLSAVSSLTGGTLRLSA--.QSEKLA.KLTTSERRHYEFLKRSSGKTVAAEFLESL-l.......................................
B1A446_9LUTE/202-640             .....................VDGE.P.GPKPGPDPTPP--PAPPPEPTPA.KHERFIV.YTGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQT.KVWNIGVQNNVTISNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTGPNASFFLAGPAVKKIAKYNYCISYGAWTDRDMEFGMVSVVLDEH.LEGVRG....SQYVRKT.LRPGHI.SVNRTHR...LQEMPPMRE............................................DFSEEDNSSSDSNTNK.-TDN...............................................SPL.TVHL.V.K.AGDEENYTTDRSDD..VEPTL...............HDADVMK-----.....FSGF.....VG.....AKDRFTLQGADPi...................................gPGDRSVRRFRPS.ATLKSAFH--------....-----------------....SGPTPD...........................ELYNAGA.E.QAdhd.................................................fehFVSRGKEKLQDEDPMAKLER.EAEDLK.PDSDNEDNDYDRTAPLFNPADGDPW-----sgik....................................
B5KLA3_9LUTE/1-422               ....................m----.-.-----------------------.-------.----------AQSTDDAISLYDMPSQRFRYIEDENMNWTNLDSRWYSQNSLKAIPMVIVPVPQGEW.TVEISMEGYQPTSSTTDPNKDKQDGLIAYNDDLK.EGWNVGVYNNVEITNNKADNTLKYGHPD...MELNSCHFNQQQCLERDGDLTCHIKTTGDNASFFIVGPAVQKQSKYNYAVSYGAWTDRMMEIGMIAIALDEQ.--GSSG....STRTERP.KRVGHS.MAVSTWE...TINLPEKEDse........................................klKTGQRQDLKTPFTISE.SSDVkg...........................................ieKRD.LPLP.A.D.EDIPDFIGNDPWSN..VSIRK...............LQEEEAMTSKSSlrpqlKPPG.....LP.....KPQPVRTIGNFN.....................................PTPELVESWRPD.VNPGYSKEDVAAATIL....YGGSIKDGRSMIDKRDK....------...........................AVLDGRK.H.WG.......................................................--SSLASSLTGGTLKASA--.KSEKLA.KLTSRERAEFERIKRQQGTTQASEYLE---fil.....................................
B7TWD7_9LUTE/202-640             .....................VDGG.P.GPKPGPDPTPP--PAPPPEPTPA.KHERFIV.YTGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQN.KVWNVGVQNNVTISNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTISFHLVTTGPNASFFLVGPPVKKIAKYNYCISYGAWTDRDMEFGMVSVVLDEH.LEGVRG....SQYVRKT.LRPGHI.SVNRTHR...LQEMPPMRE............................................DFSEEDNSSSDSNTY-.KTDN...............................................SPL.TVHF.V.K.AGDEENYTTDRSDD..VEPTL...............HDADVMK-----.....FSGF.....VG.....AKDRFTLQGADPi...................................gPGDRSVRRFRPS.ATLKSAFH--------....-----------------....SGPTPD...........................ELYNAGA.E.QAdhd.................................................fehFVSRGKEKLQDEDPMAKLER.EAEDLK.PDSDNEDNDYDRTAPVFNPADGDPWS----gik.....................................
A0FLF6_BYDVP/202-650             ..............vdsstpe--PK.P.APEPTPTPQPTPAPQPAPEPTPApVPKRFFE.YIGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEAERI....TRHAETP.IRSKHI.LVSEQYE...QPLPTIIDQ............................................---GLCDVQTPEQEQT.L---...............................................---.----.V.D.EEDKQTVS------..-----...............TEPDIALMEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPVDTSGNK.IPK--PKEPEVLGTYQ....GQNIYPEDVPPIARQKLr..eAAKAPS...........................TLLYEKT.P.KK.......................................................SNNFLTRFVEANRSPTTPAApTVSTAS.NMTREQLAEYTRIRKSLGLTAAKEYKAQF-q.......................................
B5KLA7_9LUTE/1-422               ....................m----.-.-----------------------.-------.----------AQSTDDAISLYDMPSQRFRYIEDENMNWTNLDSRWYSQNSLKAIPMVIVPVPQGEW.TVEISMEGYQPTSSTTDPNKDKQDGLIAYNDDLK.EGWNVGVYNNVEITNNKADNTLKYGHPD...MELNSCHFNQQQCLERDGDLTCHIKTTGDNASFFIVGPAVQKQSKYNYAVSYGAWTDRMMEIGMIAIALDEQ.--GSSG....SARTERP.KRVGHS.MAVSTWE...TINLPEKEDse........................................klKTGQRQDLKTPFTISE.SSDVkg...........................................ieKRD.LPSS.G.H.DDIPDFIGNDPWSN..VSIRK...............LQEEEAMTSKSG.....LRPQlkppgLP.....KPQPVRTIGNFN.....................................PTPELVESWRPD.VNPGYSKEDVAAATIL....YGGSIKDGRSMIDKRDK....------...........................AVLDGRK.H.WG.......................................................--SSLASSLTGGTLKASA--.KSEKLA.KLTSRERAEFERIKRQQGTTQASEYLE---fil.....................................
D2K8T0_9LUTE/198-664             ....................v-DD-.A.PPTPTPTPT---PPAPTPAPTP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpIQVSAPS...EVYTPEAPE............................................QPTNEGTESMPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLVPTHADTLR.....QADK.....VR.....RALMANASRSAS.....................................PPPTNTEIPVLG.ATDTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPARS.E.TS.......................................................--TLQGGSLSGGSLRGG---.NLQALP.EATREQRREYERLKNSRGKTVAKAHAKEH-g.......................................
E5GAA9_9LUTE/204-663             ...................vd-DSS.P.PPAPAPQPPPPPPPSPSPEPQPC.KKDRFWG.YEGVPQNKISAARNDQFIDVKSLNYVQMYKWEDDRWDRINMQANYSRNDRNYAEPYMIIPANKGKF.HVYVECNGQMAVKSIGGKADNSWNGMIAYDTSR-.RAWDVGNYKGCVITNYQKNNTFVAGHPD...VELNNCKFTSSRGVECDCYLSFQLTCDDDDGAWMLYAPPIPKGDKYNYSVSYGEYVDRNCEWGAVSISIDE-.--DNST....GNEIKMK.PMKGAM.HWSE---...-PVDFARES............................................---QRQDFKTPSPPER.GTDD...............................................LES.EKKK.E.E.ENLLNELE-ERIPD..ANEDFwegmpvrststtegdRASTGSRLRGTL.....KPPG.....LP.....KPQPTRTITEFR.....................................PNPDLVEAWRPD.LAPTYSKADVAAATVI....AGGSVHEGREHLKRREE....------...........................AVLNNRE.R.WG.......................................................-PLSAVSSLTGGTLSLSA--.QSEKLA.KLTTSERRHYEFLKRSSGKVVAAEFLESL-l.......................................
Q8B6K8_9LUTE/1-517               .....................VDGE.P.GPKPGPSPTPP--PSPPPEPTPA.KRERFIV.YTGTVSTLISARQNSDSISLYSIRDQRVRYIEDENANWTNIKAQWYSQSSVEAIPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQT.KVWNVGVQNNVTISNNKADADWKYGHPN...LTINGERFDQNQVVEKDGTISFHLVTTGPNASFFLVGPAVKKIAKYNYCISYGAWTDRDMEFGLVSVVLDEH.LEGARG....SQYVRKT.LRPGHI.SVNRSHR...LQDSFTPVEyvs.....................................dedsSSNSSIVSNRPSTPDN.DSDTqfaeslrg..............................klpsqtqlpPKG.FLSR.L.S.AKEKEQISSSKPSN..VENQV...............GPLVAAY--GYP.....SQTG.....VY.....DAAREILQAKEAaenlaelerdlkeink.....leppdvivqeeipdfvPPSEKVFQESPE.YVPPVWRNADQAVTVS....SYEPPNWSRPANE----....SGYPPKk.........................gSLKGTLS.K.LG......................................................gSLRSGESSLRGSLRKTQDQSdLDYKLS.KLNVLQRSQYQRMLNNSGKTRARAYLDGL-d.......................................
A5A2V6_BYDVP/207-650             ...................le--PK.P.APEPTPTPQPTPAPQPAPKPTPApAPKRFFE.YIGTPTGTISTRENSDSISVSELGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEAERI....TRHAEAP.IRSKHI.LVSEQYE...QPLPTIIDQ............................................---GLCDVQTPEQEQT.L---...............................................---.----.V.D.EEDKQTVS------..-----...............TEPDIALMEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPVDTSGNK.IPK--PKEPEVLGTYQ....GQNIYPEDVPPIARRKLr..eAANAPS...........................TLLYEKT.P.KK.......................................................SNNFLTRFVEANRSPTTPAApTVSTVS.NMTREQLAEYTRIRKSLGLTAAKEYKAQF-q.......................................
G8Z1W7_9LUTE/201-663             .....................VDGS.S.PPPPSPSPTPPPPPPPQPQPQPC.AQ-RFWG.YEGNPQNKILTAENSRNIDSRPLNFVQMYKWEDEKWDKVNLQAGYSRNDRRCMETYLTIPADKGKF.HVYLEADGEFVVKHIGGELDGSWLGNIAYDVSQ-.RGWNIGNYKGCKIKNYQSNTTFVAGHPD...ATMNSKSFDSARAVEVDWYASFELECDDEEGSWAIYPPPIQKDSSYNYTVSYGNYTEKYCEWGAISVSIDED.----NN....GSAPRRI.PRKGAM.-AWSTPG...PSFSGDESQ............................................----RQDFKTPSPEER.GSDAleseetke..............................eenlldrleEEN.IPDA.D.D.EDIWKGISRGSETG..TTEDD...............RASTSSRLRGNL.....KPQG.....LP.....KPQPTRTITKFD.....................................PDPDLVEAWRPD.LAPGYSKADVAAATVI....AGGSIHEGRDMLRRRDE....------...........................KVMDSRK.K.WG.......................................................-ILSSASSLTSGSLKKLS-A.QSEKLA.KLTTGERAEFERIKNSRGKTVAAEYLE---vvl.....................................
B1A434_9LUTE/202-640             .....................VDGE.P.GPKPGPDPTPP--PAPPPEPTPA.KHERFIV.YTGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQT.KVWNIGVQNNVTISNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTGPNASFFLAGPAVKKIAKYNYCISYGAWTDRDMEFGMVSVVLDEH.LEGVRG....SQYIRKT.LRPGHI.SVNRTHR...LQEMPPMRE............................................DFSEEDNSSSDSNTY-.KTDN...............................................SPL.TVHI.V.K.AGDEENYTTDRSDD..VEPTL...............HDADVMK-----.....FSGF.....VG.....AKDRFTLQGADPi...................................gPGDRSVRRFRPS.ATLKSAFH--------....-----------------....SGPTPD...........................ELYNAGA.E.QAdhd.................................................fehFVSRGKEKLQDEDPMAKLER.EAEDLK.PDSDNEDNDYDRTAPMFNPADGDPWS----gik.....................................
B7TWE0_9LUTE/202-640             .....................VDGG.P.GPKPGPDPTPP--PAPPPEPTPA.KHERFIV.YTGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQN.KVWNVGVQNNVTISNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTGPNASFFLVGPPVKKIAKYNFCISYGAWTDRDMEFGLVSVVLDEH.LEGVRG....SQYVRKT.LRPGHI.SVNRSHR...LQEMPPMRE............................................DFSEEDNSSSDSNTY-.KTDN...............................................SPL.TVHL.V.K.AGDEENYTTDRSDD..VEPTL...............HDADVMK-----.....FSGF.....VG.....AKDRFTLQGADPi...................................gPGDRSVRRFRPS.ATLKSAFH--------....-----------------....SGPTPD...........................ELYNAGA.E.QAdhd.................................................fehFVSRGKEKLQDEDPMAKLER.EAEDLK.PDSDNEDNDYDRTAPVFNPADGDPWS----gik.....................................
A5A2W2_BYDVP/206-650             ..................tpe--PK.P.APGPTPTPQPTPAPQPAPEPTPApVPKRFFE.YIGTPTGTISTRENSDSISVSKLGGQLMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEAERI....TRHAETP.IRSKHI.LVSEQYE...QPLPTIIDQ............................................---GLCDVQTPEQEQT.L---...............................................---.----.V.D.EEDKQTVS------..-----...............TEPDIALMEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPVDTSGNK.IPK--PKEPEVLGTYQ....GQNIYPEDVPPIARQKLr..dAANAPS...........................TLLYERT.P.KK.......................................................SNNFLTRFMEANRSPTTPAApTVSTVS.NMTREQLAEYTRIRKSLGLTAAKEYKAQF-q.......................................
A5A2Y0_BYDVP/202-650             ..............vdsstpe--PK.P.APEPTPTPQPTPAPQPAPEPTPApVPKRFFE.YIGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETRVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEAERI....TRHAETP.IRSKHI.LVSERYV...EPLPTIIDQ............................................---GLCDVKTPEQEQT.L---...............................................---.----.V.D.EEDRQTVS------..-----...............TEPDIALQEYEA.....ATAE.....IP.....DAEEDVLPSREQ.....................................LSSKPLDTSGNI.IPK--PKEPEVLGTYQ....GQNIYPEDVPPLARQRLr..eAAKAPS...........................TLLYERT.P.KK.......................................................SSNFLTRFVEANRSPTTPAApTVSTVS.NMTREQLAEYTRIRKSLGLTAAKEYKAQF-q.......................................
D2K8W0_9LUTE/198-265             ..................vgd----.A.PPTPTPTPT---PPAPTPAPAP-.---KYFG.YQGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQL-------------------------.----------------------------------.----------------------------...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
Q91GX4_BYDVP/1-449               ..............vdsstpe--PK.P.APEPTPTPQPTPAPQPAPEPTPApVPKRFFE.YVGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEAKRI....TRHAETP.IRSKHT.LVSERYE...EPLPTVIDQ............................................---GLCDVKTPEQEQT.----...............................................---.---L.V.E.EEDRQTVS------..-----...............TEPDIALQEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPLDTSGNI.IPK--PKEPEVLGTYQ....GQNIYPEDVPPLARQRLr..eAAKAPS...........................TLLYERT.P.KK.......................................................SNNFLTRFVEANRSPTTPAApTVSTAS.NMTREQLAEYTRIRKSLGLTAAKEYKAQF-q.......................................
Q84840_PLRV/1-490                ...................vd--SG.S.EPGPS--------PQPTPTPTPQ.KHERFIA.YVGIPMLTIQARENDDQIILGSLGSQRMKYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGVIAYSNADS.DYWNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP-TDGRFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEH.LEGTGS....ANRVRRP.PREGHT.YMASPRE...PEGKPVGNKprd.....................................etpiQTQERQPDQTPSDDVS.DAGS...............................................VNN.SGST.E.S.LQLEFGVNSDSTYD..ATVDG...............TDWPRIPPPRHP.....PEPR.....VS.....GNSRTVIDFS--.....................................PKADLLENWDAEhFDPGYSKEDVAAATII....AHGSIQDGRSMLEKREEs..vKNKTSSwkpplskavspa..iaklrsirksqplE------.-.-Ggtlkk.............................................datdgVSSIGSGSLTGGTLKRKVTI.EERLLQ.TLTTEQRLWYENLKKT-NPPAAIQWLYEY-q.......................................
Q8B6L6_9LUTE/1-520               .....................VDGE.P.GPKPGPDPAPQ--PTPAPEPTPA.KHERFIA.YTGTLSTLVSARQSSDSISLYSIRSQRIRYIEDENSSWTNIDAKWYSQNSVEAIPMFVYPVPEGTW.SIEISCEGYQAASSTSDPHRGKCDGMIAYDDDSS.KVWNVGQQNNVTITNNKADNDWKYGHPD...LTINGDKFDQNQVVEKDGIISFHLVTTGPNASFFLVAPAVKKTAKYNFCVSYGDWTDRDMEFGMVSVVLDEH.LEGARS....SQYVRKT.PRSGHV.GVNRSHR...LQDSSTPVEyvsd....................................edssSSNGSIVSIRPSTPDN.DSEAqfteslkg..............................klpiqsklpPKG.FLSR.L.S.AREKEEISSSKPSN..VDRQV...............GPLVAAY--GYP.....SQTG.....VY.....DAAREILRAKEAaenlaelerdlkeink....leppdvivqeeipdfvpPSEKILREDDPD.YVPPIWQNADQAVLVS....SYEPPDWSRPAYE----....SGNPPK...........................KAGTLKG.T.LSkl...................................................ggSLRSGESSLRGSLRKTQDQIdLDNKLS.KLSVIQRSQFQRILNNMGKTRARAYIDGL-d.......................................
Q7T6K7_9LUTE/1-415               .....................----.-.-----------------------.-------.-------------------------VTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCSISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSHANFTDKILEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYTPEAPE............................................QPTNEGTESMPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLVPTHADTLR.....QADK.....VR.....RALMANASRSAS.....................................PPPVNTEVPVLG.ATDTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPARS.E.TS.......................................................--TLQGGSLSGGSLRGG---.NLQALP.EATREQRREYERLKNSQGKTVAKAHAKEH-g.......................................
Q5I4G6_BYDVP/201-644             .....................VDSStP.EPKPTPAPTPPPQPEPKPEPTPApPPKRFFE.YVGTPIGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVQASGKDACFYIMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEALRM....SRHSESP.TRVNNV.LIDEGYH...QTLPPIQDF............................................---GLCDVQTPGQDEV.EE--...............................................---.----.-.-.-DDKQTVS------..-----...............TEPDIALQEYEA.....ATAE.....IP.....DAEEDVLPSREQ.....................................LSSKPVDTSGEE.IPKPPPRDNEILGVYQ....GQPIYADDVPPIARQKLr..dASKAPS...........................TMLYDKA.P.KP.......................................................-KSFLSRLVEGNRSKVDTSApSTATTS.NLTREQLREYTRIRNSLGLTAAKEYKAQF-s.......................................
Q8B6K2_9LUTE/1-363               .....................VDGE.P.GPKPGPDPAPQ--PTPTPEPTPA.KHERFIA.YTGTLSTLISARQSSDSISLYSIRSQRIRYIEDENSSWTNIDAKWYSQNSVEAIPMFVYPVPEGTW.SIEISCEGYQAASSTSDPHRGKCDGMIAYDDDSS.KVWNVGQQNNVTITNNKADNDWKYGHPD...LTINGDKFDQNQVVEKDGIISFHLVTTGPNASFFLVAPAVKKTAKYNFCVSYGDWTDRDMEFGMVSVVLDEH.LEGARS....SQYVRKT.LRPGHI.SVNRSHR...LQEMPPTRE............................................DFSEEDN-SSSDSNTY.KTDS...............................................SSM.TVHL.V.K.AGDEENYTTDQSDD..VDPTL...............RDAEVMK-----.....FAGF.....VG.....AKDRFALQGAKPi...................................gPGDRSIHRFKPS.ATLKS-----------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------afhs....................................
Q84824_PLRV/1-490                ...................vd--SG.S.EPGPS--------PQPTPTPTPQ.KHERFIA.YVGIPMLTIQARENDDQIILGSLGSQRMKYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNADS.DYWNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP-TDGRFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEH.LEGTGS....ANRVRRP.PREGHT.YMASPRE...PEGKPVGNKprd.....................................etpiQTQERQPDQTPSDDVS.DAGS...............................................VNG.GGST.E.S.LQLEFGINSDSTYD..ATVDG...............TDWPKIPPPRHP.....PEPR.....VS.....GNSRTVTDFS--.....................................PKADLLENWDAEhFDPGYSKEDVAAATII....AHGSIQDGRSMLEKREEn..vKNKTSSwkppspnavspa..iaklrsirksqplE------.-.-Ggtlkk.............................................datdgVSSIGSGSLTGGTLKRKATI.EERLLQ.TLTTEQRLWYENLKKT-NPSAATQWLFEY-q.......................................
A5A323_9LUTE/206-511             .....................VDAE.P.GPSPGPSPDPPPPPSPSPEPAPV.KEERFIV.YSGVAHTIISAQSTDDSIIVRDIPDQRFRYVENENFYWFQIAAQWYSNTNTKAVPMFVFPVPIGEW.SVEISTEGYQATSSTTDPNKGRIDGLIAYDNSS-.EGWNIGAGSNVTITNNKADNSWKYGHPD...LEINSCHFNQNQVLEKDGIISFHVKATEKEANFFLVAPPVQKTSKYNYAVSYGAWTDRDMEFGLITVTLDEK.---RGS....GSPTRKS.LRAGHA.GVTTTTD...LVALPEKEN............................................--SGIETSETPSAPVT.SSKA...............................................PLP.TV--.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------sdseseddplsaapdvg.......................
C7AXW4_BYDVP/21-187              ..............vdsstpe--PK.P.APEPTPTPQPTPAPQPAPEPTPAsVPKRFFE.YIGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQSAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNVLATNTWRPGH--...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------........................................
B7TWD4_9LUTE/202-640             .....................VDGE.P.GPKPGPDPTPP--PAPPPEPTPA.KHERFIV.YTGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTNIQAQWYSQNSVEAIPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQK.KVWNVGVQNNVTISNNKADADWKYGHPN...LTINGERFDQNQVVEKDGTISFHLVTTGPNASFFLVGPPVKKIAKYNYCISYGAWTDRDMEFGMVSVVLDEH.LEGVRG....SQYVRKT.LRPGHI.SVNRSHR...LQEMPPMRE............................................DFSEEDNSSSDSNTY-.KTDN...............................................SPL.TVHL.V.K.AGDEEIYTTDRSDD..AEPTL...............HDADVMK-----.....FSGF.....VG.....AKDRFTLQGADPi...................................gPGDRSVRRFRPS.ATLKSAFH--------....-----------------....SGPTPD...........................ELYNAGA.E.QAdhd.................................................fehFVSRGKEKLQDEDPMAKLER.EAEDLK.PDSDNEDNDYDRTAPVFNPADGDPWS----gik.....................................
Q65846_9LUTE/198-637             .....................VDPS.P.SPAPAPAPTPTPQPQPFPQPQPEpAKPRFYAnYSGTPTVNISTRETSDSIAVKRLGAQTLMYNSDDVHENRQIKSWWYSDNNVESQAAFVFPVPEGEY.SIQITAEGLQSVDHIGGNYDGYWIGLIAYGNDIS.DNWGIGVYDKCSITDLINTASWRPGHKD...MELNGCKFSD-QVVERDAIISFKIHAQ-KGASFYLVAPRTKKADKYNYVVSYGGYTEKRMEFGTISVTIDER.NDEARS....QWHTLQP.FKPGLL.EISHKRAtplSTFVPVPDT............................................-NFERNEDTNPPVSVS.SPEL...............................................---.EVNL.N.L.EDISHELTERGREP..TPDPQ...............DDLAKRLEEYEK.....ATSE.....VP.....DFALTQD-----.....................................DEEIPSISLAPP.KPPGLPKSPEPASTYR....-----------------....--PDPV...........................TIPNYTK.S.KA.......................................................NNRLLSRFLEGNRSNKVADG.STATTS.RLTPEQNLEYYRIQRSLGKTAAAKYKQEC-l.......................................
E0A2S6_9LUTE/1-137               ....................g----.-.-----------------------.-------.------------------------------------------------------------------.----------------------------------.ATWNVGEYNNVKITKLLNTSSWKKGHKD...VVLNGCHFNDGQVIERDSTMSFHCEVGHGGGTILLVAPPVCKSDKYNYVVPYGEYTTKHMEFGSIAICFDEK.HGGARA....GKFLGAPfPRAGHV.VCEQQTE...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------iarfpagsd...............................
MCAPS_PEMVW/191-473              ...................gd---D.A.PPSPGPDPGPQPPPPPPPSPTPV.-GARFWG.YEGVPESRMISERNDHDIDVKPLSFITMYKWEDESWTSVKLSASYLQNDQVEATPYFLIPSSKGKF.SVYIECEGFQAVKSIGGKSDGCWGGLIAYNRKK-.DGWQARAYTGTVLSNYRSTTTVINGHPD...CEVNDCKFKPDRGVESDLICSFHLEAE-EDSYWALQAPPIQKSSDYNYVVSYGGYTEKSIEWGSVSISIDEV.-NQTAS....ASPWRGR.ARK---.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------lailqetavpppfppggvmdyhlgdregdqtgtsekg...
Q6STE7_9LUTE/166-239             .....................VDAE.P.GPRPGPSPDPP---PPTPEPTPA.KEERFIV.YSGVAHSNISAQGTDDSIIVRDIPDQRFRYVENENFYWFQI-------------------------.----------------------------------.----------------------------...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------a.......................................
B3GQB4_PLRV/2-107                .lekreenvknktsswkpplp----.-.-----------------------.-------.------------------------------------------------------------------.----------------------------------.----------------------------...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....------KAVSPAIAKLRsirkSQPLEK...........................GTLKEDA.T.DG.......................................................VSSIGSGSLTGGTLKRKATI.EERLLQ.TLTTEQRLWYENLKKT-NPLAATQWMFEY-q.......................................
Q3YB89_9LUTE/202-640             .....................VDGE.P.GPKPGPDPTPP--PAPPPEPTPA.KHERFIV.YTGTLSTLISARQNSDSISLYPIRDQRVRYIEDENANWAYIKAQWYSQNSVEAVPMFIYPVPQGTW.SVEISCEGYQATSSTTDPHRGKSDGMIAYDDDQT.KVWNVGVQNNVTITNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTGPNASFFLAGPAVKKIAKYNFCISYGAWTDRDMEFGLVSVVLDEH.LEGVRG....SQYVRKT.LRPGHI.SVNRPHR...LQIMPPTRE............................................DDSDGYSSSSDS-NTY.KTDN...............................................SPL.TVHL.V.K.AGDEENCTTDRSDD..VEPIL...............HDADVMK-----.....FSGF.....VG.....AKDRFMLQGADPi...................................gPGDRSVRRFKPS.ATLKSAFH--------....-----------------....SGPTPD...........................ELYNAGT.E.QAdhd.................................................fehFVSRGKEKLQDEDPMAKLER.EAGDLK.PDSDNEDNDYDRTAPVFNPADGDPWS----gin.....................................
E0YC38_9LUTE/201-343             .....................VDD-.S.SPPPAPTPPPPPPPSPSPEPKPC.KKDRFWG.YEGVPQNKISAARNNQFIDVKTLNYVQMYKWEDDRWDRVNMQASYARNDRNYAEPYMVIPANKGKF.HVYVECDGQMAVKSIGGKADNSWNGLIAYDVSR-.KAWNIGNYK-------------------...------------------------------------------------------------------------.------....-------.------.-------...---------............................................----------------.----...............................................---.----.-.-.--------------..-----...............------------.....----.....--.....------------.....................................------------.----------------....-----------------....------...........................-------.-.--.......................................................--------------------.------.------------------------------t.......................................
B0FKU8_BYDVP/201-646             .....................VDSStP.EPKPTPAPTPAPTPEPKPEPTPApPPKRFFE.YVGTPIGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDCYWIGLIAYSNSSG.DNWGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEASGKDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEAFRM....TRHSECP.TRVNNI.LIDEGYC...QPLSTITDQ............................................---GLCDVQTPGQDQE.VV--...............................................---.----.-.-.EEDRQTVS------..-----...............TESDIALKEYEA.....AIAE.....IP.....DAEEDALPSREQ.....................................LSSKPVDTSGEE.IPKPRPLSNEVLGVYQ....GQTIYADDVPPGTRQKLr..dAAKAPS...........................TLLYDKT.P.KR.......................................................SKSILSRFLEGNRSSVESAApSTATTS.NLTREQLREYTRIRNTLGLTAAKEYKARL-s.......................................
B0FKW6_BYDVP/201-643             .....................VDS-.S.TPEPTPAPAPQPTPQPAPEPTPApAPKRFFE.YIGTPMGVISTRENTDSISVSQLGGQSMQYIENEKCETRTIDSFWSTNNNVAAQAAFVYPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGIIAYSNSSD.DNWGIGNYRGCSFKNYLATNTWRPGHKD...LKLNDCQFTGEQIVERNSIISFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEAIRI....AKHSATP.NRANHI.LVSERYQ...DVLPTIENQ............................................---GLCDVETPSQETS.I---...............................................---.----.V.E.EDDKQSVS------..-----...............TEPEIAVKEYEA.....AVAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPVDTSGNT.IPR--TKEPEVLGTYQ....GQNIYPEDVPPAARQALr..eAARAPS...........................TMLYDKA.P.KG.......................................................AKSILSRFVEGNRSKTNPAApSVSTTS.NMTREQLKEYTRIRNSLGVTAAKEYKVQF-q.......................................
Q8B6L2_9LUTE/1-520               .....................VDGE.P.GPKPGPDPAPQ--PTPTPEPTPA.KHERFIA.YTGTLSTLISARQSSDSISLYSIRSQRIRYIEDENSSWTNIDAKWYSQNSVEAIPMFVYPVPEGTW.SIEISCEGYQAASSTSDPHRGKCDGMIAYDDDSS.KVWNVGQQNNVTITNNKADNDWKYGHPD...LTINGDKFDQNQVVEKDGIISFHLVTTGPNASFFLVAPAVKKTAKYNFCVSYGDWTDRDMEFGMVSVVLDEH.LEGARS....SQYVRKT.PRSGHV.GVNRSHR...LQDSSTPVEyvsd....................................edssSSNSSIVSNRPSAPDN.DSEAqfaeslkg..............................klptqsklpPKG.FLSR.L.S.AREKEEISSSKPSN..VDRQV...............GPLVAAY--GYP.....SQTG.....VY.....DAAREILRAKEAaenlaelerdlkeink....leppdvivqeeipdfvpPSEKILKEDDPD.YVSPIWQNADQAVLVS....SYEPRDWSRPTYE----....SGDPPK...........................KAGTLKG.T.LSkl...................................................ggSLRSGESSLRGSLRKTQDQTdLDNKLS.KLSVVQRSQYQRILNSMGKTRARAYIDGL-d.......................................
Q99GS4_PLRV/1-490                ...................vd--SG.S.EPGPS--------PQPTPTPTPQ.KHERFIA.YVGIPMLTIQARENDDQIILGSLGNQRMKYIEDENRSYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNADS.DYWNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISLHVEAP-TDGRFFLVGPAVQKTAKYNYTISYGDWTDRDMELGLITVVLDEH.LEGTDS....ANRVRRP.PREGHT.YMASPRE...PEGKPVGNKprd.....................................etpiQTQERQPDQTPSDDVS.DAGS...............................................VNS.GGST.E.S.LRLEFGVNSDSTYD..ATVDG...............TDWPRIPPPRHP.....PEPR.....VS.....GNSRTVTDFS--.....................................PETDLLENWDAKhFDPGYSKEDVAAATII....AHGSIQDGRSMLEKREEn..vKNKTSSwkpplskavspaiaklrsirksqplegGTLNKDA.T.DG.......................................................VSSIGSGSLTGGTLKRKVTI.EDRLLQ.TLTTEQRLWFENLKKT-NPPAATQWLYEY-q.......................................
B0FL08_BYDVP/202-650             ..............vdsstpe--PK.P.APEPTPTPQPTPAPQPAPEPTPApAPKRFFE.YIGIPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNYVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSSG.DNWGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATGTDACFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCDESdVEAERI....TRHAKTP.IRSKHI.LVSEQYE...QPLPTIIDQ............................................---GLCDVQTPEQEQT.L---...............................................---.----.V.D.EEDKQTVS------..-----...............TEPDIALMEYEA.....ATAE.....IP.....DAEEDVLPSKEQ.....................................LSSKPVDTSGNK.IPK--PKEPEVLGTYQ....GQNIYPEDVPPIARQKLr..eAANAPS...........................TLLYEKT.P.KK.......................................................SNNFLTRFVDANRSPTTPAApTVSTVS.NMTREQLAEYTRIRKSLGLTAAKEYKAQF-q.......................................
Q70FV5_9LUTE/1-417               ....................e----.-.-----------------------.-------.------------------------NVTMYLWKDESWSIEQLPAGYRVNNRERAIPFVLFPVDKGRY.SVFIQCEGFKAVKAKGGTNDGKMSGFLCDNANL-.AGWRAYAYSGCTVSNYRTSDSNVPGHPD...MRVNGGSFTD-QLVERDFSCSFHLEVP-QQGYFGLEAPPIEKSDHFNFVVSYANFTDKIMEWGSISVAIDEVnDGAYSR....SKWDKTT.AMSARLpTQVSAPS...EVYNPEKPE............................................ESKNEGTESTPPAPNP.ALGPdnpatkeptp...........................kivdnpdpkvLNW.LNNQ.R.D.KPVVEEVLRESPIY..APPPP...............PSLTPTSADTLR.....QADK.....VR.....RALMANASRSAS.....................................PPPSTTEVPVLG.ATDTASLSGSLRGGSL....RGNLGSRPSLPRV----....ADSPPR...........................SVSPARS.E.TS.......................................................--TLQGGSLGGGSLRGG---.NLQVLP.EATREQRREYERLKNSQGKTVARAHAREH-g.......................................
G1K0U2_9LUTE/202-720             .....................VDGE.P.GPKPGPDPAPQ--PTPTPEPTPA.KHERFIA.YTGTLSTLISARQSSDSISLYSIRNQRIRYIEDENSSWANIDAKWYSQNSVEAIPMFVYPVPEGTW.SIEISCEGYQAASTTSDPHRGKCDGMIAYDDDSS.KVWNVGQQNNVTITNNKADNDWKYGHPD...LTINGDRFDQNQVVEKDGIISFHLVTTGPNASFFLVAPAVKKTAKYNFCVSYGDWTDRDMEFGMVSVVLDEH.LEGARS....SQYIRKS.PRPGHF.GVNRSHR...LQDSFTPVEyvs.....................................eddsSSSSSIVSNRPSTPVS.DSEVqfaeslkg..............................klptqsklpPKG.FLSR.L.S.VKEKEEISKSRPSN..VENQV...............EPLVKAY--GYP.....SQTG.....VY.....DAAREILQAKEAaenlaelerdlkeinr....leppdiivqeeipdfvpPSEKVVQEDNRE.YIPPIWRNADQAVAVS....SYEPPDWSQSAYE----....SGYPSR...........................KVGSLRG.T.LSkl...................................................ggSLKSGESSLRGSLRKTQDQSdLDYKLS.KLNVLQRSQYQRILANLGKTRARAYIDGL-d.......................................
#=GC seq_cons                    .......................st.s.sPpPsPsPp....PtPsPpPsP....pRFht.Y.GsPpshIpsRpNo-tIsltplts.sMhhhEDEshshpplsutahsNNphpA.shhlaPVscGpa.SV.IpCEGaQuspphusspcGph.GhIAYsssp..csWslGsYsGssIoNhhsssoa+.GH.D...hclNuspFsptQlVERDhshSFHlcss.ppupFhLhAPslpKos+YNasVSYGsaT-+hMEaG.ISVslDEp..tu.p.....sphscps.h+ss+h..hsps.p.......s...p...............................................t.ts.ppP.t.........................................................................ph..............................p.s.h............tst.....l......ts....h.tt........................................ssp.hc....t.hs...s.p...hss.............s...h..........s.ssp...........................ph..ttt....t.........................................................s..st.lpusp..tt....p.phh..phoppphtpYpplpps.s.ssAptah.t..t.......................................
//
DBGET integrated database retrieval system