GenomeNet

Database: Pfam
Entry: PLRV_ORF5
LinkDB: PLRV_ORF5
Original site: PLRV_ORF5 
#=GF ID   PLRV_ORF5
#=GF AC   PF01690.13
#=GF DE   Potato leaf roll virus readthrough protein
#=GF AU   Bashton M, Bateman A
#=GF SE   Pfam-B_1335 (release 4.1)
#=GF GA   27.40 27.40;
#=GF TC   27.70 27.40;
#=GF NC   24.50 27.30;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 80369284 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   7513925
#=GF RT   Changes in the amino acid sequence of the coat protein
#=GF RT   readthrough domain of potato leafroll luteovirus affect the
#=GF RT   formation of an epitope and aphid transmission. 
#=GF RA   Jolly CA, Mayo MA; 
#=GF RL   Virology 1994;201:182-185.
#=GF DR   INTERPRO; IPR002929;
#=GF CC   This family consists mainly of the potato leaf roll virus 
#=GF CC   readthrough protein. This is generated via a readthrough  of
#=GF CC   open reading frame 3 a coat protein allowing transcription of
#=GF CC   open reading frame 5 to give an extended coat protein  with a
#=GF CC   large c-terminal addition or read through domain [1]. The
#=GF CC   readthrough protein is thought to play a role in the 
#=GF CC   circulative aphid transmission of potato leaf roll virus [1].
#=GF CC   Also in the family is open reading frame 6 from beet western
#=GF CC   yellows virus and potato leaf roll virus both luteovirus and an
#=GF CC   unknown protein from cucurbit aphid-borne yellows virus a
#=GF CC   closterovirus.
#=GF SQ   472
#=GS G0YSX3_9LUTE/6-456    AC G0YSX3.1
#=GS B0FKL4_BYDVP/565-649  AC B0FKL4.1
#=GS Q65877_BYDVR/18-370   AC Q65877.1
#=GS Q6STE1_BYDVP/193-420  AC Q6STE1.1
#=GS Q84820_PLRV/5-489     AC Q84820.1
#=GS B0FKU2_BYDVP/558-645  AC B0FKU2.1
#=GS B0FKN8_BYDVP/557-643  AC B0FKN8.1
#=GS U5LXW1_9LUTE/206-579  AC U5LXW1.1
#=GS D7EZI4_9LUTE/207-610  AC D7EZI4.1
#=GS B2BJG5_9LUTE/213-556  AC B2BJG5.1
#=GS A5A316_BYDVP/567-649  AC A5A316.1
#=GS B0FKR2_BYDVP/208-562  AC B0FKR2.1
#=GS I1Z183_PLRV/214-698   AC I1Z183.1
#=GS H9NAD4_9LUTE/201-265  AC H9NAD4.1
#=GS K4GSV7_9LUTE/212-504  AC K4GSV7.1
#=GS B1A431_9LUTE/212-500  AC B1A431.1
#=GS Q7T6K7_9LUTE/2-223    AC Q7T6K7.1
#=GS F8RUH4_9LUTE/201-418  AC F8RUH4.1
#=GS K4GUL7_9LUTE/212-504  AC K4GUL7.1
#=GS F8RUG2_9LUTE/201-418  AC F8RUG2.1
#=GS D3JXR4_9LUTE/201-470  AC D3JXR4.1
#=GS C7AXW5_BYDVP/38-187   AC C7AXW5.1
#=GS F8RUC3_9LUTE/201-476  AC F8RUC3.1
#=GS Q87035_9LUTE/9-314    AC Q87035.1
#=GS S4U2K4_9LUTE/1-69     AC S4U2K4.1
#=GS C7AXW4_BYDVP/38-187   AC C7AXW4.1
#=GS B7TWC5_9LUTE/212-501  AC B7TWC5.1
#=GS M4GJX8_9LUTE/201-468  AC M4GJX8.1
#=GS A5A2Z2_BYDVP/565-649  AC A5A2Z2.1
#=GS K4GPY1_9LUTE/212-504  AC K4GPY1.1
#=GS Q91AV3_9LUTE/1-374    AC Q91AV3.1
#=GS B0ZT93_9LUTE/206-580  AC B0ZT93.1
#=GS I1XV24_PLRV/1-106     AC I1XV24.1
#=GS J7FCV1_9LUTE/209-614  AC J7FCV1.1
#=GS B5L2B9_9LUTE/207-612  AC B5L2B9.1
#=GS S0ER74_9LUTE/199-466  AC S0ER74.1
#=GS Q84824_PLRV/5-489     AC Q84824.1
#=GS A5A304_BYDVP/219-573  AC A5A304.1
#=GS L0ANF1_PLRV/1-226     AC L0ANF1.1
#=GS Q99GS4_PLRV/5-489     AC Q99GS4.1
#=GS Q65849_BYDVP/366-448  AC Q65849.1
#=GS W8Q8Z8_BYDVP/21-249   AC W8Q8Z8.1
#=GS B0FKK8_BYDVP/557-645  AC B0FKK8.1
#=GS Q8QHP7_PLRV/1-106     AC Q8QHP7.1
#=GS Q65872_BYDV1/6-374    AC Q65872.1
#=GS Q2L3I9_9LUTE/201-471  AC Q2L3I9.1
#=GS B3FHC0_9LUTE/227-595  AC B3FHC0.1
#=GS Q7T6K1_9LUTE/2-237    AC Q7T6K1.1
#=GS B0ZT81_9LUTE/206-579  AC B0ZT81.1
#=GS B1A419_9LUTE/212-490  AC B1A419.1
#=GS K9Y3B7_9LUTE/208-573  AC K9Y3B7.1
#=GS F8RUD5_9LUTE/201-469  AC F8RUD5.1
#=GS Q65846_9LUTE/210-568  AC Q65846.1
#=GS M4GJX1_9LUTE/201-456  AC M4GJX1.1
#=GS B1A425_9LUTE/212-499  AC B1A425.1
#=GS D2K8V0_9LUTE/201-265  AC D2K8V0.1
#=GS Q8B6L2_9LUTE/9-312    AC Q8B6L2.1
#=GS B7TWC8_9LUTE/212-502  AC B7TWC8.1
#=GS M4GJY1_9LUTE/201-469  AC M4GJY1.1
#=GS B0ZT69_9LUTE/206-579  AC B0ZT69.1
#=GS B0FKU8_BYDVP/556-645  AC B0FKU8.1
#=GS Q7T6L0_9LUTE/2-231    AC Q7T6L0.1
#=GS B0FKM0_BYDVP/203-559  AC B0FKM0.1
#=GS Q9IZF4_9LUTE/210-538  AC Q9IZF4.1
#=GS Q7T6J5_9LUTE/2-223    AC Q7T6J5.1
#=GS A0FLF6_BYDVP/565-649  AC A0FLF6.1
#=GS B3GQB4_PLRV/1-106     AC B3GQB4.1
#=GS S4U2I9_9LUTE/1-77     AC S4U2I9.1
#=GS C7AXW3_BYDVP/38-187   AC C7AXW3.1
#=GS A5A328_BYDVP/219-572  AC A5A328.1
#=GS Q91QQ1_9LUTE/9-318    AC Q91QQ1.1
#=GS B0FL14_BYDVP/203-566  AC B0FL14.1
#=GS D2K8T0_9LUTE/201-469  AC D2K8T0.1
#=GS G8Z1W7_9LUTE/209-612  AC G8Z1W7.1
#=GS D2K8U5_9LUTE/201-265  AC D2K8U5.1
#=GS A5A323_9LUTE/216-545  AC A5A323.1
#=GS Q91AV7_9LUTE/1-373    AC Q91AV7.1
#=GS E7FL73_9LUTE/215-719  AC E7FL73.1
#=GS Q9IZG0_BYDVP/565-649  AC Q9IZG0.1
#=GS F8RUN4_9LUTE/201-418  AC F8RUN4.1
#=GS A5A2R5_9LUTE/216-556  AC A5A2R5.1
#=GS B3FGU1_9LUTE/209-612  AC B3FGU1.1
#=GS A5A2Q8_BYDVP/567-649  AC A5A2Q8.1
#=GS B0FL26_BYDVP/203-563  AC B0FL26.1
#=GS S4U5P0_9LUTE/1-78     AC S4U5P0.1
#=GS G3E232_9LUTE/1-259    AC G3E232.1
#=GS B0FKM6_BYDVP/554-643  AC B0FKM6.1
#=GS Q8QYQ3_PLRV/1-106     AC Q8QYQ3.1
#=GS Q5UUX6_9LUTE/206-579  AC Q5UUX6.1
#=GS J7FDA1_9LUTE/208-505  AC J7FDA1.1
#=GS F8RUI9_9LUTE/201-418  AC F8RUI9.1
#=GS Q70FV7_9LUTE/2-239    AC Q70FV7.1
#=GS E3UIM2_BLRV/211-508   AC E3UIM2.1
#=GS D2K8W5_9LUTE/201-265  AC D2K8W5.1
#=GS I1Z192_PLRV/214-698   AC I1Z192.1
#=GS O92523_9LUTE/359-452  AC O92523.1
#=GS Q91IC7_BYDVP/364-448  AC Q91IC7.1
#=GS Q70FV2_9LUTE/2-225    AC Q70FV2.1
#=GS F8RUL6_9LUTE/201-418  AC F8RUL6.1
#=GS I3Y1T5_9LUTE/208-502  AC I3Y1T5.1
#=GS B0FKT0_BYDVP/203-562  AC B0FKT0.1
#=GS O92521_9LUTE/370-453  AC O92521.1
#=GS F8RUK1_9LUTE/201-418  AC F8RUK1.1
#=GS MCAPS_BWYVG/207-610   AC P09515.2
#=GS Q45ZZ0_BYDVP/566-649  AC Q45ZZ0.1
#=GS Q5CC80_BYDVP/218-571  AC Q5CC80.1
#=GS R9UHA0_9LUTE/205-590  AC R9UHA0.1
#=GS B0FKX2_BYDVP/560-642  AC B0FKX2.1
#=GS Q65972_9LUTE/209-609  AC Q65972.2
#=GS F8RUI3_9LUTE/201-418  AC F8RUI3.1
#=GS B0FKM0_BYDVP/553-643  AC B0FKM0.1
#=GS Q84815_PLRV/5-489     AC Q84815.1
#=GS Q8JZ09_9LUTE/208-610  AC Q8JZ09.1
#=GS B5KLA3_9LUTE/1-372    AC B5KLA3.1
#=GS A5A2T8_BYDVP/565-649  AC A5A2T8.1
#=GS Q91IC7_BYDVP/18-370   AC Q91IC7.1
#=GS B0FKU2_BYDVP/203-563  AC B0FKU2.1
#=GS F8RUJ5_9LUTE/201-418  AC F8RUJ5.1
#=GS R4I757_9LUTE/10-411   AC R4I757.1
#=GS D0EX81_9LUTE/201-265  AC D0EX81.1
#=GS Q2L3F3_9LUTE/201-477  AC Q2L3F3.1
#=GS B1A434_9LUTE/212-504  AC B1A434.1
#=GS E0A2S1_9LUTE/1-137    AC E0A2S1.1
#=GS Q8B6L4_9LUTE/9-309    AC Q8B6L4.1
#=GS Q8BA01_PLRV/214-698   AC Q8BA01.1
#=GS I1Z1A5_PLRV/1-106     AC I1Z1A5.1
#=GS B0FKX8_BYDVP/219-573  AC B0FKX8.1
#=GS B1A440_9LUTE/212-501  AC B1A440.1
#=GS A5A2S0_BYDVP/219-649  AC A5A2S0.1
#=GS R9U127_9LUTE/203-507  AC R9U127.1
#=GS B0FL20_BYDVP/556-645  AC B0FL20.1
#=GS O09708_PEMV1/198-469  AC O09708.1
#=GS R4HG89_9LUTE/212-501  AC R4HG89.1
#=GS K9LHK2_9LUTE/4-192    AC K9LHK2.1
#=GS Q670I2_9LUTE/218-578  AC Q670I2.1
#=GS B0FKS4_BYDVP/203-559  AC B0FKS4.1
#=GS B0FKK2_BYDVP/202-555  AC B0FKK2.1
#=GS B0FL20_BYDVP/203-563  AC B0FL20.1
#=GS Q70FV6_9LUTE/2-239    AC Q70FV6.1
#=GS V5KYS7_9LUTE/201-479  AC V5KYS7.1
#=GS B0FKN8_BYDVP/202-558  AC B0FKN8.1
#=GS Q7T6K8_9LUTE/2-223    AC Q7T6K8.1
#=GS C7AXW7_BYDVP/38-187   AC C7AXW7.1
#=GS B0FL02_BYDVP/219-570  AC B0FL02.1
#=GS Q65849_BYDVP/18-372   AC Q65849.1
#=GS B5KLA5_9LUTE/1-372    AC B5KLA5.1
#=GS Q84822_PLRV/5-489     AC Q84822.1
#=GS B7TWD7_9LUTE/212-500  AC B7TWD7.1
#=GS Q8B6K4_9LUTE/9-515    AC Q8B6K4.1
#=GS S4U191_9LUTE/1-76     AC S4U191.1
#=GS S4U216_9LUTE/1-76     AC S4U216.1
#=GS A7XUE2_9LUTE/212-500  AC A7XUE2.1
#=GS S4U205_9LUTE/1-76     AC S4U205.1
#=GS Q8B6M4_9LUTE/9-319    AC Q8B6M4.1
#=GS H9NAE6_9LUTE/201-265  AC H9NAE6.1
#=GS B0FL26_BYDVP/556-645  AC B0FL26.1
#=GS E0A2S0_9LUTE/1-137    AC E0A2S0.1
#=GS Q7T6J4_9LUTE/2-223    AC Q7T6J4.1
#=GS W8FKV2_9LUTE/1-257    AC W8FKV2.1
#=GS Q8QYN3_PLRV/1-106     AC Q8QYN3.1
#=GS D2K8W0_9LUTE/201-265  AC D2K8W0.1
#=GS S4U4L7_9LUTE/1-77     AC S4U4L7.1
#=GS F8RUJ8_9LUTE/201-418  AC F8RUJ8.1
#=GS Q70FV0_9LUTE/2-225    AC Q70FV0.1
#=GS B1A413_9LUTE/212-500  AC B1A413.1
#=GS D2K8U0_9LUTE/201-265  AC D2K8U0.1
#=GS Q460A0_BYDVP/219-570  AC Q460A0.1
#=GS Q7T6K5_9LUTE/2-222    AC Q7T6K5.1
#=GS E0A2S3_9LUTE/1-137    AC E0A2S3.1
#=GS I1Z1A1_PLRV/214-698   AC I1Z1A1.1
#=GS E2DRQ5_9LUTE/208-656  AC E2DRQ5.1
#=GS F8RUL0_9LUTE/201-418  AC F8RUL0.1
#=GS C6GYU8_9LUTE/207-562  AC C6GYU8.1
#=GS A5A2Q2_BYDVP/569-651  AC A5A2Q2.1
#=GS Q7T6K9_9LUTE/2-232    AC Q7T6K9.1
#=GS A5A2Y0_BYDVP/567-649  AC A5A2Y0.1
#=GS S4U1A3_9LUTE/1-76     AC S4U1A3.1
#=GS Q70FV9_9LUTE/2-234    AC Q70FV9.1
#=GS V9PPM4_PLRV/214-698   AC V9PPM4.1
#=GS A5A2Y6_BYDVP/219-572  AC A5A2Y6.1
#=GS D7EZJ0_9LUTE/209-612  AC D7EZJ0.1
#=GS Q2L3G5_9LUTE/201-483  AC Q2L3G5.1
#=GS Q45ZZ0_BYDVP/219-570  AC Q45ZZ0.1
#=GS Q99AS9_BYDVM/206-579  AC Q99AS9.1
#=GS B0FKZ6_BYDVP/555-645  AC B0FKZ6.1
#=GS Q7T6J8_9LUTE/2-223    AC Q7T6J8.1
#=GS MCAPS_PLRV1/213-697   AC P17525.2
#=GS B1A437_9LUTE/212-500  AC B1A437.1
#=GS S4U5N6_9LUTE/1-77     AC S4U5N6.1
#=GS B0FKP4_BYDVP/203-563  AC B0FKP4.1
#=GS S4U2K7_9LUTE/1-78     AC S4U2K7.1
#=GS MCAPS_BYDVP/218-571   AC P09516.3
#=GS R9Q9M3_9LUTE/1-351    AC R9Q9M3.1
#=GS B3GQA5_PLRV/1-106     AC B3GQA5.1
#=GS B0ZT99_9LUTE/206-579  AC B0ZT99.1
#=GS E0YC37_9LUTE/209-329  AC E0YC37.1
#=GS V5KXI8_9LUTE/201-479  AC V5KXI8.1
#=GS Q7T6K0_9LUTE/2-236    AC Q7T6K0.1
#=GS A5A2Q2_BYDVP/221-573  AC A5A2Q2.1
#=GS A5A2Z8_BYDVP/219-572  AC A5A2Z8.1
#=GS Q84840_PLRV/5-489     AC Q84840.1
#=GS Q84829_PLRV1/5-489    AC Q84829.1
#=GS B0FKR2_BYDVP/556-643  AC B0FKR2.1
#=GS Q91GX4_BYDVP/364-448  AC Q91GX4.1
#=GS R9Q9K0_9LUTE/209-612  AC R9Q9K0.1
#=GS I1XV11_PLRV/214-698   AC I1XV11.1
#=GS Q91QR1_9LUTE/9-310    AC Q91QR1.1
#=GS Q99GS1_PLRV/5-489     AC Q99GS1.1
#=GS A5A310_BYDVP/219-572  AC A5A310.1
#=GS G3E238_9LUTE/1-283    AC G3E238.1
#=GS F8RUJ2_9LUTE/201-418  AC F8RUJ2.1
#=GS MCAPS_PEMVW/198-469   AC Q84711.2
#=GS I1Z196_PLRV/1-106     AC I1Z196.1
#=GS Q8B6M2_9LUTE/9-310    AC Q8B6M2.1
#=GS B0FKQ0_BYDVP/560-642  AC B0FKQ0.1
#=GS Q80J50_9LUTE/206-579  AC Q80J50.1
#=GS Q45ZY5_BYDVP/219-573  AC Q45ZY5.1
#=GS J7FE72_9LUTE/207-611  AC J7FE72.1
#=GS Q65874_9LUTE/11-333   AC Q65874.1
#=GS B0FEU6_PLRV/1-106     AC B0FEU6.1
#=GS O92521_9LUTE/18-375   AC O92521.1
#=GS Q8QYP9_PLRV/214-698   AC Q8QYP9.1
#=GS B0FKQ6_BYDVP/555-643  AC B0FKQ6.1
#=GS S4U4K8_9LUTE/1-74     AC S4U4K8.1
#=GS A5A328_BYDVP/565-649  AC A5A328.1
#=GS A5A2P7_9LUTE/217-556  AC A5A2P7.1
#=GS B0FKP4_BYDVP/554-645  AC B0FKP4.1
#=GS Q8QYM7_PLRV/1-106     AC Q8QYM7.1
#=GS V9PNP2_PLRV/214-698   AC V9PNP2.1
#=GS S4U5M7_9LUTE/1-76     AC S4U5M7.1
#=GS Q8QYM9_PLRV/214-698   AC Q8QYM9.1
#=GS B0FKZ6_BYDVP/203-562  AC B0FKZ6.1
#=GS C7AXW6_BYDVP/38-187   AC C7AXW6.1
#=GS B0FKZ0_BYDVP/203-562  AC B0FKZ0.1
#=GS D4P4W1_9LUTE/199-477  AC D4P4W1.1
#=GS F8RUC9_9LUTE/201-479  AC F8RUC9.1
#=GS E3UIL9_PEMV1/198-468  AC E3UIL9.1
#=GS C7AXX0_BYDVP/38-187   AC C7AXX0.1
#=GS D2K8T5_9LUTE/201-265  AC D2K8T5.1
#=GS A5A304_BYDVP/567-649  AC A5A304.1
#=GS L7YEQ5_9LUTE/208-612  AC L7YEQ5.1
#=GS Q6STE7_9LUTE/172-238  AC Q6STE7.1
#=GS M4GJZ2_9LUTE/201-456  AC M4GJZ2.1
#=GS Q7T6J6_9LUTE/2-223    AC Q7T6J6.1
#=GS F8RUM5_9LUTE/201-418  AC F8RUM5.1
#=GS D4P4U7_9LUTE/201-265  AC D4P4U7.1
#=GS R4I816_9LUTE/9-412    AC R4I816.1
#=GS A5A2V0_BYDVP/219-571  AC A5A2V0.1
#=GS B0FL02_BYDVP/565-649  AC B0FL02.1
#=GS B7TWD1_9LUTE/212-500  AC B7TWD1.1
#=GS I1XV29_PLRV/214-698   AC I1XV29.1
#=GS MCAPS_TYYVF/208-612   AC P09514.2
#=GS Q2L3H7_9LUTE/201-479  AC Q2L3H7.1
#=GS C7AXX1_BYDVP/38-187   AC C7AXX1.1
#=GS B3GQA1_PLRV/214-698   AC B3GQA1.1
#=GS I1Z187_PLRV/1-106     AC I1Z187.1
#=GS R9Q9K4_9LUTE/1-221    AC R9Q9K4.1
#=GS S4U5M9_9LUTE/1-75     AC S4U5M9.1
#=GS B0FL14_BYDVP/555-645  AC B0FL14.1
#=GS E5GAA9_9LUTE/211-617  AC E5GAA9.1
#=GS B1A410_9LUTE/212-500  AC B1A410.1
#=GS Q7T6K6_9LUTE/2-222    AC Q7T6K6.1
#=GS U5LV62_9LUTE/206-579  AC U5LV62.1
#=GS Q7T6J7_9LUTE/2-223    AC Q7T6J7.1
#=GS A5A310_BYDVP/565-649  AC A5A310.1
#=GS Q45ZZ5_BYDVP/219-570  AC Q45ZZ5.1
#=GS B0FKY4_BYDVP/566-649  AC B0FKY4.1
#=GS F8RUH7_9LUTE/201-418  AC F8RUH7.1
#=GS Q70FV8_9LUTE/2-225    AC Q70FV8.1
#=GS D7EZH8_9LUTE/206-610  AC D7EZH8.1
#=GS F8RUN1_9LUTE/201-418  AC F8RUN1.1
#=GS B1A422_9LUTE/212-501  AC B1A422.1
#=GS Q91GX6_BYDVP/18-371   AC Q91GX6.1
#=GS S4U212_9LUTE/1-76     AC S4U212.1
#=GS A5A2Q8_BYDVP/219-574  AC A5A2Q8.1
#=GS I1Z1C1_PLRV/1-106     AC I1Z1C1.1
#=GS E0A2S5_9LUTE/1-137    AC E0A2S5.1
#=GS Q70FV4_9LUTE/2-239    AC Q70FV4.1
#=GS B0FKT6_BYDVP/203-562  AC B0FKT6.1
#=GS R4I782_9LUTE/11-411   AC R4I782.1
#=GS F8RUF9_9LUTE/201-471  AC F8RUF9.1
#=GS Q8B6K6_9LUTE/9-516    AC Q8B6K6.1
#=GS R9UFV9_9LUTE/203-590  AC R9UFV9.1
#=GS Q2L3H1_9LUTE/201-475  AC Q2L3H1.1
#=GS Q65862_9LUTE/11-333   AC Q65862.1
#=GS E0A2S2_9LUTE/1-137    AC E0A2S2.1
#=GS S4U2J5_9LUTE/1-77     AC S4U2J5.1
#=GS B0FKW0_BYDVP/555-643  AC B0FKW0.1
#=GS Q460A0_BYDVP/566-649  AC Q460A0.1
#=GS S4U4J6_9LUTE/1-78     AC S4U4J6.1
#=GS A5A2W9_9LUTE/217-545  AC A5A2W9.1
#=GS Q45ZY5_BYDVP/565-649  AC Q45ZY5.1
#=GS B0FKT6_BYDVP/555-645  AC B0FKT6.1
#=GS B1A452_9LUTE/212-500  AC B1A452.1
#=GS Q8B6K2_9LUTE/9-321    AC Q8B6K2.1
#=GS S4U202_9LUTE/1-76     AC S4U202.1
#=GS A5A2Y6_BYDVP/565-649  AC A5A2Y6.1
#=GS S4U4N7_9LUTE/1-71     AC S4U4N7.1
#=GS F8RUI0_9LUTE/201-418  AC F8RUI0.1
#=GS Q91GX6_BYDVP/366-448  AC Q91GX6.1
#=GS Q17S69_9LUTE/210-502  AC Q17S69.1
#=GS F2X6V5_9LUTE/201-470  AC F2X6V5.1
#=GS A0FLF6_BYDVP/219-572  AC A0FLF6.1
#=GS Q65877_BYDVR/364-448  AC Q65877.1
#=GS A5A2S6_BYDVP/565-649  AC A5A2S6.1
#=GS C7AXW9_BYDVP/38-187   AC C7AXW9.1
#=GS R9S4X7_SIMAS/215-306  AC R9S4X7.1
#=GS Q8V2F5_BLRV/210-518   AC Q8V2F5.1
#=GS I1Z1B7_PLRV/214-698   AC I1Z1B7.1
#=GS Q5UUW8_9LUTE/202-575  AC Q5UUW8.1
#=GS F8RUK4_9LUTE/201-418  AC F8RUK4.1
#=GS S4U4K0_9LUTE/1-75     AC S4U4K0.1
#=GS Q70FV5_9LUTE/2-233    AC Q70FV5.1
#=GS Q9J1A7_9LUTE/219-572  AC Q9J1A7.1
#=GS B0FKW6_BYDVP/208-567  AC B0FKW6.1
#=GS B0FKQ6_BYDVP/203-558  AC B0FKQ6.1
#=GS B0FKU8_BYDVP/203-563  AC B0FKU8.1
#=GS S4U5Q1_9LUTE/1-71     AC S4U5Q1.1
#=GS O92523_9LUTE/18-370   AC O92523.1
#=GS S4U194_9LUTE/1-76     AC S4U194.1
#=GS Q70FV1_9LUTE/2-234    AC Q70FV1.1
#=GS B0FKW6_BYDVP/559-642  AC B0FKW6.1
#=GS S4U208_9LUTE/1-77     AC S4U208.1
#=GS A5A2T2_BYDVP/213-566  AC A5A2T2.1
#=GS A5A2V6_BYDVP/567-649  AC A5A2V6.1
#=GS Q45GB7_9LUTE/208-612  AC Q45GB7.1
#=GS Q2L3I3_9LUTE/201-471  AC Q2L3I3.1
#=GS F8RUG8_9LUTE/201-418  AC F8RUG8.1
#=GS B0FKN2_BYDVP/559-645  AC B0FKN2.1
#=GS B0FKL4_BYDVP/219-570  AC B0FKL4.1
#=GS E0YC38_9LUTE/209-343  AC E0YC38.1
#=GS A7XUE7_9LUTE/212-504  AC A7XUE7.1
#=GS B7TWE0_9LUTE/212-500  AC B7TWE0.1
#=GS A5A316_BYDVP/219-572  AC A5A316.1
#=GS B0FKW0_BYDVP/203-552  AC B0FKW0.1
#=GS F8RUE1_9LUTE/201-471  AC F8RUE1.1
#=GS I1XV15_PLRV/1-106     AC I1XV15.1
#=GS Q7T6J9_9LUTE/2-223    AC Q7T6J9.1
#=GS S4U197_9LUTE/1-76     AC S4U197.1
#=GS B0FKV4_BYDVP/560-645  AC B0FKV4.1
#=GS B0ZT75_9LUTE/206-579  AC B0ZT75.1
#=GS Q7T6K3_9LUTE/2-230    AC Q7T6K3.1
#=GS Q70FV3_9LUTE/2-225    AC Q70FV3.1
#=GS A5A2T2_BYDVP/561-643  AC A5A2T2.1
#=GS A5A2X4_BYDVP/566-650  AC A5A2X4.1
#=GS E5GAB5_9LUTE/211-615  AC E5GAB5.1
#=GS A5A2S6_BYDVP/219-573  AC A5A2S6.1
#=GS R9UH96_9LUTE/205-548  AC R9UH96.1
#=GS Q2L3F9_9LUTE/201-483  AC Q2L3F9.1
#=GS A5A2Y0_BYDVP/219-572  AC A5A2Y0.1
#=GS Q91GX4_BYDVP/18-370   AC Q91GX4.1
#=GS S4U218_9LUTE/1-75     AC S4U218.1
#=GS E0A2S4_9LUTE/1-137    AC E0A2S4.1
#=GS B0FKY4_BYDVP/219-572  AC B0FKY4.1
#=GS A5A2Z8_BYDVP/567-649  AC A5A2Z8.1
#=GS Q8QYP3_PLRV/214-698   AC Q8QYP3.1
#=GS Q8B6K8_9LUTE/11-310   AC Q8B6K8.1
#=GS F8RUL9_9LUTE/201-418  AC F8RUL9.1
#=GS Q84819_PLRV/5-489     AC Q84819.1
#=GS I1XV20_PLRV/214-698   AC I1XV20.1
#=GS B5L2B7_9LUTE/208-612  AC B5L2B7.1
#=GS A5A2W2_BYDVP/567-649  AC A5A2W2.1
#=GS F8RUE7_9LUTE/201-473  AC F8RUE7.1
#=GS A5A2T8_BYDVP/219-570  AC A5A2T8.1
#=GS Q7T6K2_9LUTE/2-236    AC Q7T6K2.1
#=GS Q8QYR0_PLRV/1-106     AC Q8QYR0.1
#=GS B0FKQ0_BYDVP/210-567  AC B0FKQ0.1
#=GS D2K8V5_9LUTE/201-265  AC D2K8V5.1
#=GS Q8B6K0_9LUTE/9-316    AC Q8B6K0.1
#=GS B1A428_9LUTE/212-491  AC B1A428.1
#=GS D4P4V5_9LUTE/201-477  AC D4P4V5.1
#=GS C7AXX2_BYDVP/38-187   AC C7AXX2.1
#=GS Q5I4G6_BYDVP/203-562  AC Q5I4G6.1
#=GS Q19A29_BYDVP/15-242   AC Q19A29.1
#=GS S4U1A1_9LUTE/1-77     AC S4U1A1.1
#=GS B0FKT0_BYDVP/555-645  AC B0FKT0.1
#=GS Q8QYN6_PLRV/214-698   AC Q8QYN6.1
#=GS Q5CC80_BYDVP/564-648  AC Q5CC80.1
#=GS Q8B6L6_9LUTE/9-298    AC Q8B6L6.1
#=GS B0FKR8_BYDVP/203-560  AC B0FKR8.1
#=GS B0FKX2_BYDVP/208-567  AC B0FKX2.1
#=GS O93184_PEMV1/198-468  AC O93184.1
#=GS A5A2V6_BYDVP/219-572  AC A5A2V6.1
#=GS U5LV37_9LUTE/206-579  AC U5LV37.1
#=GS D4P4W7_9LUTE/201-477  AC D4P4W7.1
#=GS F8RUL3_9LUTE/201-418  AC F8RUL3.1
#=GS Q9QQN6_9LUTE/4-274    AC Q9QQN6.1
#=GS L0AN47_PLRV/1-106     AC L0AN47.1
#=GS Q8QYQ6_PLRV/214-698   AC Q8QYQ6.1
#=GS G8Z1X3_9LUTE/209-612  AC G8Z1X3.1
#=GS Q91QP6_9LUTE/11-313   AC Q91QP6.1
#=GS H9NAC9_9LUTE/201-265  AC H9NAC9.1
#=GS K4GSW3_9LUTE/212-504  AC K4GSW3.1
#=GS Q9JH75_9LUTE/4-274    AC Q9JH75.1
#=GS Q9J1A7_9LUTE/565-649  AC Q9J1A7.1
#=GS Q65848_9LUTE/212-567  AC Q65848.1
#=GS B3FGT5_9LUTE/207-502  AC B3FGT5.1
#=GS U5LVB0_9LUTE/206-579  AC U5LVB0.1
#=GS A5A2X4_BYDVP/219-573  AC A5A2X4.1
#=GS Q8B6L0_9LUTE/11-309   AC Q8B6L0.1
#=GS V9PPM1_PLRV/214-698   AC V9PPM1.1
#=GS B0FKS4_BYDVP/556-643  AC B0FKS4.1
#=GS I1XV33_PLRV/1-106     AC I1XV33.1
#=GS Q5I4G6_BYDVP/556-643  AC Q5I4G6.1
#=GS G3E244_9LUTE/1-259    AC G3E244.1
#=GS T1VY69_9LUTE/199-464  AC T1VY69.1
#=GS S4U2K1_9LUTE/1-76     AC S4U2K1.1
#=GS U5LU52_9LUTE/206-580  AC U5LU52.1
#=GS G3E226_9LUTE/1-280    AC G3E226.1
#=GS F8VCF6_9LUTE/210-512  AC F8VCF6.1
#=GS A5A334_BYDVP/219-572  AC A5A334.1
#=GS Q91QQ6_9LUTE/9-307    AC Q91QQ6.1
#=GS F8RUK7_9LUTE/201-418  AC F8RUK7.1
#=GS S4U1A7_9LUTE/1-78     AC S4U1A7.1
#=GS B3GQB0_PLRV/214-698   AC B3GQB0.1
#=GS B0FKX8_BYDVP/567-649  AC B0FKX8.1
#=GS Q45ZZ5_BYDVP/566-649  AC Q45ZZ5.1
#=GS Q9IZG0_BYDVP/219-573  AC Q9IZG0.1
#=GS D2K8X0_9LUTE/201-265  AC D2K8X0.1
#=GS S4U214_9LUTE/1-77     AC S4U214.1
#=GS A5A2U4_BYDVP/566-649  AC A5A2U4.1
#=GS Q7T6K4_9LUTE/2-232    AC Q7T6K4.1
#=GS Q3YB89_9LUTE/212-490  AC Q3YB89.1
#=GS MCAPS_BYDVP/564-649   AC P09516.3
#=GS B0FKR8_BYDVP/557-643  AC B0FKR8.1
#=GS B0FKV4_BYDVP/203-568  AC B0FKV4.1
#=GS S6CRN9_BYDVP/562-649  AC S6CRN9.1
#=GS S4U5P6_9LUTE/1-69     AC S4U5P6.1
#=GS B7TWD4_9LUTE/212-497  AC B7TWD4.1
#=GS Q8B6M0_9LUTE/9-517    AC Q8B6M0.1
#=GS C8CBB0_9LUTE/208-655  AC C8CBB0.1
#=GS W8Q9Y2_BYDVP/21-249   AC W8Q9Y2.1
#=GS B5KLA7_9LUTE/1-373    AC B5KLA7.1
#=GS B0FKK2_BYDVP/557-643  AC B0FKK2.1
#=GS S4U4J3_9LUTE/1-75     AC S4U4J3.1
#=GS A5A2Z2_BYDVP/219-572  AC A5A2Z2.1
#=GS F8RUG5_9LUTE/201-418  AC F8RUG5.1
#=GS B5L2B5_9LUTE/208-612  AC B5L2B5.1
#=GS B0FEU2_PLRV/214-698   AC B0FEU2.1
#=GS S6CRN9_BYDVP/219-571  AC S6CRN9.1
#=GS B0FKN2_BYDVP/212-563  AC B0FKN2.1
#=GS J7FCG7_9LUTE/209-549  AC J7FCG7.1
#=GS F8RUM8_9LUTE/201-418  AC F8RUM8.1
#=GS F8RUH1_9LUTE/201-418  AC F8RUH1.1
#=GS C7AXW8_BYDVP/38-187   AC C7AXW8.1
#=GS F8RUF3_9LUTE/201-470  AC F8RUF3.1
#=GS B1A446_9LUTE/212-504  AC B1A446.1
#=GS Q8B6L8_9LUTE/9-309    AC Q8B6L8.1
#=GS B0FL08_BYDVP/219-571  AC B0FL08.1
#=GS A5A2U4_BYDVP/219-572  AC A5A2U4.1
#=GS A5A2V0_BYDVP/567-649  AC A5A2V0.1
#=GS B1A416_9LUTE/212-500  AC B1A416.1
#=GS Q80FH7_9LUTE/201-471  AC Q80FH7.1
#=GS MCAPS_PLRVW/213-697   AC P11626.3
#=GS F8RUM2_9LUTE/201-418  AC F8RUM2.1
#=GS F8RUI6_9LUTE/201-418  AC F8RUI6.1
#=GS Q84817_PLRV/5-489     AC Q84817.1
#=GS B0FKK8_BYDVP/203-563  AC B0FKK8.1
#=GS E0A2S6_9LUTE/1-137    AC E0A2S6.1
#=GS B0FL08_BYDVP/565-649  AC B0FL08.1
#=GS Q8QYR3_PLRV/214-698   AC Q8QYR3.1
#=GS Q8QYR8_PLRV/214-698   AC Q8QYR8.1
#=GS T1VY64_9LUTE/199-463  AC T1VY64.1
#=GS A5A2W2_BYDVP/219-573  AC A5A2W2.1
#=GS S4U192_9LUTE/1-76     AC S4U192.1
#=GS B0ZT87_9LUTE/206-579  AC B0ZT87.1
#=GS B0FKM6_BYDVP/203-554  AC B0FKM6.1
#=GS B1A443_9LUTE/212-500  AC B1A443.1
#=GS B1A449_9LUTE/212-500  AC B1A449.1
#=GS G1K0U2_9LUTE/210-716  AC G1K0U2.1
#=GS S4U2L1_9LUTE/1-71     AC S4U2L1.1
#=GS B0FKZ0_BYDVP/555-645  AC B0FKZ0.1
G0YSX3_9LUTE/6-456               ............p-PPGP.S.P...P.PSP.S.PPPPV..PSRFW.GY...EGNPQCKILTAENNRNIDSRPLNFVSMYKWEDEKWDKVNLQAGYSRNDRRCMETYFVIPASRGKF.HVYLEADGEFVVKHIGGDCDGNWLGNIAYDVSQ.-RG.WNIGDYKGCRISNYQSNTVFVAGHPD...AEMNGKHFDAARAVEVDWFASFELTCDdEDG.AWRIYPPPIQKDSSYNYTVSYGDYTEKYCEWGAVSVSIDE-DN...STGTKSR....IK-.........P.HK-.GVMMWS.YPEkensEGESESETDQ...GKD..lKTPDA..TT...........---LV...D..FE.SDD..N......S......S.SKSA......E.S....I...P...D......NTDL...-N.PWNAvvssK....S..D.R...PFKQ..EDDrvstssrlsgnlrrpgsgnpqlrsplgrekapepsesDLDAAR..IkglP...PPR.E..Q-LPG-FKPTRSIST.FNPEPDLVEAWRPG-TGPGYSKEDVAAATILAHGSIADGRSMLDKRDQEVLRSRSSWGTG....--------------------.--------.......-------------------------------------------------.----------gflkkmktsssdka........................................................................................................................................................................................................................................
B0FKL4_BYDVP/565-649             ..........edv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPlarqKLREAAKAPTTLLYER-TPK.KSSNILTRylesnrsPTTPAAPSVSTVS------------------NMTREQLAEYTRIRRSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
Q65877_BYDVR/18-370              .............PQPTP.A.P...Q.PAP.E.PTPAP.vPKRFF.EY...IGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAER....ITRha.....etP.IRF.KHILVS.EQY...eQPLPTIIDQC...LCD..vQTPEQ..EQtlv.....deeDKQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LM.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskpvDTSGNK..I...P...KPK.E..P--------------.-----EVLGTYQGQNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppia..................................................................................................................................................................................................................................................
Q6STE1_BYDVP/193-420             .............PQPTP.A.P...Q.PAP.E.PTPAP.iPKRFF.EY...IGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVE---....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------e.....................................................................................................................................................................................................................................................
Q84820_PLRV/5-489                .............SEPGP.S.P...Q.PTP.T.PTPQK..HERFI.AY...VGIPMLTIQARENDDQIILGSLGSQRMKYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNAD.SDY.WNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP.TDG.RFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEHLE...GTGSANR....VRR.........P.PRE.GHTYMA.SPR....EPEGKPVGNK...PRD...ETPIQ..TQ...........ERQPD...Q..TP.SDD..V......S......D.AGSV......N.S....G...G...S......TESL...QL.EFGV....N....S..D.S...TYDA..TVD.....................................GTDWPR..I...P...PPR.H..PPEPRVSGNSRTVTD.FSPKADLLENWDAEHFDPGYSKEDVAAATIIAHGSIQDGRSMLEKREENVKNKTSSWKPP....SPKAVSPAIAKLRSIRKSQP.LEGGTLKK.......DATDGVSSIGSGSLTGGTLKRKATIEERLLQTLTTEQRLWYENLKKTNP.SAATQWLFEY......................................................................................................................................................................................................................................................
B0FKU2_BYDVP/558-645             .......iyaedv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPgtrqKLRDAAKAPSTLLYD-KTPK.RSKSILSR.......FIEGNRSSVESAAPS------TAT-----TSNLTREQLREYTRIRNTLGlTAAKAYKAQF......................................................................................................................................................................................................................................................
B0FKN8_BYDVP/557-643             .......iyaddv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPiarqKLRDAAKAPSTLLYDK--AP.KSKSFLSRfvegnrsKTETTAPSTATTS------------------NLTREQLREYTRIRNTLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
U5LXW1_9LUTE/206-579             .........peptPQPQP.E.P...K.PDP.Q.PTPEP.qHKRFF.EY...VGTPYVIIQTRESSDSIAVKSMNDQSFQYIENETSEQRTVQAWWTSNNGVQAQAAFVFPIPAGEY.SVNISCEGLQSVDHIAGNRDGYWIGLIAYQNQS.GDY.WGVGNYAGCDITNLLGTNTWRPGHED...LELNGCKFTNGQIVERDAVISFHVKAQgADP.KFYLMAPKTMKSDKYNYVVSYGGYTDKRMEFGSISVTVD---E...SDVEAQR....YNRhtst.vrktE.NRDyGWMSVL.PPY....DPNQVPEQEE...EQP...MVDKE..MD...........SRSPV...E..PP.SPT..S......-......D.TEAE......R.AfdlrE...E...E......LTRA...RL.EYEA....A....T..E.S...IPDA..APD.....................................-----I..L...P...SKS.E..MSSRPIDHDGRSLPK.PQSK-EVLGTYQGQNITP----DDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppviae................................................................................................................................................................................................................................................
D7EZI4_9LUTE/207-610             ............ePSPSP.G.P...S.PSP.Q.PTPQK..KYRFI.VY...TGVPVTRIMAQSTDDAISLYDMPSQRFRYIEDENMNWTNLDSRWYSQTSLKAVPMIIVPVPQGEW.TVEISMEGYQPTSSTTDPNKDKQDGLIAYNDDF.KEG.WNVGVYNNVEITNNKADNTLKYGHPD...MELNGCHFNQGQCLERDGDLTCHLKTTgDNA.SFFIVGPAVQKQSKYNYAVSYGAWTDRMMEIGMIAIALDEQ--...GSSGSAK....IKR.........P.KRA.GHSMAV.STC....ETISFPKNEN...FEE...SNTSQ..RQ...........DFNTP...L..TH.GEG..S......-......D.NLEV......G.V....G...GlplP......VENI...-P.DFDG....DdpwsN..I.S...TRKP..QEDe...................................aMTSKSG..F...K...PQL.K..PPGLPRPQPVRTIRN.FNPEPDLVEAWRP-DVNPGYSKEDVAAATVMYGGSVHEGRSMLAKRDQAVLDGRKSW---....--------------------.--------.......-------------------------------------------------.----------gss...................................................................................................................................................................................................................................................
B2BJG5_9LUTE/213-556             .............PSPGP.Q.P...Q.PTP.S.PSPQK..HERFI.AY...VGIPMLTIQARENDDQILLRSMGLQRMKYIEDENQNYTNIDSQFYSQSNVNAVPMYYFNVPKGTW.SVDISCEGYQPTSSTTDPNRGRSDGLIAYSNSD.SDY.WNVGEADGVKISNLRNDNTYRXGHPD...LEINSCHFRDGQLLERDATISFHVEAP.DDG.RFFLIGPAIQKTAKYNYTISYGEWTDRDMELGLITVVLDEHLE...GSGSGNL....ARR.........E.RRS.LHQHCK.SLY....APEGPP-ENK...PWD...DNQII..VG...........ERQLR...K..TL.SMD..M......S......E.AGSD......L.R....E...G...K......LES-...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------npsgdardelnytlnlsdsedelidepnfvpgmrmnleavplanpadkdyil..................................................................................................................................................................................................
A5A316_BYDVP/567-649             ............v-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPiarqKLREAANAPSTLLYER-TPK.KGNNFLTRfleanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
B0FKR2_BYDVP/208-562             ........ptpap-APQP.A.P...Q.PAP.E.PTPAP.vPKRFF.EY...IGTPMGVISTRENTDSISVSQLGGQSMQYIENEKCETRTIDSFWSTNNNVAAQAAFVYPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGIIAYSNSS.DDN.WGIGNYRGCSFKNYLATNTWRPGHKD...LKLNDCQFTGGQIVERDSIISFHVEATgADA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEALR....TTRhs.....ecP.TRV.NNILID.EGY...cQPLSTITDQG...LCD..vQTPGQ..DQev......veeDRQTV...S..TE.SDT..A......-......-.----......-.-....-...-...-......----...LK.EYEV....A....T..A.E...IPDA..EEDalpsre........................qlssrpvDTSGEE..I...P...KPR.P..PS-NE----------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------vlgvyqgqpiyaedvp......................................................................................................................................................................................................................................
I1Z183_PLRV/214-698              .............SEPGP.S.P...Q.PTP.T.PTPQK..HERFI.AY...VGIPMLTIQARENDDQIILGSLGSQGMKYIEDENQNYTNISSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNAD.SDY.WNVGEADGVKISKLRNDNTYRQGHPD...LEINSCHFREGQLLERDATISFHVEAP.TDG.RFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEHLE...GTGSANR....VRR.........P.LRE.GHTYMA.SPR....EPEGKPVGNK...PRD...ETPIQ..TQ...........ERQPD...Q..TP.SDD..V......S......D.AGSV......D.S....G...G...S......TESL...QL.EFGA....N....S..D.S...TYDA..TVD.....................................GTDWPR..I...P...PPR.H..PPEPRVSGNSRTVTD.FSPKADLLENWDAEHFDPGYSKEDVAAATIIAHGSIQDGRSMLEKREENVKNKTSSWKPP....LPKAVSPAIAKLRSLRKSQP.LEGGTLKK.......DATDGVSSIGSGSLTGGTLKRKVTIEERLLQTLTTEQRLWYENLKKTNP.QAATQWLFEY......................................................................................................................................................................................................................................................
H9NAD4_9LUTE/201-265             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDES-------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------wsieql................................................................................................................................................................................................................................................
K4GSV7_9LUTE/212-504             .............PDPTP.P.P...A.PPP.E.QTPAK..HERFI.VY...TGTMSTLISARQNSDSISLYSIRDQRIRYIEDENANWTNIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQ.NKV.WNIGVQNNVTITNNKADADWKYGHPD...LTINGERFDQKQVVEKDGTISFHLVTTgPNA.SFFLAGPAVKKTAKYNFCISYGAWTDRDMEFGLVSVVLDEHLE...GVRGSQY....VRK.........T.LRP.GHVSVN.RSH....R---------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------lqdcftpveyvsdedsssssssivsnrpstpdhdsdaqfaeslr..........................................................................................................................................................................................................
B1A431_9LUTE/212-500             .............PDPTP.P.P...A.PPP.E.PTPAK..HERFI.VY...TGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQ.TKV.WNIGVQNNVTISNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTgPNA.SFFLAGPAVKKIAKYNYCISYGAWTDRDMEFGMVSVVLDEHLE...GVRGSQY....IRK.........T.LRP.GHISVN.RTH....RL--------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------qemppmredfseednsssdsntyktdnspltvhlvkagd...............................................................................................................................................................................................................
Q7T6K7_9LUTE/2-223               .........tmyl-----.-.-...-.---.-.-----..-----.--...-----------------------------WKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCSISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSHANFTDKILEWGSISVAIDEVND...GAYS---....--R.........S.K--.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------wdkttamsarlptqvsapsevytpeapeqptnegtesmppap............................................................................................................................................................................................................
F8RUH4_9LUTE/201-418             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNREHAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVA------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------i.....................................................................................................................................................................................................................................................
K4GUL7_9LUTE/212-504             .............PDPTP.P.P...A.PPP.E.PTPAK..HERFI.VY...TGTMSTLISARQNSDSISLYSIRDQRIRYIEDENANWTNIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQ.NKV.WNIGVQNNVTITNNKADADWKYGHPD...LTINGERFDQKQVVEKDGTISFHLVTTgPNA.SFFLAGPAVKKTAKYNFCISYGAWTDRDMEFGLVSVVLDEHLE...GVRGSQY....VRK.........T.LRP.GHVSVN.RSH....R---------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------lqdcftpveyvsdedsssssssivsnrpstpdhdsdaqfaeslr..........................................................................................................................................................................................................
F8RUG2_9LUTE/201-418             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKYF.GY...HGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVPYANFTVKILEWGSISVA------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------i.....................................................................................................................................................................................................................................................
D3JXR4_9LUTE/201-470             ...........ap--PTP.T.P...Q.PTPpA.PAPAP..APKYF.GY...QGVPNNIIKTRGNSEYLDVGQLDSVTMYFWKDESWSIEKLSAGYRVNTRDRAIPYLLIPVEKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFIC-DNVN.LQG.WRAYAYTGCSISNYKTADSNVLGHPD...MRVNNCSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSCANFTEKIMEWGSVSIAIDEVND...GAYSGS-....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------kwdkttalrarlrnqvsapsevytpvalessadegtgstpl.............................................................................................................................................................................................................
C7AXW5_BYDVP/38-187              .............PQPTP.A.P...Q.PAP.E.PTPAP.vPKRFF.EY...IGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGH--...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------......................................................................................................................................................................................................................................................
F8RUC3_9LUTE/201-476             ...........ap--PTP.T.P...T.PTPpA.PTPAP..ASKYL.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNNGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVND...GA-----....YSR.........S.KWD.KTTAMS.ARL....PTQVSAPSEV...YTP...ETPEQ..PA...........N----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------egtesmppapnpal........................................................................................................................................................................................................................................
Q87035_9LUTE/9-314               ...........pgPDPAP.Q.P...T.PTP.K.PTPAK..HERFI.AY...TGTLSTLISARQSSDSISLYSIRNQRIRYIEDENSSWTNIDAKWYSQNSVEAIPMFVYPVPEGTW.SIEISCEGYQAASSTSDPHRGKCDGMIAYDDDS.SKV.WNVGQQNNVTITNNKADNDWKYGHPDpldLMINGDRFDQNQVVEKDGIISFHLVTTgPNA.SFFLVAPAVKKTAKYNFCVSYGDWTDRDMEFGMVSVVLDEHLE...GARSSQY....VRK.........S.PRP.GHFGVN.RSHr..lQDSFTPVEYV...SDD...DSS--..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------ssssivsnrpstpdndsdiqfanslkgklpsqtkl...................................................................................................................................................................................................................
S4U2K4_9LUTE/1-69                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....-------APSTLLYE-KTSK.KSNNFLTRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRRSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
C7AXW4_BYDVP/38-187              .............PQPTP.A.P...Q.PAP.E.PTPAS.vPKRFF.EY...IGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQSAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNVLATNTWRPGH--...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------......................................................................................................................................................................................................................................................
B7TWC5_9LUTE/212-501             .............PDPTP.P.P...A.PPP.E.PTPAK..HERFI.VY...TGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQ.NKV.WNVGVQNNVTISNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTgPNA.SFFLVGPPVKKIAKYNYCISYGAWTDRDMEFGMVSVVLDEHLE...GVRGSQY....VRK.........T.LRP.GHISVN.RSH....RLQ-------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------empptredfseedssssdsntyktdnspltvhlvkagde...............................................................................................................................................................................................................
M4GJX8_9LUTE/201-468             ...........ap--PTP.T.P...Q.PTPpA.PAPAP..APKYF.GY...QGVPNNIIKTRGNSEYLDVGQLDSVTMYLWKDESWSIEQLPAGYRVNTQDRAIPYLLIPVEKGKY.SVFIQCEGFKAVKAKGGTNNGKMSGFIC-DNIN.LQG.WRAYAYSGCSISNYKTADSNVPGHPD...MRVNNCSFTD-QLVERDFSCSFHLEVP.QKG.YFGLEAPPIEKSDHFNFVVSYANFTEKTMEWGSVSIAIDEVSD...GAYSG--....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------skwdkttamsarlrdlvsapsevytpvalvssadegtest..............................................................................................................................................................................................................
A5A2Z2_BYDVP/565-649             ..........edv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPiarqKLREAANAPSTLLYE-KTPK.KSNNFLTRfveanrsPTTPAAPSVSTVS------------------NMTREQLAEYTRIRRSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
K4GPY1_9LUTE/212-504             .............PDPTP.P.P...A.PPP.E.PTPAK..HERFI.VY...TGTMSTLISARQNSDSISLYSIRDQRIRYIEDENANWTNIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQ.NKV.WNIGVQNNVTITNNKADADWKYGHPD...LTINGERFDQKQVVEKDGTISFHLVTTgPNA.SFFLAGPAVKKTAKYNFCISYGAWTDRDMEFGLVSVVLDEHLE...GVRGSQY....VRK.........T.LRP.GHVSVN.RSH....R---------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------lqdcftpveyvsdedsssssssivsnrpstpdhdsdaqfaeslr..........................................................................................................................................................................................................
Q91AV3_9LUTE/1-374               ...........ma-----.-.-...-.---.-.-----..-----.--...----------QSTDDAISLYDMPSQRFRYIEDENMNWTNLNSRWYSQNNLKAIPMIIVPVPQGEW.TVEISMEGYQPTSSTTDPNKDKQDGLIAYNDDL.NEG.WNVGIYNNVEITNNKADNTLKYGHPD...MELNNCHFNQGQCLERDGDLTCHVKTTgDNA.SFFIVGPAVQKQSKYNYAVSYGAWTDRMMEIGMIAIALDE--Q...GSSGSTR....TQR.........P.KRA.GHSMAV.STW....ETINYPEKEN...SEI...TETSQ..--...........-RQDF...K..TP.LHI..Se....gS......D.PLEV......G.E....G...GvplP......VDEN...IP.DFV-....-....-..-.-...----..-GDdpwfkis......................trkpqeeeAMSQSS..V...L...KPQlK..PPGLPRPQPVRTIRD.FDPKPDLVEAWRP-DVNPGYSKEDVAAATVMYGGSVHEGRSMIDKRDKAVLNGRKRW---....--------------------.--------.......-------------------------------------------------.----------gssla.................................................................................................................................................................................................................................................
B0ZT93_9LUTE/206-580             .........peptPQPQP.E.P...K.PDP.Q.PTPEP.qHKRFF.EY...VGTPYVIIQTRESSDSIAVKSMNDQSFQYIENETSEQRTVQAWWTSNNGVQAQAAFVFPIPAGEY.SVNISCEGLQSVDHIGGNRDGYWIGLIAYQNQS.GDY.WGVGNYAGCDITNLLGTNTWRPGHED...LELNGCKFTNGQIVERDAVISFHVKAQgADP.KFYLMAPKTIKSDKYNYVVSYGGYTDKRMEFGSISVTVD---E...SDVEAQR....YNRhtst.vrktE.NRDyGWMSVL.PPY....DPNQVPEQEE...EQP...MVDKE..MY...........SRSPV...E..PP.SPT..S......-......D.TEAE......R.AfdlrE...E...E......LTRA...RL.EYEA....A....T..E.S...IPDA..APD.....................................-----I..L...P...SKS.E..MSSRPIDHDGRSLPK.PQSK-EVLGTYQGQNITP----DDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppviaek...............................................................................................................................................................................................................................................
I1XV24_PLRV/1-106                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.-----------------------------------------MLEKREESVKNKTSSWKLP....LPEAVSPAIAKLRSIRKSQP.LEGGTLKK.......DTTDGVSSIGSGSLTGGTLKRKATIEERLLQTLTTEQRLWYENLKKTDP.PAATQWMFEY......................................................................................................................................................................................................................................................
J7FCV1_9LUTE/209-614             ...........pg--PSP.A.PpppP.PPP.Q.PQPQP.cAQRFW.GY...EGNPQNKILTAENSRNIDSRPLNFVQMYKWEDEKWEKVNLQAGYSRNDRRCMETYLTIPADKGKF.HVYLEADGEFVVKHIGGELDGSWLGNIAYDVSQ.-RG.WNIGNYKGCKIKNYQSNTTFVAGHPD...ASMNGKNFDAARAVEVDWFASFELECDdEEG.SWAIYPPPIQKDSSYNYTVSYGNYTEKYCEWGAISVSIDE--D...NNGSAP-....-RR.........I.PRK.GAMAWS.FPE....SDFSGDMSQR...QDV...KTPPQ..S-...........ERGSD...D..LA.SEE..K......-......-.----......-.-....-...K...E......EENL...LD.ELE-....-....-..E.S...IPDT..DEDfwkgiplgs..................taattegdraSTSS-R..L...R...GNL.K..PPGLPKPQPTRTITD.FKPNPDLVEAWRP-DLAPTYSKADVAAATVIAGGSVHEGREHLKRRDDAVMDSRKKWGPL....--------------------.--------.......-------------------------------------------------.----------stvs..................................................................................................................................................................................................................................................
B5L2B9_9LUTE/207-612             ...........ep-GPSP.G.P...S.PSP.Q.PAPSK..KYRFI.VY...TGVPVTRIMAQSTDDAISLYDMPSQRFRYIEDENMNWTNLDSRWYSQNSLKAIPMIIVPVPQGEW.TVEISMEGYQPTSSTTDPNKDKQDGLIAYNDDL.KEG.WNVGVYNNVEITNNKADNTLKYGHPD...MELNSCHFNQGQCLERDGDLTCHVKTTgDNA.SFFVVGPAVQKQSKYNYAVSYGAWTDRMMEIGMIAIALDEQ--...GSSGSAK....IER.........P.KRV.GHSMAV.STW....ETINLPEKEN...SEE...FKTDQ..RQ...........DLKTH...P..AA.GGS..-......S......D.MLDI......V.Q....G...G...L......P--L...PV.E---....-....-..E.D...IPDS..IMDdpwsnipa.....................kssqedeaMTSKSG..F...K...PQL.K..PPGLPRPQPVRTIRN.FDPEPDLVEAWRP-DVNPGYSKEDVAAATVMYGGSVKEGRSMIDKRDKAVLDGRKSW---....--------------------.--------.......-------------------------------------------------.----------gssl..................................................................................................................................................................................................................................................
S0ER74_9LUTE/199-466             .........spps--PEP.S.P...E.PPP.QpPAPTP.aRCRFW.GY...EGIPSVSVSSAENDRDVEVRALSTIDLYKFEDENWSTVHLRAGYSTNDRVHAQPYIVFPIEKGEF.DVYIECEGFQAVKSIGGKADGSWEGLIAYSTSD.S-G.WLVSEYVGVSITKYQSSTAFVGGHPD...TRLNDCSFKQDRAVECDIVCSFRLSADsDNA.KWLLYAPWIQKASEYNYIVSYGAYTEKICELGSISVNIDEVNE...QQGPSPA....S--.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------krwgrrrldrerqlvktlvnqpssdleeaket......................................................................................................................................................................................................................
Q84824_PLRV/5-489                .............SEPGP.S.P...Q.PTP.T.PTPQK..HERFI.AY...VGIPMLTIQARENDDQIILGSLGSQRMKYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNAD.SDY.WNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP.TDG.RFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEHLE...GTGSANR....VRR.........P.PRE.GHTYMA.SPR....EPEGKPVGNK...PRD...ETPIQ..TQ...........ERQPD...Q..TP.SDD..V......S......D.AGSV......N.G....G...G...S......TESL...QL.EFGI....N....S..D.S...TYDA..TVD.....................................GTDWPK..I...P...PPR.H..PPEPRVSGNSRTVTD.FSPKADLLENWDAEHFDPGYSKEDVAAATIIAHGSIQDGRSMLEKREENVKNKTSSWKPP....SPNAVSPAIAKLRSIRKSQP.LEGGTLKK.......DATDGVSSIGSGSLTGGTLKRKATIEERLLQTLTTEQRLWYENLKKTNP.SAATQWLFEY......................................................................................................................................................................................................................................................
A5A304_BYDVP/219-573             .............PQPTP.A.P...Q.PSP.E.PTPAP.vPKRFF.EY...IGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAER....ITRha.....etP.IRS.KHILVS.EQY...eQPLPTIIDQG...LCD..vQTPEQ..EQtlv.....deeDKQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LM.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskpmDTSGNK..I...P...KPK.E..P--------------.-----EVLGTYQGQNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppiarq................................................................................................................................................................................................................................................
L0ANF1_PLRV/1-226                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...--D...ETPMQ..TQ...........ERRPD...Q..TP.SDD..V......S......D.AGSE......K.S....G...G...S......TESL...RL.EFGA....N....Y..D.S...TYDA..TVD.....................................GTDWPR..I...P...PPR.H..PPEPRVSGNSRTVTD.FSPKADLLENWDAEHFDPGYSKEDVAAATIIAHGSIQDGRSMLEKREENVKNKTSSWKPP....LSKAVSPAIAKLRSIRKSQP.LEGGTLKK.......DATDGVSSIGSGSLTGGTLKRKVTIEERLLQTLTTEQRLWYENLKKTNP.PASTQWLFEY......................................................................................................................................................................................................................................................
Q99GS4_PLRV/5-489                .............SEPGP.S.P...Q.PTP.T.PTPQK..HERFI.AY...VGIPMLTIQARENDDQIILGSLGNQRMKYIEDENRSYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNAD.SDY.WNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISLHVEAP.TDG.RFFLVGPAVQKTAKYNYTISYGDWTDRDMELGLITVVLDEHLE...GTDSANR....VRR.........P.PRE.GHTYMA.SPR....EPEGKPVGNK...PRD...ETPIQ..TQ...........ERQPD...Q..TP.SDD..V......S......D.AGSV......N.S....G...G...S......TESL...RL.EFGV....N....S..D.S...TYDA..TVD.....................................GTDWPR..I...P...PPR.H..PPEPRVSGNSRTVTD.FSPETDLLENWDAKHFDPGYSKEDVAAATIIAHGSIQDGRSMLEKREENVKNKTSSWKPP....LSKAVSPAIAKLRSIRKSQP.LEGGTLNK.......DATDGVSSIGSGSLTGGTLKRKVTIEDRLLQTLTTEQRLWFENLKKTNP.PAATQWLYEY......................................................................................................................................................................................................................................................
Q65849_BYDVP/366-448             ............v-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPiarqKLREAANAPSTLLYER-TPK.KSSNFLTRfveanrsPTTPAAPTVSTAS------------------NMTREQLAEYTRIRRSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
W8Q8Z8_BYDVP/21-249              .............PEPTP.A.P...Q.PTP.E.PTPAP.aPKRFF.EY...VGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVTDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYRGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgNDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAE-....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------......................................................................................................................................................................................................................................................
B0FKK8_BYDVP/557-645             ......piyaddv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPgtrqKLRDAAKAPSTLLYD-KTPK.RSKSILSR.......FIEGNRSSVESAAP------PTAT-----TSNLTREQLREYTRIRNTLGlTAAKEYKAR-l.....................................................................................................................................................................................................................................................
Q8QHP7_PLRV/1-106                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.-----------------------------------------MLEKREENVKNKTSSWKPP....LPKAVSPAIAKLRSIRKSQP.LEGGTLKK.......DATDGVSSIGSGSLTGGTLKRKVTIEERLLQTLTTEQRLWYENLKKTNP.PAAIQWLHEY......................................................................................................................................................................................................................................................
Q65872_BYDV1/6-374               .........pepsPQPQP.E.P...K.PDP.Q.PTPEP.rQKRFF.EY...VGTPYVVIQTRESSDSIAVKAMNDQSFQYIENETSEQRTVKAWWNSNNSVQAQAAFIFPIPAGEY.SVNISCEGLQSVDHIGGNRDGYWIGLIAYQSQS.GDY.WGVGNYVGCDITNLLGTNTWRPGHED...LELNSCKFTDGQIVERDAVISFHVKARgADP.KFYLMAPKTMKADKYNYVVSYGGYTDKRMEFGTISVTVD---E...SDVEAER....YSRhtst.vrrtE.NRDyGWMNVL.PPY....NPDQVPEQ--...-ED...EQPVV..DKemd.....agsPIDTA...S..LT.SDT..E......A......EkAFDL......K.E....E...E...L......T-RA...IL.EYEA....A....T..V.S...IPDA..APD.....................................-----I..L...P...SKS.E..MSSKPIDRDGRSLPK.-SQTKEVLGTYQGQNITS------------------------------------------....--------------------.--------.......-------------------------------------------------.----------ddvp..................................................................................................................................................................................................................................................
Q2L3I9_9LUTE/201-471             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFP-CDNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAMDEVND...GAYS---....--R.........S.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------kwdkttamsarlptqvsapsevytpeapeqptnegtesmppa............................................................................................................................................................................................................
B3FHC0_9LUTE/227-595             ........apsps-PPSP.T.P...A.PTP.A.PTPQ-..PERFF.VY...AGVPGVDIQTRETDDSIIVGRLNSERLRYVEDEQQTLVDIRADWYSNNSVEAVPMLLFDLEEGSW.SVDAECQGYQAVTAVGGSEDSNWLGFIAYNNAN.GAT.WNVGEYNNVKITKLLNTSSWKKGHKD...VVLNGCHFNDGQIIERDSTMSFHCEVGhGGG.TILLVAPPVCKSDKYNYVVSYGEYTTKHMEFGSIAICFDEKND...GARAGKF....LGA.........PfPRA.GHVVRE.QQT....EIARFPAGSD...VPI...-VKIS..DN...........DFATS...T..QPaAHI..L......P......V.PSSV......Q.L....P..dD...P.....vSKKV...RS.WIEN....S....S..E.DlrlAREA..EQT.....................................DSDWEP..L...P...PPA.P..PPGPRQLPTDT----.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------sgatqairnqilrdhtqpysgpgtp.............................................................................................................................................................................................................................
Q7T6K1_9LUTE/2-237               .........tmyl-----.-.-...-.---.-.-----..-----.--...-----------------------------WKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGRY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTVSNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSHANFTDKIMEWGSISVAVDEVND...G-----A....YSR.........S.KWD.KTTAMS.ARL....PTQVSAPSEV...FNP...ETPEE..SK...........NEGTE...S..TP.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------papnpalgpdnpatkep.....................................................................................................................................................................................................................................
B0ZT81_9LUTE/206-579             .........peptPQPQP.E.P...K.PDP.Q.PTPKP.qHKRFF.EY...VGTPYAIIQTRESSDSIAVKSMNDQSFQYIENETSEQRTVQAWWTSNNGVQAQAAFVFPIPAGEY.SVNISCEGLQSVDHIGGNRDGYWIGLIAYQNQS.GDY.WGVGNYAGCDITNLLGTNTWRPGHED...LELNGCKFTNGQIVERDAVISFHVKAQgADP.KFYLMAPKTMKSDKYNYVVSYGGYTDKRMEFGSISVTVD---E...SDVEAQR....YNRhtst.vrktE.NRDyGWMSVL.PPY....DPNQMPEQEE...EQP...MVDKE..MD...........PRSPV...E..PP.SPT..S......Y......T.EAER......A.F....DlreE...E......LTRA...RL.EYEA....A....T..G.S...IPDA..APD.....................................-----I..L...P...SKS.E..MSSRPIDHDGRSLPK.PQSK-EVLGTYQGQNITP----DDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppviae................................................................................................................................................................................................................................................
B1A419_9LUTE/212-490             .............PDPTP.P.P...A.PPP.E.PTPAK..HERFI.VY...TGTLSTLISARQNSDSISLYPIRDQRVRYIEDENANWAYIKAQWYSQNSVEAVPMFIYPVPQGTW.SVEISCEGYQATSSTTDPHRGKSDGMIAYDDDQ.TKV.WNVGLQNNVTITNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTgPNA.SFFLAGPAVKKIAKYNFCISYGAWTDRDMEFGLVSVVLDEHLE...GVRGSQY....VRK.........T.LRP.GHISVN.RPH....R---------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------lqimpptreddsdgyssssdsntyktdnsp........................................................................................................................................................................................................................
K9Y3B7_9LUTE/208-573             ............p-GPSP.G.P...S.PSP.Q.PTPQK..KYRFI.VY...TGVPVTRIMAQSTDDAISLYDMPTQRFRYIEDENMNWTNLDSRWYSQNNLKAIPMIIIPVPQGEW.TVEISMEGYQPTSSTTDPNKDKQDGLIAYNDDL.NEG.WNVGIYNNVEITNNKADNTLKYGHPD...MELNSCHFNQGQCLERDGDLTCHVTTTgDNA.SIFIVGPAVQKQSKYNYAVSYGAWTDRMMEIGMIAVALDE-QG...SSGSAKK....VKR.........P.KRA.GHSMAV.STW....ETINSPEKEN...SEQ...LETSQ..RQ...........D---F...K..TP.LMV..Vg....sS......D.KLDV......E.E....G...G...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------lplpaeedipdfigndpwfnistkepqeeeamssrsglrpqlkppglpkpqpvrtirsfdptpdlveawrpnvnpgpd........................................................................................................................................................................
F8RUD5_9LUTE/201-469             ...........ap--PTP.T.P...Q.PTPpA.PAPAP..APKYF.GY...QGVPNNTIRTRGNSEYLDVGQLDSVTMYLWKDESWSIEQLPAGYRVNTQDRAIPYLLIPVEKGKY.SVFIQCEGFKAVKAKGGTNNGKMSGFIC-DNIN.LQG.WRAYAYSGCSISNYKTADSNVPGHPD...MRVNNCSFTD-QLVERDFSCSFHLEVP.QKG.YFGLEAPPIEKSDHFNFVVSYANFTEKTMEWGSVSIAIDEVSD...GAYSG--....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------skwdkttamsarlrdlvsapsevytpvalvssadegtgntp.............................................................................................................................................................................................................
Q65846_9LUTE/210-568             ............p-TPTP.Q.P...Q.PFP.Q.PQPEP.aKPRFYaNY...SGTPTVNISTRETSDSIAVKRLGAQTLMYNSDDVHENRQIKSWWYSDNNVESQAAFVFPVPEGEY.SIQITAEGLQSVDHIGGNYDGYWIGLIAYGNDI.SDN.WGIGVYDKCSITDLINTASWRPGHKD...MELNGCKFSD-QVVERDAIISFKIHAQ.KGA.SFYLVAPRTKKADKYNYVVSYGGYTEKRMEFGTISVTIDERND...EARSQWH....TLQ.........P.FKP.GLLEIS.HKR...aTPLSTFVPVP...DTN..fERNED..TNppvsvsspeleVNLNL...E..DI.SHE..L......T......E.RGRE......P.T....P...D...P......QDDLa.kRLeEYEK....A....T..S.E...VPDFalTQD.....................................DEEIPS..Is.lA...PPK.P..PGLPK----------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------spepastyrp............................................................................................................................................................................................................................................
M4GJX1_9LUTE/201-456             ...........ap--PTP.T.P...Q.PTPpA.PAPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGQLDSVTMYLWKDESWSIEQLPAGYRVNTQDRAIPYLLIPVEKGKY.SVFIQCEGFKAVKAKGGTNNGKMSGFIC-DNIN.LQG.WRAYAYSGCSISNYKTADSNVPGHPD...MRVNNCSFTD-QLVERDFSCSFHLEVP.QKG.YFGLEAPPIERSDHFNFVVSYANFTEKTMEWGSVSIAIDEVSD...GAYS---....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------gskwdkttamsarlrdlvsapseiytpva.........................................................................................................................................................................................................................
B1A425_9LUTE/212-499             .............PDPTP.P.P...A.PPP.E.PTPAK..HERFI.VY...TGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQ.NKV.WNVGVQNNVTISNNKADADWKYGHPN...LTINGERFDQNQVVEKDGTVSFHLVTTgPNA.SFFLVGPPVKKIAKYNYCISYGAWTDRDMEFGMVSVVLDEHLE...GVRGSQY....VRK.........T.LRP.GHISVN.RSH....R---------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------lqemppmredfseedssssdxntyktdnspltvhlvkag...............................................................................................................................................................................................................
D2K8V0_9LUTE/201-265             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDES-------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------wsieql................................................................................................................................................................................................................................................
Q8B6L2_9LUTE/9-312               ...........pgPDPAP.Q.P...T.PTP.E.PTPAK..HERFI.AY...TGTLSTLISARQSSDSISLYSIRSQRIRYIEDENSSWTNIDAKWYSQNSVEAIPMFVYPVPEGTW.SIEISCEGYQAASSTSDPHRGKCDGMIAYDDDS.SKV.WNVGQQNNVTITNNKADNDWKYGHPD...LTINGDKFDQNQVVEKDGIISFHLVTTgPNA.SFFLVAPAVKKTAKYNFCVSYGDWTDRDMEFGMVSVVLDEHLE...GARSSQY....VRK.........T.PRS.GHVGVN.RSHr..lQDSSTPVEY-...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------vsdedssssnssivsnrpsapdndseaqfaeslkgklptqskl...........................................................................................................................................................................................................
B7TWC8_9LUTE/212-502             .............PDPTP.P.P...A.PPP.E.PTPAK..HERFI.VY...TGTMSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKSQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQ.NKV.WNVGVQNNVTISNNKADADWKYGHPN...LTINGERFDQNQVVEKDGTVSFHLVTTgPNA.SFFLVGPPVKKIAKYNYCISYGAWTDRDMEFGMVSVVLDEHLE...GVRGSQY....VRK.........T.LRP.GHISVN.RSH....R---------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------lqemppmredfseedssssndntyetdnspltihlvkagdee............................................................................................................................................................................................................
M4GJY1_9LUTE/201-469             ...........ap--PTP.T.P...Q.PTPpA.PAPAP..APKYF.GY...QGVPNNIIRTRGNSEYLDVGQLDSVTMYLWQDESWSIEQLPAGFRVNTQDRAIPYLLIPVEKGKY.SVFIQCEGFKAVKAEGGTNNGKMSGFIC-DNTN.LQG.WRAYAYSGCSISKYKTADSIVPGHPD...MRVNNCSFTD-QLVERDFSCSFHLEVP.QKG.YFGLEAPPIEKSDHFNFVVSSANFTEKTMEWGSVSIAIDEVSD...GAYSG--....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------skwdkttamsarlrdlvsapsevytpvalvssadegtestp.............................................................................................................................................................................................................
B0ZT69_9LUTE/206-579             .........peptPQPQP.E.P...K.PDP.Q.PTPEP.qHKRFF.EY...VGTPYVIIQTRESSDSIAVKSMNDQSFQYIENETSEQRTVQAWWTSNNGVQAQAAFVFPIPAGEY.SVNISCEGLQSVDHIGGNRDGYWIGLIAYQNQS.GDY.WGVGNYAGCDITNLLGTNTWRPGHED...LELNGCKFTNGQIVERDAVISFHVKAQgADP.KFYLMAPKTMKSDKYNYVVSYGGYTDKRMEFGSISVTVD---E...SDVEAQR....YNRhtst.vrktE.NRDyGWMSVL.PPY....DPNQVPEQEE...EQP...MVDKE..MY...........SRSPV...E..PP.SPT..S......-......D.TEAE......R.AfdfrE...E...E......LTRA...RL.EYEA....A....T..E.S...IPGA..APD.....................................-----I..L...P...SKS.E..MSSRPIDHDGRSLPK.PQSK-EVLGTYQGQNITP----DDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppviae................................................................................................................................................................................................................................................
B0FKU8_BYDVP/556-645             .....qtiyaddv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPgtrqKLRDAAKAPSTLLYD-KTPK.RSKSILSR.......FLEGNRSSVESAAPS------TAT-----TSNLTREQLREYTRIRNTLGlTAAKEYKAR-l.....................................................................................................................................................................................................................................................
Q7T6L0_9LUTE/2-231               .........tmyl-----.-.-...-.---.-.-----..-----.--...-----------------------------WKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAAKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNDPGHPD...MKVNGGSITD-QLVERDFSCSLHLEVP.QQG.YFGLEAPPIEKSDHFNLVVSYANFTDKILEWGSISVAIDEVND...GA-----....YSR.........S.KWD.KTAAMS.ARL....PTQVSALSEV...YTP...ETPEQ..PT...........DEGTE...S..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------mppapnpalgpdn.........................................................................................................................................................................................................................................
B0FKM0_BYDVP/203-559             .sstpepkptpap-TPPP.Q.P...E.PKP.E.PTPAP.pPKRFF.EY...VGTPTGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVQASgKDA.CFYIMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEALR....MSRhs.....esP.TRV.NNILID.EGY...hQTLSPIQNLG...LCD..vQTPGQ..DEve.......edDKQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LQ.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskpvDTSGEV..I...P...KPP.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------pkdneilgvyqgqpiys.....................................................................................................................................................................................................................................
Q9IZF4_9LUTE/210-538             ...pgpspgpspd---PP.P.P...S.PSP.E.PAPAK..EERFI.VY...SGVAHTVITAQGTDDSIIVKDIPDQRFRYVENENFYWFQIAAQWYSNTNTKAVPMFVFPVPIGEW.SVEISTEGYQATSSMTDPNKGRIDGLIAYDNSN.-EG.WNIGAGSNVTITNNKADNSWKYGHPD...LEINSCHFNQNQVLEKDGLISFHIKATeKEA.NFFLVAPPVQKTSKYNYAVSYGAWTDRDMEFGLISVTLD---E...KRSSGSP....TRK.........S.LRA.GHTQVA.STT....D----LVASP...EKD...NSGIQ..TS...........ETPAV...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------pvtsskapipmvsdseseddplsaapdvgfggtrllldtdiqtvpnpevaeaflnsa.............................................................................................................................................................................................
Q7T6J5_9LUTE/2-223               .........tmyl-----.-.-...-.---.-.-----..-----.--...-----------------------------WKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVND...GAYS---....--R.........S.K--.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------wdkttamsarlptqvsapsevytpeapeqptnegtesmppap............................................................................................................................................................................................................
A0FLF6_BYDVP/565-649             ..........edv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPiarqKLREAAKAPSTLLYE-KTPK.KSNNFLTRfveanrsPTTPAAPTVSTAS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
B3GQB4_PLRV/1-106                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.-----------------------------------------MLEKREENVKNKTSSWKPP....LPKAVSPAIAKLRSIRKSQP.LEKGTLKE.......DATDGVSSIGSGSLTGGTLKRKATIEERLLQTLTTEQRLWYENLKKTNP.LAATQWMFEY......................................................................................................................................................................................................................................................
S4U2I9_9LUTE/1-77                ............a-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....KLREAANAPSTLLYE-KTSK.KSNNFLTRfmeanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRRSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
C7AXW3_BYDVP/38-187              .............PQPTP.A.P...Q.PAP.E.PTPAP.vPKRFF.EY...IGTPTGTISTRENSDSISVSKLSGQSMQYIENEECETKVIDSFWSINNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGH--...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------......................................................................................................................................................................................................................................................
A5A328_BYDVP/219-572             .............PQPTP.A.P...Q.PAP.E.PTPAP.aPKRFF.EY...IGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAER....TTRha.....etP.IRS.KHILVS.EQY...eQPLPTIIDQG...LCD..vQTPEQ..EQtlv.....deeDKQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LM.EYES....A....T..A.E...IPDA..EEDvlpske........................qlsskpvDTSGNK..I...P...KPK.E..P--------------.-----EVLGTYQGQNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppiar.................................................................................................................................................................................................................................................
Q91QQ1_9LUTE/9-318               ...........pgPDPAP.Q.P...T.PTP.E.PTPAK..HERFI.AY...TGTLSTLISARQSSDSISLYSIRSQRVRYIEDENSSWTNIDAKWYSQNSVEAIPMFVYPVPEGTW.SIEISCEGYQAASSTSDPHRGKCDGMIAYDDDS.SKV.WNVGQQNNVTITNNKADNDWKYGHPD...LTINGDKFDQNQVVEKDGIISFHLVTTgPNA.SFFLVAPAVKKTAKYNFCVSYGDWTDRDMEFGMVSVVLDEHLE...GARSSQY....VRK.........T.LRP.GHISVN.RSH....RLQEMPP---...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------tredfseednsssdnntyktdnspmtvhlvkagdeesyatdqtddvepillda.................................................................................................................................................................................................
B0FL14_BYDVP/203-566             ..sstpepkptpaPTPAP.A.P...E.PKP.E.PTPAP.pPKRFF.EY...VGTPVGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEASgKDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEALR....MTRhs.....ecP.TST.NNILID.EGY...cQPLSTITDQG...LCD..vQTPSQ..DQev......veeDRQTV...S..SE.SDI..A......-......-.----......-.-....-...-...-......----...LK.EYEA....A....T..A.V...IPDA..EEDalpsre........................qlsskpvDTSGAK..I...P...RSK.S..PTN------------.-----E------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------vlgvyqgqsiyaedvppg....................................................................................................................................................................................................................................
D2K8T0_9LUTE/201-469             ...........ap--PTP.T.P...T.PTPpA.PTPAP..TPKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVND...GAYS---....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------rskwdkttamsarlpiqvsapsevytpeapeqptnegtesmp............................................................................................................................................................................................................
G8Z1W7_9LUTE/209-612             ...........psPSPTP.P.P...P.PPP.Q.PQPQP.cAQRFW.GY...EGNPQNKILTAENSRNIDSRPLNFVQMYKWEDEKWDKVNLQAGYSRNDRRCMETYLTIPADKGKF.HVYLEADGEFVVKHIGGELDGSWLGNIAYDVSQ.-RG.WNIGNYKGCKIKNYQSNTTFVAGHPD...ATMNSKSFDSARAVEVDWYASFELECDdEEG.SWAIYPPPIQKDSSYNYTVSYGNYTEKYCEWGAISVSIDE--D...NNGSAPR....--R.........I.PRK.GAMAWS.TPG....-PSFSGDESQ...RQD..fKTPSP..E-...........ERGSD...A..LE.SEE..T......K......-.----......-.-....-...-...-......-EEE...NL.LDRL....E....E..E.N...IPDA..DDEdiwkgisrgs.................etgtteddraSTSS-R..L...RgnlKPQ.G..LPKP---QPTRTITK.FDPDPDLVEAWRP-DLAPGYSKADVAAATVIAGGSIHEGRDMLRRRDEKVMDSRKKW---....--------------------.--------.......-------------------------------------------------.----------gils..................................................................................................................................................................................................................................................
D2K8U5_9LUTE/201-265             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDES-------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------wsieql................................................................................................................................................................................................................................................
A5A323_9LUTE/216-545             ...........psPDPPP.P.P...S.PSP.E.PAPVK..EERFI.VY...SGVAHTIISAQSTDDSIIVRDIPDQRFRYVENENFYWFQIAAQWYSNTNTKAVPMFVFPVPIGEW.SVEISTEGYQATSSTTDPNKGRIDGLIAYDNS-.SEG.WNIGAGSNVTITNNKADNSWKYGHPD...LEINSCHFNQNQVLEKDGIISFHVKATeKEA.NFFLVAPPVQKTSKYNYAVSYGAWTDRDMEFGLITVTLD---E...KRGSGSP....TRK.........S.LRA.GHAGVT.TTTd..lVALPEKENSG...IET..sETPSA..PVt.........sSKAPL...P..TV.SDS..E......S......E.DDP-......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------lsaapdvgfggtrllidtdiktipdpdvadafvnsahvgedp............................................................................................................................................................................................................
Q91AV7_9LUTE/1-373               ...........ma-----.-.-...-.---.-.-----..-----.--...----------QSTDDAISLYDMPSQRFRYIEDENMNWTNLDSRWYSQNSLKAIPMVIVPVPQGEW.TVEISMEGYQPTSSTTDPNKDKQDGLIAYNDDL.KEG.WNVGVYNNVEITNNKADNTLKYGHPD...MELNSCHFNQQQCLERDGDLTCHIKTTgDNA.SFFIVGPAVQKQSKYNYAVSYGAWTDRMVEIGMIAIALDE--Q...GSSGSAR....TER.........P.KRV.GHSMAV.STW....ETINLPEKED...S--...-EKLK..TG...........QRQDL...K..TP.FTI..S......-......-.-GSS......D.V....K...G...I......-EKR...DL.PLP-....A....D..E.D...IPDF..IGNdpwsnvsi.....................rklqeeeaMTSKSG..L...R...PQL.K..PPGLPKPQPVRTIGN.FNPTPELVESWRP-DVNPGYSKEDVAAATILYGGSIKDGRSMIDKRDKAVLDGRKHW---....--------------------.--------.......-------------------------------------------------.----------gssl..................................................................................................................................................................................................................................................
E7FL73_9LUTE/215-719             .......ppppsg--PEP.-.P...P.PPP.Q.PEPCK..KNRFW.GY...EGNPQSKILTAENDRNIDSRPLNFVSMYKWEDEKWDKVNLQAGYSRNDRRCMETYLTIPADKGKF.HVYLEADGEFVVKHIGGDLDGSWLGNIAYDVSQ.-RG.WTVGNYKGCKIKNYQTNITFVAGHPE...AKMNGKAFDSARAVEVDWFASFELECDdEEG.SWMIYPPPIQKDSSYNYTVSYGNYTEKYCEWGAISVSIDEDNE...GYA-PRR....IPR.........K.GEM.AWSYPE.KDY...sENKPQKENWD...TEP..lDTGEM..QR...........ERQLV...K..TP.SPD..V......S......D.SGSE......F.G....A...D...P......IPQD...LI.D-KV....N....R..G.E...ALDP..MQQleydkyrfqe................nvielsesqdqSSEYPK..L...P...PPV.-..PHKPLP--LGRTEKF.FRPRADLLEAWDKDHFDPGYTKEEVAAATIISHGSITDGRAAIEERDNKIQRARVSW-PH....DKSTTSPSIAKLREETSEKKaLFGGSLRR.......-GSEAASSLGGGSITGGTLKSKRTVEEGIVPKLTTTQRLRYEQLKARSQ.TAANEYL---wsv...................................................................................................................................................................................................................................................
Q9IZG0_BYDVP/565-649             ..........edv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPiarqKLREAANAPSTLLYER-APK.KSHNFLTRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
F8RUN4_9LUTE/201-418             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLGVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYVYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVA------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------i.....................................................................................................................................................................................................................................................
A5A2R5_9LUTE/216-556             ...........psPDPPP.P.P...S.PSP.E.PAPVK..EERFI.VY...SGVAHTIISAQSTDDSIIVRDIPDQRFRYVENENFYWFQIAAQWYSNTNTKAVPMFVFPVPIGEW.SVEISTEGYQATSSITDPNKGRIDGLIAYDNS-.SEG.WNIGAGSNVTITNNKADNSWKYGHPD...LEINSCHFNQNQVLEKDGIISFHVKATeKEA.NFFLVAPPVQKTSKYNYAVSYGAWTDRDMEFGLITVTLD---E...KRGSGSP....TRK.........S.SRA.GHAGVT.TTTd..lVALPEKENSG...IET..sETPSA..PVt.........sSKAPL...P..TV.SDS..E......S......E.DDPL......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------saapdvgfggtrllidtdiktipdpdvadafvnsahvgedpwaevrafksaq..................................................................................................................................................................................................
B3FGU1_9LUTE/209-612             ...........psPSPTP.P.P...P.PPP.Q.PQPQP.cAQRFW.GY...EGNPQNKILTAENSRNIDSRPLNFVQMYKWEDEKWDKVNLQAGYSRNDRRCMETYLTIPADKGKF.HVYLEADGEFVVKHIGGELDGSWLGNIAYDVSQ.-RG.WNIGNYKGCKIKNYQSNTTFVAGHPD...ATMNSKSFDSARAVEVDWYASFELECDdEEG.SWAIYPPPIQKDSSYNYTVSYGNYTEKYCEWGAISVSIDE---...-DNNGNA....PRR.........I.PRK.GAMAWS.TP-....EPSFSGDESQ...RQD..fKTPSP..E-...........ERGSD...A..LE.SEE..M......K......E.----......-.-....-...-...-......EENL...LD.RFE-....-....E..E.N...IPDV..DDEdiwkgisrgs.................esgtaeddraSTSSRLrgN...L...KPR.G..LPKPQ---PTRTITQ.FNPNPDLVEAWRP-DLAPEYSKADVAAATVIAGGSIHEGRDMLRRRDEKVMDSRKKW---....--------------------.--------.......-------------------------------------------------.----------gvls..................................................................................................................................................................................................................................................
A5A2Q8_BYDVP/567-649             ............v-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPiarqKLREAAKAPSTLLYE-KTPK.KSNNFLTRfveanrsPTTPAAPTVSTAS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
B0FL26_BYDVP/203-563             ..sstpepkptpaPTPAP.T.P...E.PKP.E.PTPAP.pPKRFF.EY...VGTPIGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEASgKDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEALR....MTRhs.....ecP.TRV.NNILID.EGY...cQPLSTITDQG...LCD..vQTPGQ..DQev......veeDRQTV...S..TE.SDI..A......-......-.----......-.-....-...-...-......----...LK.EYEA....A....T..A.E...IPDA..EEDalpsre........................qlsskpvDTSGEE..I...P...KPR.P..PS-NE----------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------vlgvyqgqpiyaedv.......................................................................................................................................................................................................................................
S4U5P0_9LUTE/1-78                ...........aa-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....KLREAANAPSTLLYE-KTPK.KSNNFLTRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRRSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
G3E232_9LUTE/1-259               ............m-----.-.-...-.---.-.-----..-----.--...-----------------------------------NWTNVDARWYSSNNVKAVPMYVFPVPEGTW.SVEISTEGYQPTASTTNPNKGKVDGMIAYSDDQ.SEV.WNVGINQNCNITNLKADNSWKYGHPD...MEINNCHFNQGQVLEMDGTISFRVETTgSDA.SFFQVGPAVQKQSKYNYAVSYGAWTDRDMELGLISVSLDEKDG...SRGSA--....MKR.........P.RRE.GHSKAV.STW....ETINLPEKEN...SER...SITSQ..RQd.........sKTQPQ...Q..GF.SDA..G......S......E.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------dnkewdftpgtrmflpedfeeprevqnddllrdrg...................................................................................................................................................................................................................
B0FKM6_BYDVP/554-643             ....gqpiyaddv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPiarqKLRDAAKAPSTMLYDK--AP.KSKSFLSRfvegnrsKVENTAPSTATTS------------------NLTREQLREYTRIRNSLGlTAAREYKAQF......................................................................................................................................................................................................................................................
Q8QYQ3_PLRV/1-106                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.-----------------------------------------MLEKREENVKNKTSSWKPP....LPKAVSPAIAKLRSIRKSQP.LEGGILKK.......DATDGVSSIGSGSLTGGTLKRKVTIEERLLQTLTTEQRLWYENLKKTNP.LAATQWLFEY......................................................................................................................................................................................................................................................
Q5UUX6_9LUTE/206-579             .........peptPQPQP.E.P...K.PDP.Q.PTPEP.qHKRFF.EY...VGTPYVIIQTRESSDSIAVKSMNDQSFQYIENETSEQRTVQAWWTSNNGVQAQAAFVFPIPAGEY.SVNISCEGLQSVDHIGGNRDGYWIGLIAYQNQS.GDY.WGVGNYAGCDITNLLGTNTWRPGHED...LELNGCKFTNGQIVERDAVISFHVKAQgADP.KFYLMAPKTMKSDKYNYVVSYGGYTDKRMEFGSISVTVD---E...SDVEAQR....YNRhtst.vrktE.NRDyGWMSVL.PPY....DPNQVPEQEE...EQP...MVDKE..MD...........SRSPV...E..PP.SPT..S......-......D.TEAE......R.AfdlrE...E...E......LTRA...RL.EYEA....A....T..E.S...IPDA..APD.....................................-----V..L...P...SKS.E..MSSRPIDHDGRSLPK.PQSK-EVLGTYQGQNITP----DDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppviae................................................................................................................................................................................................................................................
J7FDA1_9LUTE/208-505             ..........pap-TPTPpP.P...A.PSP.E.PTPCK..GARFW.GY...EGNPQSKIQTAENNRNIDSRPLNYVSMYRWEDEKWDQVNLQAGYSRNDRRCMETYFVIPANKGKF.HVYLEADGEFVVKHIGGDLDGSWLGNIAYDVSQ.-RG.WNIGNYKGCSIKNYQSKTTFVAGHPD...ASMNGKNFDAARAVEVDWFASFELECDdDEG.SWRIYPPPIQKDSSYNYTVSYGNYTEKYCEWGAVSISIDE---...-DNATGR....VPQ.........R.IKP.RKGVMTwSTP....EPERQPAEQT...PVQ...EPSET..SGlda.....pptTKQED...E..TT.D--..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------dlggkfkepqipefst......................................................................................................................................................................................................................................
F8RUI9_9LUTE/201-418             ...........ap--PTP.T.P...T.PTPpA.LTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVA------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------i.....................................................................................................................................................................................................................................................
Q70FV7_9LUTE/2-239               ........nvtmy-----.-.-...-.---.-.-----..-----.--...----------------------------LWKDESWSIEQLPAGYRVNNRERAIPFVLFPIDKGRY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTVSNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFSLEAPPIEKSDHFNFVVSYANFTDKIMEWGSISVAIDEVND...G-----A....YSR.........S.KWD.KTTAMS.ARL....PTQVSAPSEV...YNS...ETPEE..SE...........NEGTE...S..TP.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------papnpalgpdnpatkep.....................................................................................................................................................................................................................................
E3UIM2_BLRV/211-508              ...........pp-PPTP.A.P...A.PQP.Q.PTP-K..HERFI.VY...TGVPESRISAQSTDDSISVYSLQNQRLRYIEDENANWTNIEARWYSNNNVKATPMFIFPVPQGKW.SVEISTEGYQPTSSTTDPNNGKCDGLIAYSDDDkTDV.WNVGVQKNITLSNNKADNTWKYGHPD...LEINNCKFNNRQVLERDAYISFHVETTgPNA.SFFLVAPPVQKTARYNYAVSYGAWTDRMLEFGSVTVALDEHLE...GGYSSHY....IRR.........S.PRP.GHLEST.RTY....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------dlhllphmddliaanttavvdgygssisidrqvlvavdnhivdsgdemd.....................................................................................................................................................................................................
D2K8W5_9LUTE/201-265             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDES-------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------wsieql................................................................................................................................................................................................................................................
I1Z192_PLRV/214-698              .............SEPGP.S.P...Q.PTP.T.PTPQK..HERFI.AY...VGIPMLTIQARENDDQIILGSLGSQRMKYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNAD.SDY.WNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP.TDG.RFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEHLE...GTGSANR....VRR.........P.PRE.GHTYMA.SPR....EPEGKPVGNK...PRD...ETLMQ..TQ...........ERQPD...Q..TP.SDD..V......S......V.AGSV......N.S....R...G...S......TESL...RL.EFGV....N....S..D.S...TYDA..TVD.....................................GTDWPR..I...P...PPR.H..PPESRVSGNSRTVTD.FSPKADLLENWDAEHFDPGYSKEDVAAATIIAHGSIQDGRSMLEKREENVKNKTSSWKPP....LSKAVSPAIAKLRSIRKSQP.LEGGTFEK.......DATDGVSSIGSGSLTGGTLKRKATIEERLLQTLTTEQRLWYENLKKTNP.PAATQWLFEY......................................................................................................................................................................................................................................................
O92523_9LUTE/359-452             .wkqgqniypedv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPlarqRLREAAKAPSTLLYER-TPK.KSNNFLTRfveanrsPTTPAAPTVSTAS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
Q91IC7_BYDVP/364-448             ..........edv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPlarqRLREAAKAPSTLLYER-TPK.KSNNFLTRfveanrsPTTPAAPTVSTTS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
Q70FV2_9LUTE/2-225               .........nvtm-----.-.-...-.---.-.-----..-----.--...---------------------------YLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVND...GAYS---....--R.........S.K--.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------wdkttamsarlptqvsapsevytpeapeqptnegtesmppap............................................................................................................................................................................................................
F8RUL6_9LUTE/201-418             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVL.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVA------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------i.....................................................................................................................................................................................................................................................
I3Y1T5_9LUTE/208-502             ........stppp--PQP.G.P...E.PP-.P.PTPQPcaKSRFW.GY...EGNPQNKILTAENDRNIDSRPLNFVSMYKWEDEKWDKVNLQAGYSRNDRRCMETYLTIPADKGKF.HVYLEADGEFVVKHIGGDLDGSWLGNIAYDVSQ.-RG.WTVGNYKGCKIKNYQTNTTFVAGHPD...SKMNGKSFDSARAVEVDWFASFELECDdEEG.SWMIYPPPIQKDVSYNYTVSYGNYTEKYCEWGAISVSIDEDNE...GYA-PRR....IPRk......geT.TRS.DPEKDY.SEN....KPQKENWNTK...PLD...AGK-T..LR...........EGKPD...T..NP.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------ssdirvklnyslsle.......................................................................................................................................................................................................................................
B0FKT0_BYDVP/203-562             ..sstpepkptpaPTPAP.T.P...E.PKP.E.PTPAP.pPKRFF.EY...VGTPIGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNLS.GDN.WGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFRVEASgKDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEALR....MTRhs.....ecP.TRV.NNILID.EGY...cQPLSTITDQG...LCD..vQTPGQ..DQev......veeDRQTV...S..TE.SDI..A......-......-.----......-.-....-...-...-......----...LK.EYEA....A....T..A.E...IPDA..EEDalpsre........................qlsskpvDTSGEE..I...P...KPR.P..PS-NE----------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------vlgvyqgqpiyadd........................................................................................................................................................................................................................................
O92521_9LUTE/370-453             ...........dv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPlarqRLREAAKAPSTLLYER-TPK.KSGNFLTRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
F8RUK1_9LUTE/201-418             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHLNFVVSYANFTDKILEWGSISVA------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------i.....................................................................................................................................................................................................................................................
MCAPS_BWYVG/207-610              ............p-GPSP.G.P...S.PSP.Q.PTPQK..KYRFI.VY...TGVPVTRIMAQSTDDAISLYDMPSQRFRYIEDENMNWTNLDSRWYSQNSLKAIPMIIVPVPQGEW.TVEISMEGYQPTSSTTDPNKDKQDGLIAYNDDL.SEG.WNVGIYNNVEITNNKADNTLKYGHPD...MELNGCHFNQGQCLERDGDLTCHIKTTgDNA.SFFVGRPAVQKQSKYNYAVSYGAWTDRMMEIGMIAIALDEQ-G...SSGSA-K....TKR.........P.KRV.GHSMAV.STW....ETINLPEKEN...SEE...---IQ..TS...........QRQDF...K..TP.PTAggG......S......D.MLDV......E.E....G...G...L......PLSV...EE.EIP-....-....-..-.-...--DF..VGDnpwsnitt....................ensqeeeamSSKSGL..T...P...QLK.P..PGLPK-PQPIRRLKS.FDATPDLVEAWRP-DVNPGYSKADWAVATIIAGGSIKDGRSMIDKRDKAVLDGRKSW---....--------------------.--------.......-------------------------------------------------.----------gss...................................................................................................................................................................................................................................................
Q45ZZ0_BYDVP/566-649             ...........dv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPlarqRLREAAKAPSTLLYER-TPK.KSNNFLTRfveanrsPTTPAAPTVSTTS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
Q5CC80_BYDVP/218-571             .............PQPTP.A.P...Q.PTP.E.PTPAP.aPKRFF.EY...VGTPTGTISTRENSDSISVSKLGGQSMQYMENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYRGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgNDA.CFYLMAPKTMITDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAKH....ITRha.....etP.IRS.KHILVS.ERY...vEPLPTITDQG...LCD..vKTPEQ..EQtlv.....deeDRQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LQ.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskplDTSGNI..I...P...KSK.E..P--------------.-----EVLGTYQGQNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppmar.................................................................................................................................................................................................................................................
R9UHA0_9LUTE/205-590             ...........pgPKPKP.D.P...T.PTP.A.PEPKT..PKRFF.EF...IGTPSGVIQTRESSDSISVSKLGDQTFQKIENEKSNDVFLSSYWQYSNSVYAQAAFVIPIYQGSY.SVNISCEGMQSVDHIGGEQDGYWIGLIAYSNST.DDV.WGVGNYQGCTITKYLVTNSWRPGHQD...LKLNDCAFDKGQIVERDAVLSFHVEAVgDNP.SFYLLAPKTQKTDKYNYVVSYGGYTNKKMEFGTIAITCD---E...SDVEALR....NARha.....nyP.IKE.NHQEL-.--Y....HGSGTLLPAY...SPDrveVYPDI..TS..........sERTVQ...P..RP.SEE..P......-......K.FRDI......Q.N....Q...E...E......LSSL...FD.LYDL....A....T..S.E...IPDA..REDvlptkq........................emskkpiDSLGTE..I...P...RPR.SmsPEYPRPRSRSPEYPRpRSRSPEPIGTYHGQNIYDDD----------------------------------------....--------------------.--------.......-------------------------------------------------.----------vpkqvaer..............................................................................................................................................................................................................................................
B0FKX2_BYDVP/560-642             ............v-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPaarqALREAARAPSTMLYD-KAPK.GAKSILSRfvegnrsKTTPAAPSVSTTS------------------NMTREQLKEYTRIRNSLGvTAAKEYKAQ-l.....................................................................................................................................................................................................................................................
Q65972_9LUTE/209-609             ...........psPSPTP.P.P...P.PPP.Q.PQPQP.cAQRFW.GY...EGNPQNKILTAENSRNIDSRPLNFVQMYKWEDEKWDKVNLQAGYSRNDRRCMETYLTIPADKGKF.HVYLEADGEFVVKHIGDELDGSWLGNIAYDVSQ.-RG.WNVGNYKGCKITNYQSNTVFVAGHPD...ATMNGKSFDTARAVEVDWFASFELECDdEEG.SWAIYPPPIQKDSSYNYTVSYGNYTEKYCEWGAISVSID----...EDNNGNE....PRR.........I.PRR.GVMAWS.TP-....EPSFSGDDSQ...RQD..fNTPSL..E-...........ERGSD...A..LE.SEE..KkeednlL......D.LEEE......N.I....P...D...V......DD-D...DL.WKGI....S....R..A.S..eAGTA..EDDr...................................aSTSS-R..L...RgnlKPK.G..LPKPQ---PTRTITE.FNPGPDLIEVWRP-DLAPGYSKADVAAATVLAGGSVHEGRDMLERREAKVMDSRKKW---....--------------------.--------.......-------------------------------------------------.----------gi....................................................................................................................................................................................................................................................
F8RUI3_9LUTE/201-418             ...........ap--PTP.T.P...T.PTPpA.PTPAP..ASKYL.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISSYRTPDSNVSGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVA------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------i.....................................................................................................................................................................................................................................................
B0FKM0_BYDVP/553-643             ....qgqpiysdd-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.---------------------------------------------------------VPPiarqKLRDAAKAPSTLLYDK--AP.KSKSFLSRfvegnrsKTETTAPSTATTS------------------NLTREQLREYTRIRKTLGlTAAREYKAQF......................................................................................................................................................................................................................................................
Q84815_PLRV/5-489                .............SEPGP.S.P...Q.PTP.T.PTPQK..HERFI.AY...VGIPMLTIQARENDDQIILGSLGSQRMKYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNAD.SDY.WNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP.TDG.RFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEHLE...GTGSANR....VRR.........P.PRE.GHTYMA.SPR....EPEGKPVGNK...PRD...ETPIQ..TQ...........ERQPD...Q..TP.SDD..V......S......D.AGSV......N.S....G...G...S......TESL...QL.EFGI....N....S..D.S...TYDA..TVD.....................................GTDWPK..I...P...PPR.H..PPEPRVSGNSRTVTD.FSPKADLLENWDAEHFDPGYSKEDVAAATIIAHGSIQDGRSMLEKREENVKNKTSSWKPP....SPKAVSPAIAKLRSIRKSQP.LEGGTLKK.......DATDGVSSIGSGSLTGGTLKRKATIEERLLQTLTTEQRLWYENLKKTNP.LAATQWLFEY......................................................................................................................................................................................................................................................
Q8JZ09_9LUTE/208-610             ............p-GPSP.G.P...S.PSP.Q.PTPQK..KYRFI.VY...TGVPVTRIMAQSTDDAISLYDMPSQRFRYIEDENMNWTNLNSRWYSQNNLKAIPMIIVPVPQGEW.TVEISMEGYQPTSSTTDPNKDKQDGLIAYNDDL.NEG.WNVGIYNNVEITNNKADNTLKYGHPD...MELNNCHFNQGQCLERDGDLTCHVKTTgDNA.SFFIVGPAVQKQSKYNYAVSYGAWTDRMMEIGMIAIALDE--Q...GSSGSTR....TQR.........P.KRA.GHSMAV.STW....ETINYPEKEN...SEI...TETSQ..RQ...........DFKTP...L..HI.SES..-......S......D.PLEV......G.K....G...GmplP......ADEN...IP.DFVG....-....-..-.-...----..--Ddpwfeis......................trksqeeeAMSHSS..V...L...KPQlK..PPGLPKPQPVRTIRD.FDPKPDLVEAWRP-DVNPGYSKEDVAAATVMYGGSVHEGRSMIDKRDKAVLDGRKRW---....--------------------.--------.......-------------------------------------------------.----------gs....................................................................................................................................................................................................................................................
B5KLA3_9LUTE/1-372               ...........ma-----.-.-...-.---.-.-----..-----.--...----------QSTDDAISLYDMPSQRFRYIEDENMNWTNLDSRWYSQNSLKAIPMVIVPVPQGEW.TVEISMEGYQPTSSTTDPNKDKQDGLIAYNDDL.KEG.WNVGVYNNVEITNNKADNTLKYGHPD...MELNSCHFNQQQCLERDGDLTCHIKTTgDNA.SFFIVGPAVQKQSKYNYAVSYGAWTDRMMEIGMIAIALDE--Q...GSSGSTR....TER.........P.KRV.GHSMAV.STW....ETINLPEKED...SEK...LKTGQ..RQ...........DLKTP...F..TI.SES..Sd....vK......G.IEKR......D.L....P...L...P......ADED...IP.DFIG....N....-..-.-...----..--Dpwsnvsi......................rklqeeeaMTSKSS..L...R...PQL.K..PPGLPKPQPVRTIGN.FNPTPELVESWRP-DVNPGYSKEDVAAATILYGGSIKDGRSMIDKRDKAVLDGRKHW---....--------------------.--------.......-------------------------------------------------.----------gss...................................................................................................................................................................................................................................................
A5A2T8_BYDVP/565-649             ..........ddv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPiarqKLREAAKAPSTLLYE-KTPK.KSNNFLTRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
Q91IC7_BYDVP/18-370              .............PQPTP.A.P...Q.PAP.E.PTPAP.vPKRFF.EY...IGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGMIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTFD---E...SDVEAKR....ITRha.....etS.IRS.KHILVS.ERY...eEPLPTITNQG...LCD..vKTPEQ..EQtlv.....deeDRQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LQ.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskplDTSGNI..I...P...KSK.E..P--------------.-----EVLGTYQGQNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppla..................................................................................................................................................................................................................................................
B0FKU2_BYDVP/203-563             ..sstpepkptpaPTPAP.T.P...E.PKP.E.PTPAP.pPKRFF.EY...VGTPIGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEASgKDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEALR....MTRhs.....ecP.TRV.NNILID.EGF...cQPLSTTTDQG...LCD..vQTPGQ..EQev......veeDRQTV...S..TG.SDI..A......-......-.----......-.-....-...-...-......----...LM.EYEA....A....T..A.E...IPDA..EEDalpsre........................qlsskpvDTSGEE..I...P...KPR.P..P-NNEVL--------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------gvyqgqpiyaedv.........................................................................................................................................................................................................................................
F8RUJ5_9LUTE/201-418             ...........ap--PAP.T.P...T.PTPpA.PTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSNANFTDKILEWGSISVA------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------i.....................................................................................................................................................................................................................................................
R4I757_9LUTE/10-411              ............gPSPTP.P.P...P.PPP.Q.PQPQP.cAQRFW.GY...EGNPQNKILTAENSRNIDSRPLNFVQMYKWEDEKWDKVNLQAGYSRNDRRCMETYLTIPADKGKF.HVYLEADGEFVVKHIGGELDGSWLGNIAYDVSQ.-RG.WNVGNYKGCKIKNYQSNTVFVAGHPD...ATMNGKSFDTARAVEVDWFASFELECDdEEG.SWAIYPPPIQKDSSYNYTVSYGNYTEKYCEWGAISVSIDEDN-...---NGNV....PRR.........I.PRK.GAMAWS.TP-....EPSLSGDDSQ...RQD..fNTPSP..K-...........ERGSD...I..LE.SEE..K......KeednllD.LEEE......N.I....P...-...D......VDDD...DL.WKGI....S....R..A.S...AAGT..TEDd..................................raSTSS-R..L...RgnlKPK.G..LPKPQ---PTRTIAE.FNPEPDLIEAWRP-DLAPGYSKADVAAATVIAGGSIHEGRDMLERREAKVMDSRKKW---....--------------------.--------.......-------------------------------------------------.----------gils..................................................................................................................................................................................................................................................
D0EX81_9LUTE/201-265             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDES-------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------wsieql................................................................................................................................................................................................................................................
Q2L3F3_9LUTE/201-477             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLPAGYRVNNRERAIPFVLFPIDKGRY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTVSNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKIMEWGSISVAIDEVND...GAYS---....--R.........S.KWD.KTTAMS.AR-....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------lptqvsapsevynpeapeesenegtestppapnpalg.................................................................................................................................................................................................................
B1A434_9LUTE/212-504             .............PDPTP.P.P...A.PPP.E.PTPAK..HERFI.VY...TGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQ.TKV.WNIGVQNNVTISNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTgPNA.SFFLAGPAVKKIAKYNYCISYGAWTDRDMEFGMVSVVLDEHLE...GVRGSQY....IRK.........T.LRP.GHISVN.RTH....RLQ-------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------emppmredfseednsssdsntyktdnspltvhivkagdeeny............................................................................................................................................................................................................
E0A2S1_9LUTE/1-137               ...........ga-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.--T.WNVGEYNNVKITKLLNTSSWKKGHKD...VVLNGCHFNDGQVIERDSTMSFHCEVGhGGG.TILLVAPPVCKSDKYNYVVSYGEYTTKHMEFGSIAICFDEKND...GARAGKF....LGA.........PfPRA.GHVVRE.Q--....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------qteiarfpagsd..........................................................................................................................................................................................................................................
Q8B6L4_9LUTE/9-309               ...........pgPDPAP.Q.P...T.PTP.E.PTPAK..HERFI.AY...TGTLSTLISARQSSDSISLYSIRSQRIRYIEDENSSWTNIDAKWYSQNSVEAIPMFVYPVPEGTW.SIEISCEGYQAASSTSDPHRGKCDGMVAYDDDS.SKV.WNVGQQNNVTITNNKADNDWKYGHPD...LTINGDRFDQNQVVEKDGIISFHLVTTgPNA.SFFLVAPAVKKTAKYNFCVSYGDWTDRDMEFGMVSVVLDEHLE...GARSSQY....VRK.........T.PRS.GHVGVN.RSH....RLQDNFVPTE...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------yvsdedsssnssivsnrpstpdndsdaqfaesmkgklpsqt.............................................................................................................................................................................................................
Q8BA01_PLRV/214-698              .............SEPGP.S.P...Q.PTP.T.PTPQK..HERFI.AY...VGIPMLTIQARENDDQIILGSLGSQRMKYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGVIAYSNAD.SDY.WNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP.TDG.RFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEHLE...GTGSANR....VRR.........P.PRE.GHTYMA.SPR....EPEGKPVGNK...PRD...ETPIQ..TQ...........ERQPD...Q..TP.SDD..V......S......D.AGSV......N.N....S...G...S......TESL...QL.EFGV....N....S..D.S...TYDA..TVD.....................................GTDWPR..I...P...PPR.H..PPEPRVSGNSRTVID.FSPKADLLENWDAEHFDPGYSKEDVAAATIIAHGSIQDGRSMLEKREESVKNKTSSWKPP....LSKAVSPAIAKLRSIRKSQP.LEGGTLKK.......DATDGVSSIGSGSLTGGTLKRKVTIEERLLQTLTTEQRLWYENLKKTNP.PAAIQWLYEY......................................................................................................................................................................................................................................................
I1Z1A5_PLRV/1-106                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.-----------------------------------------MLEKREENVKNKTSSWKPP....LPKAVSPAIAKLRSIRKSQP.LEGGTLKE.......DATDGVSSIGSGSLTGGTLKRKATIEERLLQTLTTEQRLWYENLKKTNP.LAATQWMFEY......................................................................................................................................................................................................................................................
B0FKX8_BYDVP/219-573             .............PQPTP.A.P...Q.PAP.E.PTPAP.vPKRFF.EY...IGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYRGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAER....ITRha.....etP.IRS.KHILVS.EQY...gQPLPTIIDQG...LCD..vQTPEQ..EQtlv.....deeDKQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LM.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskpvDTSGNK..I...P...KSK.E..P--------------.-----EVLGTYQGQNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppitrq................................................................................................................................................................................................................................................
B1A440_9LUTE/212-501             .............PDPTP.P.P...A.PPP.E.PTPAK..HERFI.VY...TGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQ.NKV.WNVGVQNNVTISNNKADADWKYGHPN...LTINGERFDQNQVVEKDGTVSFHLVTTgPNA.SFFLVGPPVKKIAKYNYCISYGAWTDRDMEFGMVSVVLDEHLE...GVRGSQY....VRK.........T.LRP.GHISVN.RSH....RL--------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------qemppmredfseedssssdnntyktdnspltvhlvkagde..............................................................................................................................................................................................................
A5A2S0_BYDVP/219-649             .............PQPTP.A.P...Q.PAP.E.PTPAP.vPKRFF.EY...IGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...FKLNDCQFTDGQIVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAER....ITRha.....etP.IRS.KHILVS.EQY...eQPLPTIIDQG...LCD..vQTPEQ..EQtlv.....deeDKQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LM.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskplDTSGNK..I...P...KPK.E..P--------------.-----EVLGTYQGQNIYP----EDV---------------------------------PPiarqKLREAAKAPSTLLYE-KTPK.KSNNFLTRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
R9U127_9LUTE/203-507             ..gaspapdptptPTPTP.T.P...T.PTP.T.PTPVT..QEAFY.GY...SGVPECKIQSRKNSEFIDIYSLNFVKLFYWRDEAWSSETLSAGYIQNDSLRATPYLLVPTKKGKY.SVYIECEGFQAVKAKGGNNDGKMSGFVTYDKD-.QSG.WQVYSWAGCSLSQIKVKDTGVVAHPD...MKVNGCSFTKGQLIERDFICSFHLEAT.EDG.YWALQAPPVEKSDDHNFIVSYGSYTEKILEWGSVSISIDEI--...NRTEARK....I--.........P.KRD.KD----.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------lsqsgrladmtnvptvgvvvaattkpdlpveqpnqlavveqpteeqqkkratidqwlda...........................................................................................................................................................................................
B0FL20_BYDVP/556-645             .....qpiyaedv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPvarqKLRDAAKAPSTLLYD-KTPK.RSKSILSR.......FIEGNRSSVESAAPS------TAT-----TSNLTREQLREYTRIRNTLGlTAAKAYKAQF......................................................................................................................................................................................................................................................
O09708_PEMV1/198-469             ..........pgp-DPGP.Q.P...P.PPP.P.PSPTP.vGARFW.GY...EGVPESRMISERNDHDIDVKPLSFITMYKWEDESWTSVKLSASYLQNDQVEATPYFLIPSSKGKF.SVYIECEGFQAVKSIGGKSDGCWGGLIAY-NRK.KDG.WQARAYTGTVLSNYRSTTTVINGHPD...CEVNDCKFKPDHGVESDLICSFHLEAE.EDS.YWALQAPPIQKSSDYNYVVSYGGYTEKSIEWGSVSISID-EVN...QTASASP....WRG.........R.AR-.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------klailqetvvplpfppggamdyrlgdregdqtgt....................................................................................................................................................................................................................
R4HG89_9LUTE/212-501             ..........pdp-PPPP.P.P...A.PSP.E.PQPCK..KFRFW.GY...EGVPQNKIVTAQNNRNIDVRGLNYVKFFKWEDDNWTEVNLQANYNVNNSQYAEPYMIIPASKGKY.HVYLECDGQMAVKSVGGKADNSWRGLIAYDTS-.RRM.WSVGNYKGCIIENYKKTDSFVLGHPD...VELNDCKFDKARGVEADWYASFQLTCDdDDG.AWILYAPPIPKDSLYNYTVSYGEYTENMCEWGAVSISIDEDNS...STGNEVR....IK-.........P.GR-.--GYEM.RRA....LPEGKL-EQQ...PWE...DNPVQ..TN...........SWKEN...QseTS.SDT..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------dgesfvkaitgkl.........................................................................................................................................................................................................................................
K9LHK2_9LUTE/4-192               ........spppg--PQP.P.P...P.PPP.Q.PQPCP.kAARFW.GY...EGVPQSKILTAENNRNIDYRPLNFITMWKWEDEKWDKINLQAGYSRNDSRCMEAYCVIPANKGKH.NVYIEADGEFVVKHIGGNLDGSWLGNIAYDVSQ.-RG.WTVANYKGCKIANLQVNTAFVPGHPD...AEMNGKSFDSARAIEVDWFASFELTCD.DD-.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------eggwml................................................................................................................................................................................................................................................
Q670I2_9LUTE/218-578             ...........pgPSPPP.L.P...T.PTP.E.PTPKQ..HERFI.VY...VGSPTMDIQARENDDIITLTEPGPQNWRRIQDEDMNEVSLDSRFWTNSDLKAKPMFYFPVPAGSW.SVDITCEGYQPTSDPTKQGDNRSDGLIAYSADN.NDNlWNVGQTGSLKISNLRGINTFKAGHPK...LVVNGCNFNDGQVMERDGTLSFHVQTE.KDG.SFFLTGPPVQKQGRYNYTVSYGEWTKRILEFGLITVVLDEHLD...NSGS-NK....FKR.........P.PRN.GHQWAG.LV-....--TDTVMENT...VSD...KTPDP..PKs........krKLEPE...K..AN.SDN..K......-......-.LPEP......Q.K....R...K...L......VIDP...KL.D-EV....E....V..E.S...IPDA..PED.....................................-FNWATlgI...P...RGK.G..P--AS----------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------lagfndtelargkdqssddelpshfsapgldeipa...................................................................................................................................................................................................................
B0FKS4_BYDVP/203-559             .sstpepkptpap-TPPP.Q.P...E.PKP.E.PTPAP.pPKRFF.EY...VGTPIGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVQASgKDA.CFYIMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEALR....MSRhs.....esP.TRV.NNILID.EGY...hQTLPPIQNLG...LCD..vQTPGQ..DEve.......edDKQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LQ.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskpvDTSGEE..I...P...KPP.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------prdneilgvyqgqpiya.....................................................................................................................................................................................................................................
B0FKK2_BYDVP/202-555             dsstpepkptptp-TPPP.Q.P...E.PKP.E.PTPAP.pPKRFF.EY...VGTPTGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIVSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVQASgKDA.CFYIMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEALR....MSRhs.....esP.TRV.NNILID.EGY...hQTLPPIQNLG...LCD..vQTPGQ..DEve.......edDKQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LQ.EYEA....A....T..A.K...IPDA..EEDvlpske........................qlsskpvDTSGEE..I...P...KPP.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------prdneilgvyqgq.........................................................................................................................................................................................................................................
B0FL20_BYDVP/203-563             ..sstpepkptpaPTPAP.A.P...E.PKP.E.PTPAP.pPKRFF.EY...VGTPVGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCVFTNFLATNTWRPGHKG...LKLNDCQFTDGQIVERDAVMSFHVEASgKDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEALR....MTRhs.....ecP.TRV.NNILID.EGY...cQPLSTITDQG...LCD..vQTPGQ..DQev......veeDRQTV...S..TE.SDI..A......-......-.----......-.-....-...-...-......----...LK.EYEA....A....T..A.E...IPDA..GEDalpsre........................qlsskpvDTSGEE..I...P...KPR.P..PS-NE----------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------vlgvyqgqpiyaedv.......................................................................................................................................................................................................................................
Q70FV6_9LUTE/2-239               ........nvtmy-----.-.-...-.---.-.-----..-----.--...----------------------------LWKDESWSIEQLPAGYRVNNRERAIPFVLFPVDKGRY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-GNAN.LAG.WRAYAYSGCTVSNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKIMEWGSISVAIDEVND...G-----A....YSR.........S.KWD.KTTAMS.ARL....PTQVSAPSEV...YNP...ETPEE..SK...........DEGTE...S..TP.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------papnpalgpdnpatkep.....................................................................................................................................................................................................................................
V5KYS7_9LUTE/201-479             ...........ap--PTP.I.T...T.PTPpA.PTPAP..APKYF.GY...QGVPSNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVND...GA-----....YSR.........S.KWD.KTTAMS.ARL....PTQVSAPSEV...YTP...ETPEQ..PA...........DEGTE...S..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------mppapnpalgpd..........................................................................................................................................................................................................................................
B0FKN8_BYDVP/202-558             dsstpepkptptp-TPPP.Q.P...E.PKP.E.PTPAP.pPKRFF.EY...VGTPTGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVQASgKDA.CFYIMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEALR....MSRhs.....esP.TRV.NNILID.EGY...hQTLAPIQNLG...LCD..vQTPGQ..DEve.......edDKQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LQ.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskpvDTSGEE..I...P...KPP.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------prdneilgvyqgqpiy......................................................................................................................................................................................................................................
Q7T6K8_9LUTE/2-223               .........tmyl-----.-.-...-.---.-.-----..-----.--...-----------------------------WKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVND...GAYS---....--R.........S.K--.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------wdkttamsarlptqvsapsevytpeapeqptnegtesmppap............................................................................................................................................................................................................
C7AXW7_BYDVP/38-187              .............PQPTP.A.P...Q.PAP.E.PTPAP.vPKRFF.EY...IGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.GVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGH--...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------......................................................................................................................................................................................................................................................
B0FL02_BYDVP/219-570             .............PQPTP.A.P...Q.PAP.E.PTPAP.vPKRFF.EY...IGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAER....ITRha.....etP.IRS.KHILVS.ERY...vEPMPTIIDQG...LCD..vKTPEQ..EQtlv.....deeDKQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LQ.EYEA....A....T..V.E...VPDA..EEDvlpske........................qlsskpmDTSGNK..I...P...KPK.E..P--------------.-----EVLGTYQGMHIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppl...................................................................................................................................................................................................................................................
Q65849_BYDVP/18-372              .............PQPTP.A.P...Q.PAP.E.PTPAP.vYKRFF.EY...IGTPTGTISTRENSDSISVSKLGGQSMQYIENEICETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAER....ITRha.....etP.IRS.KHILVS.EQY...eQPLPTIIDQG...LCD..vQTPEQ..EQtlv.....deeDKQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LM.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsfrpvDTSGNK..I...P...KPR.E..P--------------.-----EVLGTYQGQNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppiarq................................................................................................................................................................................................................................................
B5KLA5_9LUTE/1-372               ...........ma-----.-.-...-.---.-.-----..-----.--...----------QSTDDAISLYDMPSQRFRYIEDENMNWTNLDSRWYSQNSLKAIPMVIVPVPQGEW.TVEISMEGYQPTSSTTDPNKDKQDGLIAYNDDL.KEG.WNVGVYNNVEITNNKADNTLKYGHPD...MELNSCHFNQQQCLERDGDLTCHIKTTgDNA.SFFIVGPAVQKQSKYNYAVSYGAWTDRMMEIGMIAIALDE--Q...GSSGSAR....TER.........P.KRV.GHSMAV.STW....ETINLPEKED...SEK...LKTGQ..RQ...........DLKTP...F..TI.SES..Sd....vK......G.IEKR......D.L....P...L...P......ADED...IP.DFIG....N....-..-.-...----..--Dpwsnvsi......................rklqeeeaMTSKSG..L...R...PQL.K..PPGLPKPQPVRTIGN.FNPTPELVESWRP-DVNPGYSKEDVAAATILYGGSIKDGRSMIDKRDKAVLDGRKHW---....--------------------.--------.......-------------------------------------------------.----------gss...................................................................................................................................................................................................................................................
Q84822_PLRV/5-489                .............SEPGP.S.P...Q.PTP.T.PTPQK..HERFI.AY...VGIPMLTIQARENDDQIILGSLGSQRMKYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNAD.SDY.WNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP.TDG.RFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEHLE...GTGSANR....VRR.........P.PRE.GHTYMA.SPR....EPEGKPVGNK...PRD...ETPIQ..TQ...........ERQPD...Q..TP.SDD..V......S......D.AGSV......N.G....G...G...S......TESL...QL.EFGI....N....S..D.S...TYDA..TVD.....................................GTDWPK..I...P...PPR.H..PPEPRVSGNSRTVTD.FSPKADLLENWDAEHFDPGYSKEDVAAATIIAHGSIQDGRSMLEKREENVKNKTSSWKPP....SPKAVSPAIAKLRSIRKSQP.LEGGTLKK.......DATDGVSSIGSGSLTGGTLKRKATIEERLLQTLTTEQRLWYENLKKTNP.SAATQWLFEY......................................................................................................................................................................................................................................................
B7TWD7_9LUTE/212-500             .............PDPTP.P.P...A.PPP.E.PTPAK..HERFI.VY...TGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQ.NKV.WNVGVQNNVTISNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTISFHLVTTgPNA.SFFLVGPPVKKIAKYNYCISYGAWTDRDMEFGMVSVVLDEHLE...GVRGSQY....VRK.........T.LRP.GHISVN.RTH....RL--------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------qemppmredfseednsssdsntyktdnspltvhfvkagd...............................................................................................................................................................................................................
Q8B6K4_9LUTE/9-515               ...........pgPDPAP.Q.P...T.PTP.E.PTPAK..HERFI.AY...TGTLSTLISARQSSDSISLYSIRSQRIRYIEDENSSWTNIDAKWYSQNSVEAIPMFVYPVPEGTW.SIEISCEGYQAASSTSDPHRGKCDGMIAYDDDS.SKV.WNVGQQNNVTITNNKADNDWKYGHPD...LTINGDRFDQNQVVEKDGIISFHLVTTgPNA.SFFLVAPAVKKTAKYNFCVSYGDWTDRDMEFGMVSVVLDEHLE...GARSSQY....VRK.........S.PRS.GHVGVN.RSH....RLQDNFVPAE...Y--...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------vsdedsssssivsnrpstpdndsdaqfaesmkgklpsqtklppkgflsrlsakerkeisnskpsnveglvgplvaaygypsqtgvydaareilqakeaaenlaelerdlkeinklepqdvivqeeipdfvppsekilkeddpdyvppiwqnadqavlvssyeppdwsrpayesgnllkkagilkgtlsklggslrsgesslrgslrktqdqtdldnklsklsviqrsqyqrilnnlgkmrarayid
S4U191_9LUTE/1-76                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....KLREAANAPSTLLYE-KTSK.KSNNFLTRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
S4U216_9LUTE/1-76                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....KLREAANAPSTLLYG-KTSK.KSNNFLTRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRNSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
A7XUE2_9LUTE/212-500             .............PDPTP.P.P...A.PPP.E.PTPAK..HERFI.VY...TGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQ.TKV.WNIGVQNNVTISNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTgPNA.SFFLAGPAVKKIAKYNFCISYGAWTDRDMEFGMVSVVLDEHLE...GVRGSQY....VRK.........T.LRP.GHISVN.RTH....RL--------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------qemppmredfseednsssdsntyktdnspltvhfvkagd...............................................................................................................................................................................................................
S4U205_9LUTE/1-76                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....KLREAANAPSTLLYD-KTSK.KSNNFLTRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRRSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
Q8B6M4_9LUTE/9-319               ...........pgPDPAP.Q.P...T.PTP.E.PTPAK..HERFI.AY...TGTLSTLISARQSSDSISLYSIRSQRIRYIEDENSSWTNIDAKWYSQNSVEAIPMFVYPVPEGTW.SIEISCEGYQAASSTSDPHRGKCDGMIAYDDDS.SKV.WNVGQQNNVTITNNKADNDWKYGHPD...LMINGDKFDQNQVVEKDGIISFHLVTTgPNA.SFFLVAPAVKKTAKYNFCVSYGDWTDRDMEFGMVSVVLDEHLE...GARSSQY....VRK.........T.LRP.GHISVN.RSH....RLQEMPPTRE...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------dfseednsssdsntyktdnsrmtvhivkagdeesyatdqtddveptlldad...................................................................................................................................................................................................
H9NAE6_9LUTE/201-265             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDES-------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------wsieql................................................................................................................................................................................................................................................
B0FL26_BYDVP/556-645             .....qpiyaedv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPgtrqKLRDAAKAPSTLLYD-KTPK.RSKSILSR.......FIEGNRSSVESAAPS------TAT-----TSNLTREQLREYTRIRNTLGlTAAKEYKAR-l.....................................................................................................................................................................................................................................................
E0A2S0_9LUTE/1-137               ...........ga-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.--T.WNVGEYNNVKITKLLNTSSWKKGHKD...VVLNGCHFNDGQVIERDSTMSFHCEVGhGGG.TILLVAPPVCKSDKYNYVVSYGEYTTKHMEFGSIAICFDEKHD...GARAGKF....LGA.........PfPRA.GHVVCE.QQT....E---------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------iarfpagsd.............................................................................................................................................................................................................................................
Q7T6J4_9LUTE/2-223               .........tmyl-----.-.-...-.---.-.-----..-----.--...-----------------------------WKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVND...GAYS---....--R.........S.K--.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------wdkttamsarlptqvsapsevytpeapeqptnegtesmppap............................................................................................................................................................................................................
W8FKV2_9LUTE/1-257               ............m-----.-.-...-.---.-.-----..-----.--...-----------------------------------NWTNLDARWYSQNSLKAIPMIIVPVPQGEW.TVEISMEGYQPTSSTTDPNKDKQDGLIAYNDDP.KEG.WNVGVYNNVEITNNKADNSWKYGHPD...MELNNCHFNQGQCLERDGDLTCHVKTTgDDA.SFFVVGPAVQKQSKYNYAVSYGAWTDRMMEIGMIAIALDEQ--...GSSGSTL....AKR.........P.KRA.GHSMAV.STW....ETLNLPEKEN...SET...STTSQ..RQd.........sKTQPQ...Q..GF.SDA..G......S......E.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------dnkewdftpgtrmflpedfeeprevqnddllrd.....................................................................................................................................................................................................................
Q8QYN3_PLRV/1-106                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.-----------------------------------------MLEKREENVKNKTSSWKPP....LPKAVSPAIAKLRSIRKSQS.LEGGTLKK.......DATDGVSSIGSGSLTGGTLKRKATIEERLLQTLTTEQRLWYENLKKTNP.LAATQWLFEY......................................................................................................................................................................................................................................................
D2K8W0_9LUTE/201-265             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDES-------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------wsieql................................................................................................................................................................................................................................................
S4U4L7_9LUTE/1-77                ............a-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....KLREAANAPSTLLYG-KTPK.KSNNFLTRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRRSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
F8RUJ8_9LUTE/201-418             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRGRAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVA------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------i.....................................................................................................................................................................................................................................................
Q70FV0_9LUTE/2-225               .........nvtm-----.-.-...-.---.-.-----..-----.--...---------------------------YLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVND...GAYS---....--R.........S.K--.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------wdkttamsarlptqvsapsevytpeapeqptnegtesmppap............................................................................................................................................................................................................
B1A413_9LUTE/212-500             .............PDPTP.P.P...A.PPP.E.PTPAK..HERFI.VY...TGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVPQGTW.SVEISCEGYQATSSTTDPHRGKSDGMIAYDDDQ.TKV.WNVGVQNNVTITNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTgPNA.SFFLAGPAVKKIAKYNFCISYGAWTDRDMEFGLVSVVLDEHLE...GVRGSQY....VRK.........T.LRP.GHISVN.RTH....RL--------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------qemppmredfseednsssdsntyktdnspltvhlvkagd...............................................................................................................................................................................................................
D2K8U0_9LUTE/201-265             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKFF.GY...QGVPNNVVKTRGNSEYLDVGPLENVTMYRWKDES-------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------wsieql................................................................................................................................................................................................................................................
Q460A0_BYDVP/219-570             .............PQPTP.A.P...Q.PAP.E.PTPAP.vPKRFF.EY...IGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGMIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQVVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTFD---E...SDVEAKR....ITRha.....etP.IRS.KHILVS.ERY...eEPLPTITNQG...LCD..vKTPEQ..EQtlv.....deeDRQTV...S..TE.PDV..A......-......-.----......-.-....-...-...-......----...LQ.EYEA....A....I..A.E...IPDA..EEDvlpske........................qlsskplDTSGNI..I...P...KSK.E..P--------------.-----EVLGTYQGQNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppl...................................................................................................................................................................................................................................................
Q7T6K5_9LUTE/2-222               .........tmyl-----.-.-...-.---.-.-----..-----.--...-----------------------------WKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPX...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVND...GAYS---....--R.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------skwdkttamsarlpaqvsapsevytpeapeqptnegtesmppa...........................................................................................................................................................................................................
E0A2S3_9LUTE/1-137               ...........ga-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.--T.WNVGEYNNVKITKLLNTSSWKKGHKD...VVLNGCHFNDGQVIERDSTMSFHCEVGhGGG.TILLVAPPVCKSDKYNYVVSYGEYTTKHMEFGSIAICFDEKND...GARAGKF....LGA.........PfPRA.GHVVRE.Q--....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------qteiarfpagsd..........................................................................................................................................................................................................................................
I1Z1A1_PLRV/214-698              .............SEPGP.S.P...Q.PTP.T.PTPQK..HERFI.AY...VGIPMLTIQARENDDQIILGSLGSQRMKYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNAD.SDY.WNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP.TDG.RFFLVGPAIQKTARYNYTISYGDWTDRDMELGLITVVLDEHLE...GTGSANR....VRR.........P.LRE.GHTYMA.SPR....EREGKPVGDK...PRD...ETPIQ..TQ...........ERQPD...Q..TP.SDD..V......S......D.AGSV......N.S....G...G...S......TESL...RL.DFGV....N....S..D.S...TYDA..TVD.....................................GTDWPR..I...P...PPR.H..PPEPRVSGNSRTVTD.FSPKADLLENWDAEHFDPGYSKEDVAAATIIAHGSIQDGRSMLEKREENVKNKTSSWKPP....LPKAVSPAIAKLRSIRKSQP.LEGGTLKE.......DATDGVSSIGSGSLTGGTLKRKATIEERLLQTLTTEQRLWYENLKKTNP.LAATQWMFEY......................................................................................................................................................................................................................................................
E2DRQ5_9LUTE/208-656             ............p-PPGP.S.P...P.PSP.S.PPPPV..PSRFW.GY...EGNPQCKILTAENNRNIDSRPLNFVSMYKWEDEKWDKVNLQAGYSRNDRRCMETYFVIPASRGKF.HVYLEADGEFVVKHIGGDRDGNWLGNIAYDVSQ.-RG.WNIGDYKGCRISNYQSNAVFVAGHPD...AEMDGKHFDAARAVEVDWFASFELTCDdEDG.AWRIYPPPIQKDSSYNYTVSYGDYTEKYCEWGAVSVSVDE-DN...STGTKSR....IK-.........P.-HK.GVMMWS.HPEkensEGESESETDQ...GKD..lKTPDA..TT...........---LV...D..FD.SDD..N......S......S.SKSA......E.S....I...P...D......NTDLnpwNA.VVSS....K....S..D.R...PFKQ..EDDrvstssrlsgnlrrpgsgnpqlrsplgrekapepsesDLDAAR..IkglP...PPR.E..Q--PPGFKPTRSIST.FNPEPDLVEAWRPG-TGPGYSKEDVAAATILAHGSIADGRSMLDKRDQEVLRSRSSWGTG....--------------------.--------.......-------------------------------------------------.----------gflkkmktsssd..........................................................................................................................................................................................................................................
F8RUL0_9LUTE/201-418             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIGQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVA------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------i.....................................................................................................................................................................................................................................................
C6GYU8_9LUTE/207-562             .......pgpspg--PSP.T.P...PpPPP.E.PTPPV..EERFI.VY...TGVAHTTILAQSTDDAISLRNIPDQRFRYIENENFYWFNIEAQWYSNTNIKAVPMFYFPIPEGQW.SVEISTEGYQATSSTTDPNKGRVDGLMAYDDS-.SEG.WNIGIGNNVEITNNKADNTWKYGHPN...LEINSCHFKQQQCLERDGVISCHVKTIgPSA.TIFVVAPPVQKLSKYNYAVSYGAWTERDMEIGLITVTLDEKRD...SGSARKK....ILRs......glP.EAT.NFTLAA.HPE...kENFGIQTSE-...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------splapaispkaqlltlsdsdseddplsaspdvgfggtrllvdtdiktipdpsvaeafvnsahvgedpwadvrafksaqrpprgpssvasgs...........................................................................................................................................................
A5A2Q2_BYDVP/569-651             ............v-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPlarqRLREAAKAPSTLLYERTS-K.KSNNFLTRfmeanrsPTTPAAPTVSTTS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
Q7T6K9_9LUTE/2-232               .........tmyl-----.-.-...-.---.-.-----..-----.--...-----------------------------WKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTN-QLVERDFSCSFYLEVP.QQG.YFGLEAPPIEKSDHFNFVVSHANFTDKILEWGSISVAIDEVND...G-----A....YNR.........S.KWD.KTAAMS.ARL....PTQVSALSEV...YTP...ETPEQ..PT...........DEGTE...S..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------mppapnpalgpdnp........................................................................................................................................................................................................................................
A5A2Y0_BYDVP/567-649             ............v-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPlarqRLREAAKAPSTLLYER-TPK.KSSNFLTRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
S4U1A3_9LUTE/1-76                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....KLREAANAPSTLLYG-KTPK.KSNNFLTRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRRSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
Q70FV9_9LUTE/2-234               ........nvtmy-----.-.-...-.---.-.-----..-----.--...----------------------------LWKDESWSIEQLPAGYRVNNRERAIPFVLFPVDKGRY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTVSNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.HFGLEAPPIEKSDHFNFVVSYANFTDKIMEWGSISVAIDEVND...GAY----....-SR.........S.KWD.KTTAMS.ARL....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------ptqvsapsevytpeapeesenegtestppapnpalgpdnp..............................................................................................................................................................................................................
V9PPM4_PLRV/214-698              .............SEPGP.S.P...Q.PTP.T.PTPQK..HERFI.AY...VGIPMLTIQARENDDQIILGSLGNQRMKYIEDENQNYTNISSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNAD.SDY.WNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP.TDG.RFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEHLE...GTGSANR....VRR.........P.PRE.GHTYMA.SPH....EPEGKPVGNK...PRD...ETPIQ..TQ...........ERQPD...Q..TP.SDD..V......S......D.AGSV......N.S....G...G...L......TESL...RL.GFGA....N....S..D.S...TYDA..TVD.....................................GTDWPR..I...P...LPR.H..PPEPRVSGNSRTVTD.FSPEADLLENWDAEHFDPGYSKEDVAAATIIAHGSIQDGRSMLEKREENVKNKASSWKPP....LSKAVSPAIAKLRSIRKSQP.LEGGTLKK.......DATDGVSSIGSGSLTGGTLKRKVTIEERLLQTLTTEQRLWYENLKKTNP.QAATQWLFEY......................................................................................................................................................................................................................................................
A5A2Y6_BYDVP/219-572             .............PQPTP.A.P...Q.PAP.E.PTPAP.aPKRFF.EY...IGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCLFTDGQIVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYRGYTNKRMEFGTISVTCD---E...SDVEAER....TTRha.....etP.IRS.KHILVS.EQY...eQPLPTIIDQG...LCD..vQTPEQ..EQtlv.....deeDKQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LM.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskpvDTSGNK..I...P...KPK.E..P--------------.-----EVLGTYQGQNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppiar.................................................................................................................................................................................................................................................
D7EZJ0_9LUTE/209-612             ...........psPSPTP.P.P...P.PPP.Q.PQPQP.cAQRFW.GY...EGNPQNKILTAENSRNIDSRPLNFVQMYKWEDEKWDKVNLQAGYSRNDRRCMETYLTIPADKGKF.HVYLEADGEFVVKHIGGELDGSWLGNIAYDVSQ.-RG.WNIGNYKGCKIKNYQSNTTFVAGHPD...ATMNSKSFDSARAVEVDWYASFELECDdEEG.SWAIYPPPIQKDSSYNYTVSYGNYTEKYCEWGAISVSIDE--D...NNGSAPR....--R.........I.PRK.GAMAWS.TP-....EPSFSGDESQ...RQD..fKTPSP..E-...........ERGSD...T..LE.SEE..T......K......E.E---......-.-....-...-...-......-ENL...LD.RFE-....-....E..E.N...IPDV..DDEdiwkgisrgs.................etgtteddraSTS-SR..L...RgnlKPQ.G..LPKP---QPTRTITK.FNPNPDLVEAWRP-DLAPGYSKADVAAATVIAGGSIHEGRDMLRRRDEKVMDSRKKW---....--------------------.--------.......-------------------------------------------------.----------gils..................................................................................................................................................................................................................................................
Q2L3G5_9LUTE/201-483             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLPAGYRVNNRERAIPFVLFPIDKGRY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTVSNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKIMEWGSISVAIDEVND...GA-----....YSR.........S.KWD.KTTAMS.ARL....PTQVSAPSEV...YNP...ETPEE..SE...........NEGTE...S..TP.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------papnpalgpdnpat........................................................................................................................................................................................................................................
Q45ZZ0_BYDVP/219-570             .............PQPTP.A.P...Q.PAP.E.PTPAP.vPKRFF.EY...IGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SINISCEGFQSVDHIGGNEDGYWIGMIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTFD---E...SDVEAKR....ITRha.....etP.IRS.KHILVS.ERY...eEPLPTITNQG...LCD..vKTPEQ..EQtlv.....deeDRQTV...S..TE.PDV..A......-......-.----......-.-....-...-...-......----...LQ.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskplDTSGNI..I...P...KSK.E..P--------------.-----EVLGTYQGQNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppl...................................................................................................................................................................................................................................................
Q99AS9_BYDVM/206-579             .........peptPQPQP.E.P...K.PDP.Q.PTPEP.qHKRFF.EY...VGTPYVIIQTRESSDSIAVKSMNDQSFRYIENETSEQRTVQAWWTSNNGVQAQAAFVFPIPAGEY.SVNISCEGLQSVDHIGGNRDGYWIGLIAYQNQS.GDY.WGVGNYAGCDITNLLGTNTWRPGHED...LELNGCKFTNGQIVERDAVISFHLKAQgADP.KFYLMAPKTMKSDKYNYVVSYGGYTDKRMQFGTISVTVD---E...SDVEAQR....YNRhtsavrkteN.LDY.GWMSVL.PPY....DPNQVPEQEE...EQP...MVDKG..MD...........SRSPV...E..PP.SPT..S......-......D.TEAE......R.AfdlrE...E...K......LTRA...RL.EYEA....A....T..E.S...IPDA..APD.....................................-----I..L...P...SKS.E..MSSRPIDHDGRSLPK.PQSK-EVLGTYQGQNITP----DDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppviae................................................................................................................................................................................................................................................
B0FKZ6_BYDVP/555-645             ....gqpiyaddv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPgtrqKLRDAAKAPSTLLYD-KTPK.RSKSILSR.......FVEGNRSSVESAAPS------TAT-----TSNLTREQLREYTRIRNSLGlTAAKEYKAR-l.....................................................................................................................................................................................................................................................
Q7T6J8_9LUTE/2-223               .........tmyl-----.-.-...-.---.-.-----..-----.--...-----------------------------WKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSSVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANITDKILEWGSISVAIDEVND...GAYS---....--R.........S.K--.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------wdkttamsarlptqvsapsevytpeapeqptnegtesmppap............................................................................................................................................................................................................
MCAPS_PLRV1/213-697              .............SEPSP.S.P...Q.PTP.T.PTPQK..HERFI.AY...VGIPMLTIQARENDDQIILGSLGSQRMKYIEDENQNYTKFSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNAD.SDY.WNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP.TDG.RFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEHLE...GTGSANR....VRR.........P.PRE.GHTYMA.SPH....EPEGKPVGNK...PRD...ETPIQ..TQ...........ERQPD...Q..TP.SDD..V......S......D.AGSV......N.S....G...G...P......TESL...RL.EFGV....N....S..D.S...TYDA..TVD.....................................GTDWPR..I...P...PPR.H..PPEPRVSGNSRTVTD.FSSKADLLENWDAEHFDPGYSKEDVAAATIIAHGSIQDGRSMLEKREENVKNKTSSWKPP....SLKAVSPAIAKLRSIRKSQP.LEGGTLNK.......DATDGVSSIGSGSLTGGTLKRKATIEERLLQTLTTEQRLWYENFKKTNP.PAATQWLFEY......................................................................................................................................................................................................................................................
B1A437_9LUTE/212-500             .............PDPTP.P.P...A.PPP.E.PTPAK..HERFI.VY...TGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVAQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQ.NKV.WNVGVQNNVTISNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTgPNA.SFFLVGPPVKKIAKYNYCISYGAWTDRDMEFGMVSVVLDEHLE...GVRGSQY....VRK.........T.LRP.GHISVN.RSH....RL--------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------qemppmredfseednsssdsntyktdnspltvhlvkagd...............................................................................................................................................................................................................
S4U5N6_9LUTE/1-77                ............a-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....KLREAANAPSTLLYE-KTPK.KSNNFLTRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRRSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
B0FKP4_BYDVP/203-563             ..sstpepkptpaPTPAP.A.P...E.PKP.E.PTPAP.pPKRFF.EY...VGTPVGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEASgKDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAFR....MTRhs.....ecP.TRV.NNILID.EGY...cQPLSTITDQG...LCD..vQTPGQ..DQev......veeDRQTV...S..TE.SDI..A......-......-.----......-.-....-...-...-......----...LK.EYEA....A....I..A.E...IPDA..EEDalpsre........................qlsskpvDTSGEE..I...P...KPR.P..L--------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------snevlgvyqgqtiyaddv....................................................................................................................................................................................................................................
S4U2K7_9LUTE/1-78                ...........rq-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....KLREAANAPSTLLYEK-TSN.KSNNFLTRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
MCAPS_BYDVP/218-571              .............PQPTP.A.P...Q.PTP.E.PTPAP.vPKRFF.EY...IGTPTGTISTRENTDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...LKLTDCQFTDGQIVERDAVMSFHVEATgKDA.SFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAER....ITRha.....etP.IRS.KHILVS.ERY...aEPLPTIVNQG...LCD..vKTPEQ..EQtlv.....dedDRQTV...S..TE.SDI..A......-......-.----......-.-....-...-...-......----...LL.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskpmDTSGNI..I...P...KPK.E..P--------------.-----EVLGTYQGQNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppmar.................................................................................................................................................................................................................................................
R9Q9M3_9LUTE/1-351               ..........myk-----.-.-...-.---.-.-----..-----.--...-----------------------------WEDEKWDKVNLQAGYSRNDRRCMETYLTIPADKGKF.HVYLEADGEFVVKHIGGELDGSWLGNIAYDVSQ.-RG.WNIGNYKGCKIKNYQSNTTFVAGHPD...ATMNSKSFDSARAVEVDWYASFELECDdEEG.SWAIYPPPIQKDSSYNYTVSYGNYTEKYCEWGAISVSIDE--D...NNGSAPR....--R.........I.PRK.GAMAWS.TP-....EPSFSGDESQ...RQD..fKTPSP..E-...........ERGSD...A..LE.SEE..T......-......-.----......-.-....-...K...E......EENL...LD.RFE-....-....E..E.N...IPDA..DDEdiwkgisrgs.................etgtteddraSTSS-R..L...RgnlKPQ.G..LPKP---QPTRTITK.FEPNPDLIEAWRP-DLAPGYSKADVAAATVIAGGSIHEGRDMLRRRDEKVMDSRKKW---....--------------------.--------.......-------------------------------------------------.----------gils..................................................................................................................................................................................................................................................
B3GQA5_PLRV/1-106                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.-----------------------------------------MLEKREENVKNKTSSWKPP....LPKAVSPAIAKLRSIRKSQP.LEGGTLKK.......DATDGVSSIGSGSLTGGTLKRKATIEERLLQTLTTEQRLWYENLKKTNP.LAATQWLFEY......................................................................................................................................................................................................................................................
B0ZT99_9LUTE/206-579             .........pepsPQPQP.E.P...K.PDP.Q.PTPEP.qHKRFF.EY...VGTPYVIIQTRESSDSIAVKSMNDQSFQYIENETSEQRTVQAWWTSNNGVQAQAAFVFPIPAGEY.SVNISCEGLQSVDHIGGNRDGYWIGLIAYQNQS.GDY.WGVGNYAGCDITNLLGTNTWRPGHED...LELNGCKFTNGQIVERDAVISFHVKAQgADP.KFYLMAPKTMKSDKYNYVVSYGGYTDKRMEFGSISVTVD---E...SDVEAQR....YNRhast.vrktE.NRDyGWMSVL.PPY....DPNQVPEQEE...EQP...MVDKE..MD...........PRSPV...E..PP.SPT..S......-......D.TEAE......R.AfdlrE...E...E......LTRA...RL.EYEA....A....T..E.S...IPDA..APD.....................................-----I..L...P...SKS.E..MSSKPIDHDGRSLPK.PQSK-EVLGTYQGQNITP----DDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------psviae................................................................................................................................................................................................................................................
E0YC37_9LUTE/209-329             .........aptp-PPPP.P.P...S.PSP.E.PKPCK..KDRFW.GY...EGVPQNKISAARNNQFIDVKTLNYVQMYKWEDDRWDRVNMQASYARNDRNYAEPYMVIPANKGKF.HVYVECDGQMAVKSIGGKADNSWNGLIAY----.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------......................................................................................................................................................................................................................................................
V5KXI8_9LUTE/201-479             ...........ap--PTP.I.T...T.PTPpA.PTPAP..APKYF.GY...QGVPSNIVKTRGNSEYPDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVND...GA-----....YSR.........S.KWD.KTTAMS.ARL....PTQVSAPSEV...YTP...ETPEQ..PA...........DEGTE...S..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------mppapnpalgpd..........................................................................................................................................................................................................................................
Q7T6K0_9LUTE/2-236               .........tmyl-----.-.-...-.---.-.-----..-----.--...-----------------------------WKDESWSIEQLPAGYRVNNRERAIPFVLFPVDKGRY.SVFVQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTVSNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKIMEWGSISVAIDEVND...GA-----....YSR.........S.KWD.KTTAMS.ARL....PTQVSAPSEV...YNP...ETPEE..SE...........NEGTE...S..TP.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------papnpalgpdnpatke......................................................................................................................................................................................................................................
A5A2Q2_BYDVP/221-573             ............p-GPTP.A.P...Q.PTP.E.PTPAP.aPKRFF.EY...VGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYRGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgNDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAKR....ITRha.....etP.IRY.KHILVS.ERY...eEPLPTITDQG...LCD..vKTPEQ..EQtlv.....deeDRQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LQ.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskplDTSGNI..I...P...KSK.E..P--------------.-----EVLGTYQGQNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppla..................................................................................................................................................................................................................................................
A5A2Z8_BYDVP/219-572             .............PQPTP.A.P...Q.PAP.E.PTPAP.vPKRFF.EY...IGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAER....ITRha.....etP.IRS.KHILVS.EQY...eQPLPTIIDQG...LCD..vQTPEQ..EQtlv.....deeDKQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LM.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskpvDTSGNK..I...P...KPK.E..P--------------.-----EVLGTYQGQNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppiar.................................................................................................................................................................................................................................................
Q84840_PLRV/5-489                .............SEPGP.S.P...Q.PTP.T.PTPQK..HERFI.AY...VGIPMLTIQARENDDQIILGSLGSQRMKYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGVIAYSNAD.SDY.WNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP.TDG.RFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEHLE...GTGSANR....VRR.........P.PRE.GHTYMA.SPR....EPEGKPVGNK...PRD...ETPIQ..TQ...........ERQPD...Q..TP.SDD..V......S......D.AGSV......N.N....S...G...S......TESL...QL.EFGV....N....S..D.S...TYDA..TVD.....................................GTDWPR..I...P...PPR.H..PPEPRVSGNSRTVID.FSPKADLLENWDAEHFDPGYSKEDVAAATIIAHGSIQDGRSMLEKREESVKNKTSSWKPP....LSKAVSPAIAKLRSIRKSQP.LEGGTLKK.......DATDGVSSIGSGSLTGGTLKRKVTIEERLLQTLTTEQRLWYENLKKTNP.PAAIQWLYEY......................................................................................................................................................................................................................................................
Q84829_PLRV1/5-489               .............SEPSP.S.P...Q.PTP.T.PTPQK..HERFI.AY...VGIPMLTIQARENDDQIILGSLGSQRMKYIEDENQNYTKFSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNAD.SDY.WNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP.TDG.RFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEHLE...GTGSANR....VRR.........P.PRE.GHTYMA.SPH....EPEGKPVGNK...PRD...ETPIQ..TQ...........ERQPD...Q..TP.SDD..V......S......D.AGSV......N.S....G...G...P......TESL...RL.EFGV....N....S..D.S...TYDA..TVD.....................................GTDWPR..I...P...PPR.H..PPEPRVSGNSRTVTD.FSSKADLLENWDAEHFDPGYSKEDVAAATIIAHGSIQDGRSMLEKREENVKNKTSSWKPP....SLKAVSPAIAKLRSIRKSQP.LEGGTLNK.......DATDGVSSIGSGSLTGGTLKRKATIEERLLQTLTTEQRLWYENFKKTNP.PAATQWLFEY......................................................................................................................................................................................................................................................
B0FKR2_BYDVP/556-643             .......iyaedv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPgtrqKLRDAAKAPSTLLYD-KTPK.RSKSILSR.......FIEGNRSSVESAAPS------TAT-----TSNLTREQLREYTRIRNTLGlTAAKEYKAR-l.....................................................................................................................................................................................................................................................
Q91GX4_BYDVP/364-448             ..........edv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPlarqRLREAAKAPSTLLYER-TPK.KSNNFLTRfveanrsPTTPAAPTVSTAS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
R9Q9K0_9LUTE/209-612             ...........psPSPTP.P.P...P.PPP.Q.PQPQP.cAQRLW.GY...EGNPQNKILTAENSRNIDSRPLNFVQMYKWEDEKWDKVNLQAGYSRNDRRCMETYLTIPADKGKF.HVYLEADGEFVVKHIGGELDGSWLGNIAYDVSQ.-RG.WNIGNYKGCKIKNYQSNTTFVAGHPD...ATMNSKSFDSARAVEVDWYASFELECDdEEG.SWAIYPPPIQKDSSYNYTVSYGNYTEKYCEWGAISVSIDE--D...NNGSAPR....--R.........I.PRK.GAMAWS.TP-....EPSFSGDESQ...RQD..fKTPSP..E-...........ERGSD...A..LE.SEE..T......-......-.----......-.-....-...K...E......EENL...LD.RFE-....-....E..E.N...IPDA..DDEdiwkgisrgs.................etgtteddraSTSS-R..L...RgnlKPQ.G..LPKP---QPTRTITK.FEPNPDLIEAWRP-DLAPGYSKADVAAATVIAGGSIHEGRDMLRRRDEKVMDSRKKW---....--------------------.--------.......-------------------------------------------------.----------gils..................................................................................................................................................................................................................................................
I1XV11_PLRV/214-698              .............SEPGP.S.P...Q.PTP.T.PTPQK..HERFI.AY...VGIPMLTIQARENDDQIILGSLGSQRMKYIEDENQNYTNISSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNAD.SDY.WNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP.TDG.RFFLIGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEHLE...GSDSAHR....LRR.........P.PRE.GHTYMV.SPN....EPEGKPVENK...PRD...ETPIQ..TQ...........ERKPD...Q..TP.SHD..V......S......D.AGSV......N.S....G...G...S......TESL...QL.EFGL....N....S..D.S...THDA..TVD.....................................GADWPR..I...P...PPR.H..PPEPRDSGNSRTVTD.FSPKADLLENWDAEHFDPGYSKEDVAAATLIAHRSIQDGRSMLEKREESVKRKTSSWKPP....LPKAVSPAIAELRSIRKTQP.LEGGTLNK.......GTTDGASTIGSGSLTGGTFKRKQTYEERLLQTLTTEQRLWYENLKKTDP.GAATQWLFE-n.....................................................................................................................................................................................................................................................
Q91QR1_9LUTE/9-310               ...........pgPDPAP.Q.P...T.PTP.E.PTPAK..HERFI.AY...TGTLSTLISARQSSDSISLYSIRSQRIRYIEDENSSWTNIDAKWYSQNSVEAIPMFVYPVPEGTW.SIEISCEGYQAASSTSDPHRGKCDGMIAYDDDS.SKV.WNVGQQNNVTITNNKADNDWKYGHPD...LTINGDRFDQNQVVEKDGIISFHLVTTgPNA.SFFLVAPAVKKTAKYNFCVSYGDWTDRDMEFGMVSVVLDEHLE...GARSSQY....VRK.........T.PRS.GHVGVN.RSH....RLQDNFVPTE...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------yvsdedsssnssivsnrpstpdndsdakfaesmkgklpsqtk............................................................................................................................................................................................................
Q99GS1_PLRV/5-489                .............SEPGP.S.P...Q.PTP.T.PTPQK..HERFI.AY...VGIPMLTIQARENDDQIILGSLGNQRMKYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNAD.SDY.WNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP.TDG.RFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEHLE...GSGSANR....VRR.........P.PRE.GHTYMA.SPR....EPEGKPVENK...PRD...ETPIQ..TQ...........ERQPD...Q..TP.SDD..V......S......D.AGSV......N.S....G...G...S......TESL...RL.EFGV....N....S..D.N...TYDA..TVD.....................................GTDWPR..I...P...PPR.H..PPEPRVSGNSRTVTD.FSTKADLLENWDAEHFDPGYSKEDVAAATIIAHVSIQDGRSMLEKREENIKNKTSSWKPP....LPKAVSPAIAKLRSIRKSQP.LEGGTLKK.......DATDGVSSIGSGSLTGGTLKRKATIEERLLQTLTTEQRLWYENLKKTNP.LAATQWLFEY......................................................................................................................................................................................................................................................
A5A310_BYDVP/219-572             .............PQPTP.A.P...Q.PAP.E.PTPAP.aPKRFF.EY...IGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHMGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAER....ITRha.....etP.IRS.KHILVS.EQY...eQPLPTIIDQG...LCD..vQTPEQ..EQtlv.....deeDKQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LM.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskpvDTSGNK..I...P...KPK.E..P--------------.-----EVLGTYQGQNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppiar.................................................................................................................................................................................................................................................
G3E238_9LUTE/1-283               ............m-----.-.-...-.---.-.-----..-----.--...-----------------------------------NWTNVDARWYSSNNVKAVPMYVFPVPEGTW.SVEISTEGYQPTASTTDPNKGKVDGMIAYSDDQ.SEV.WNVGINQNCNITNLKADNSWKYGHPD...MEINNCHFNQGQVLEMDGTISFHVETTgSDA.SFFLVGPAVQKQSKYNYAVSYGAWTDRDMELGLISVSLDEKDG...SRGSA--....MKR.........P.RRE.GHSKAV.STW....ETINLPEKEN...SEK...SITSQ..RQd.........sKTQPQ...Q..GF.SDA..G......S......E.DN--......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------kerdftpgtrmflpedfeeprevqnddllrdrgivvdpslleipdspppradhkdtd.............................................................................................................................................................................................
F8RUJ2_9LUTE/201-418             ...........ap--PTP.I.T...T.PTPpA.PTPAP..APKYF.GY...QGVPSNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVA------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------i.....................................................................................................................................................................................................................................................
MCAPS_PEMVW/198-469              ..........pgp-DPGP.Q.P...P.PPP.P.PSPTP.vGARFW.GY...EGVPESRMISERNDHDIDVKPLSFITMYKWEDESWTSVKLSASYLQNDQVEATPYFLIPSSKGKF.SVYIECEGFQAVKSIGGKSDGCWGGLIAY-NRK.KDG.WQARAYTGTVLSNYRSTTTVINGHPD...CEVNDCKFKPDRGVESDLICSFHLEAE.EDS.YWALQAPPIQKSSDYNYVVSYGGYTEKSIEWGSVSISID-EVN...QTASASP....WRG.........R.AR-.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------klailqetavpppfppggvmdyhlgdregdqtgt....................................................................................................................................................................................................................
I1Z196_PLRV/1-106                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.-----------------------------------------MLEKREENVKNKTSSWKPP....LSKAVSPAIAKLRSIRKSQP.LEGGTFEK.......DATDGVSSIGSGSLTGGTLKRKATIEERLLQTLTTEQRLWYENLKKTNP.PAATQWLFEY......................................................................................................................................................................................................................................................
Q8B6M2_9LUTE/9-310               ...........pgPDPAP.Q.P...T.PTP.E.PTPAK..HERFI.AY...TGTLSTLISARQSSDSISLYSIRSQRIRYIEDENSSWTNIDAKWYSQNSVEAIPMFVYPVPEGTW.SIEISCEGYQAASSTSDPHRGKCDGMIAYDDDS.SKV.WNVGQQNNVTITNNKADNDWKYGHPD...LTINGDRFDQNQVVEKDGIISFHLVTTgPNA.SFFLVAPAVKKTAKYNFCVSYGDWTDRDMEFGMVSVVLDEHLE...GARSSQY....VRK.........T.PRS.GHVGVN.RSH....RLQDNFVPTE...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------yvsdedsssnssivsnrpstpdndsdaqfaesmkgklpsqtk............................................................................................................................................................................................................
B0FKQ0_BYDVP/560-642             ............v-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPvarqALREAAKAPSTMLYDR-APK.GAKSILSRfvegnrsKAAPVAPSVSTTS------------------NMTREQLKEYTRIRNSLGvTAAKEYKAQF......................................................................................................................................................................................................................................................
Q80J50_9LUTE/206-579             .........peptPQPQP.E.P...K.PDP.Q.PTPEP.qHKRFF.EY...VGTPYVIIQTRESSDSIAVKSMNDQSFQYIENETSEQRTVQAWRTSNNGVQAQAAFVFPIPAGEY.SVNISCEGLQSVDHIGGNRDGYWIGLIAYQNQS.GDY.WGVGNYAGCDITNLLGTNTWRPGHED...LELDGCKFTNGQIVERDAVISFHVKAQgADP.KFYLMAPKTMKSDKYNYVVSYGGYTDKRMEFGSISVTVD---E...SDVEAQR....YNRhtst.vgkaE.NRDyGWMSVL.PPY....DPNQVPEQEE...EQP...MVDKE..MD...........SRPPV...E..PP.SPT..S......-......D.TEAE......R.AfdlrE...E...E......LTRA...RL.EYEA....A....T..E.S...IPDA..APD.....................................-----V..L...P...SKS.E..MSSRPIDHDGRSLPK.PQSK-EVLGTYQGQNITP----DDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppviae................................................................................................................................................................................................................................................
Q45ZY5_BYDVP/219-573             .............PQPTP.A.P...Q.PAP.E.PTPAP.vPKRFF.EY...IGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SINISCEGFQSVDHIGGNEDGYWIGMIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTFD---E...SDVEAKR....ITRha.....etP.IRS.KHILVS.ERY...eEPLPTITNQG...LCD..vKTPEQ..EQtlv.....deeDRQTV...S..TE.PDV..A......-......-.----......-.-....-...-...-......----...LQ.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskplDTSGNI..I...P...KSK.E..P--------------.-----EVLGTYQGQNIHP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------pplarq................................................................................................................................................................................................................................................
J7FE72_9LUTE/207-611             ........pppsp-SPTP.PpP...P.PPP.Q.PQPQP.cVQRFW.GY...EGNPQNKILTAENSRNIDSRPLNFVQMYKWEDEKWDKVNLQAGYTRNDRRCMETYLTIPADKGKF.HVYLEADGEFVVKHIGGELDGSWLGNIAYDVSQ.-RG.WNIGNYKGCKIKNYQSNTTFVAGHPD...ASMNGKNFDAARAVEVDWFASFELECDdEEG.SWAIYPPPIQKDSSYNYTVSYGNYTEKYCEWGAISVSIDEDND...----GGM....PRR.........I.PRK.GAMTWS.SPE....PSFSGDLSQR...Q-D..fKTPSP..E-...........ERGSD...T..LE.SET..Ere..eeN......P.LNRL......E.E....-...-...-......----...--.----....-....-..-.S...IPDV..DEDywtgiplgs..................taattegdraSTSSRLrgN...L...KPK.G..LPQPQ---PTRTITK.FNPDPDLVEAWRP-DLAPEYSKADVAAATVIAGGSIHEGRDMLRRRDEKVMESRKKW---....--------------------.--------.......-------------------------------------------------.----------gils..................................................................................................................................................................................................................................................
Q65874_9LUTE/11-333              ...........psPDPPP.P.P...S.PSP.E.PAPAK..EERFI.VY...SGVAHTIISAQSTDDSIIVRDIPDQRFRYVENENFYWFQIAAQWYSNTNTKAVPMFVFPVPIGEW.SVEISTEGYQATSSTTDPNKGRIDGLIAYDNS-.SEG.WNIGAGSNVTITNNKADNSWKYGHPD...LEINSCHFNQNQVLEKDGIISFHVKATeKEA.NFFLVAPPVQKTSKYNYAVSYGAWTDRDMEFGLITVTLD---E...KRGSGSP....TRK.........S.LRA.GHAGVT.TTTd..lVALPEMENSG...IET..sETPSApvTS...........SKAPL...P..TV.SDS..E......S......E.DD--......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------plsaapdvgfggtrllidtdiktipdpdvadafvns..................................................................................................................................................................................................................
B0FEU6_PLRV/1-106                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.-----------------------------------------MLEKREENVKNKTSSWKPP....LSEAVSPAIAKLRSIRKSQP.LEGGTLKK.......DVTDGVSSIGSGSLTGGTLKRKETIEERLLQTLTTEQRLWYENLKKTNP.PAAIQWLYEY......................................................................................................................................................................................................................................................
O92521_9LUTE/18-375              .............PQPTP.A.P...Q.PAP.E.PTPAP.vPKRFF.EY...IGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSYiSVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHAD...LKLNDCQFPDGQIVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVQAERkfspLTRha.....etT.IRS.KHILVS.ERY...eEPLPTVINQG...LCD..vKTPEQ..EQtlv.....deeDRQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LQ.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskplDTSVNI..I...P...KPK.E..P--------------.-----EVLGTYQGQNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppla..................................................................................................................................................................................................................................................
Q8QYP9_PLRV/214-698              .............SEPGP.S.P...Q.PTP.T.PTPQK..HERFI.AY...VGIPMLTIQARENDDQIILGSLGSQRMKYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNAD.SDY.WNVGEADGVKISKLCNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP.TDG.RFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEHLE...GTGSAYR....VRR.........P.PRE.GHTYMA.SPR....EPEGKPVGNK...PRD...ETPIQ..TQ...........ERQPD...Q..TP.SDD..V......S......D.AGSV......N.S....G...G...S......TESL...QL.EFGP....N....S..D.S...TYDA..TVD.....................................GTDWPR..I...P...PPR.H..PPKPRVSGDSRTVTN.FSPKADLLENWDAEHFDPGYSKEDVAAATIIAHGSIQDGRSMLEKREENVKNKTSSWKPP....LPKAVSPAIAKLRSIRKSQP.LEGGTLKK.......DATDGVSSIGSGSLTGGTLKRKVTIEERLLQTLTTEQRLWYENLKKTNP.PAAIQWLHEY......................................................................................................................................................................................................................................................
B0FKQ6_BYDVP/555-643             .....qpiyaddv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPiarqKLRDAAKAPSTMLYDK--AP.KSKSFLSRfvegnrsKVENTAPSTATTS------------------NLTREQLREYTRIRNSLGlTAAREYKAQF......................................................................................................................................................................................................................................................
S4U4K8_9LUTE/1-74                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--REAANAPSTLLYE-KTSK.KSNNFLTRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRRSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
A5A328_BYDVP/565-649             ..........edv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPiarqKLREAANAPSTLLYE-KTPK.KSNNFLTRfveanrsPTTPAAPSVSTVS------------------NMTREQLAEYTRIRRSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
A5A2P7_9LUTE/217-556             ............sPDPPP.P.P...S.PSP.E.PAPVK..EERFI.VY...SGVAHTIISAQSTDDSIIVRDIPDQRFRYVENENFYWFQIAAQWYSNTNTKAVPMFVFPVPIGEW.SVEISTEGYQATSSTTDPNKGRIDGLIAYDNS-.SEG.WNIGAGSNVTITNNKADNSWKYGHPD...LEINSCHFNQNQVLEKDGIISFHVKATeKEA.NFFLVAPPVQKTSKYNYAVSYGAWTDRDMEFGLITVTLD---E...KRGSGSP....TRK.........S.LRA.GHAGVT.TTTd..lVTLPEKENSG...IET..sETPSA..PVt.........sSKAPL...P..TV.SDS..E......S......E.DDPL......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------saapdvgfggtrllidtdiktipdpdvadafvnsahvgndpwaevrafknaq..................................................................................................................................................................................................
B0FKP4_BYDVP/554-645             ...qgqtiyaddv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPgtrqKLRDAAKAPSTLLYD-KTPK.RSKSILSR.......FLEGNRSSVESAAPS------TAT-----TSNLTREQLREYTRIRNTLGlTAAKEYKAR-l.....................................................................................................................................................................................................................................................
Q8QYM7_PLRV/1-106                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.-----------------------------------------MLEKREENVKNKTSSWKPP....LSKAVSPAIAKLRSIRKSQP.LEGGTLNK.......DATDGVSSIGSGSLTGGTLKRKVTIEDRLLQTLTTEQRLWFENLKKTNP.PAATQWLYEY......................................................................................................................................................................................................................................................
V9PNP2_PLRV/214-698              .............SEPGP.S.P...Q.PTP.T.PTPQK..HERFI.AY...VGIPMLTIQARENDDQIILGSLGSQRMKYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNAD.SDY.WNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP.TDG.RFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEHLE...GTGSANR....VRR.........P.LRE.GHTYMA.SPR....EPEGKPVGNK...PRD...ETPIQ..TQ...........ERQPD...Q..TP.SDD..V......S......D.AGSV......N.S....G...G...S......TESL...QL.EFGV....N....S..D.S...TYDA..TVD.....................................GTDWPK..I...P...PPR.H..PPEPRDSGNSRTVTD.FSPKADLLENWDAKHFDPGYSKEDVAAATIIAHGSIQDGRSMLEKREENVKNKTSSWKPP....LPKAVSPAIAKLRSIRKSQP.LEGGTLKK.......DATDGVSSIGSGSLTGGTLKRNVTIEERLLQTLTTEQRLWYENLKKTNP.PAATQWLFEY......................................................................................................................................................................................................................................................
S4U5M7_9LUTE/1-76                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....KLREAANAPSTLLYG-KTPK.KSNNFLTRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRRSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
Q8QYM9_PLRV/214-698              .............SEPGP.S.P...Q.PTP.T.PTPQK..HERFI.AY...VGIPMLTIQARENDDQIILGSLGNQRMKYIEDENRSYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNAD.SDY.WNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP.TDG.RFFLVGPAVQKTAKYNYTISYGDWTDRDMELGLITVVLDEHLE...GTDSANR....VRR.........P.PRE.GHTYMA.SPR....EPEGKPVGNK...PRD...ETPIQ..TQ...........ERQPD...Q..TP.SDD..V......S......D.AGSV......N.S....G...G...S......TESL...RL.EFGV....N....S..D.S...TYDA..TVD.....................................GTDWPR..I...P...PPR.H..PPEPRVSGNSRTVTD.FSPETDLLENWDAKHFDPGYSKEDVAAATIIAHGSIQDGRSMLEKREENVKNKTSSWKPP....LSKAVSPAIAKLRSIRKSQP.LEGGTLNK.......DATDGVSSIGSGSLTGGTLKRKVTIEDRLLQTLTTEQRLWFENLKKTNP.PAATQWLYEY......................................................................................................................................................................................................................................................
B0FKZ6_BYDVP/203-562             ..sstpepkptpaPTPAP.T.P...E.PKP.E.PTPAP.pPKRFF.EY...VGTPIGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEASgKDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEALR....MTRhs.....ecP.TRV.NNILID.EGY...cQPLSTIIDQG...LCD..vQTPGQ..SQev......veeDRQTV...S..TE.SDI..A......-......-.----......-.-....-...-...-......----...LK.EYEA....A....I..A.E...IPDA..EEDalpsre........................qlsskpvDTSGEE..I...P...KPR.P..PS-NE----------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------vlgvyqgqpiyadd........................................................................................................................................................................................................................................
C7AXW6_BYDVP/38-187              .............PQPTP.A.P...Q.PAP.E.PTPAP.vPERFF.EY...IGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNSNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAHSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGH--...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------......................................................................................................................................................................................................................................................
B0FKZ0_BYDVP/203-562             ..sstpepkptpaPTPAP.T.P...E.PKP.E.PTPAP.pPKRFF.EY...VGTPIGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEASgKDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEALR....MTRhs.....ecP.TRA.NNILID.EGF...cQPLSTITDQG...LCD..vQTPGQ..EQev......veeDRQTV...S..TE.SDI..A......-......-.----......-.-....-...-...-......----...LK.EYEA....A....T..A.E...IPDA..EEDalpsre........................qlsskpvDTSGEE..I...P...KPR.P..PS-NE----------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------vlgvyqgqpiyadd........................................................................................................................................................................................................................................
D4P4W1_9LUTE/199-477             .........sdap--PTP.T.P...T.PTPpA.LTPAP..ASKYL.GY...QGVPSNIVKTRGNSEYLDVGPLENVTMYLWQDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYKTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFSLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVND...GAY----....-SR.........S.KWD.KTAAMS.ARL....PTQVSAPSEV...YTP...ETPEQ..PT...........DEGT-...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------esmppapnpalg..........................................................................................................................................................................................................................................
F8RUC9_9LUTE/201-479             ...........ap--PTP.T.P...T.PTPpA.PTPAP..ASKYL.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVND...GA-----....YSR.........S.KWD.KTTAMS.ARL....PTQVSAPSEV...YTP...ETPEQ..PA...........DEGTE...S..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------mppapnpalgpd..........................................................................................................................................................................................................................................
E3UIL9_PEMV1/198-468             ..........pgp-DPGP.Q.P...P.PPP.P.PSPTP.vGARFW.GY...EGVPESRMISERNDHDIDVKPLSFITMYKWEDESWTSVKLSASYLQNDQVEATPYFLIPSSKGKF.SVYIECEGFQAVKSIGGKSDGCWGGLIAY-NRK.KDG.WQARAYTGTVLSNYRSTTTVINGHPD...CEVNDCKFRPDRGVESDLICSFHLEAE.EDS.YWALQAPPIQKSSDYNYVVSYGGYTEKSIEWGSVSISID-EVN...QTASASP....WRG.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------rarklailqetavpppfppggvmdyrlgnregdqtg..................................................................................................................................................................................................................
C7AXX0_BYDVP/38-187              .............PQPAP.A.P...Q.PAP.E.PTPAP.vPKRFF.EY...IGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGH--...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------......................................................................................................................................................................................................................................................
D2K8T5_9LUTE/201-265             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDES-------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------wsieql................................................................................................................................................................................................................................................
A5A304_BYDVP/567-649             ............v-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPiarqKLREAANAPSTLLYER-TPK.KGNNFLTRfleanrsPTTPAAPTVSTIS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
L7YEQ5_9LUTE/208-612             ............p-GPSP.G.P...S.PSP.Q.PTPSK..KYRFI.VY...TGVPVTRIMAQSTDDAISLYDMPSQRFRYIEDENMNWTNLDSRWYSQNSLKAIPMIIVPVPQGEW.TVEISMEGYQPTSSTTDPNKDKQDGLIAYNDDL.KEG.WNVGVYNNVEITNNKADNTLKYGHPD...MELNSCHFNQGQCLERDGDLTCHVKTTgDNA.SFFVVGPAVQKQSKYNYAVSYGAWTDRMMEIGMIAIALDEQ--...GSSGSAK....IER.........P.KRV.GHSMAV.STW....ETINLPEKEN...SGE...FKTDQ..RQ...........DLKTP...P..TS.GG-..S......S......D.MPDI......V.Q....G...GlplP......IEED...IP.DFIR....D....DpwS.N...IPA-..--Ktsr..............................edeaASSKSG..F...K...PQL.K..PPGLPKPQPVRTIRN.FDPEPDLVEAWRP-DVNPGYSKEDVAAATVMYGGSVNEGRSMIDKRDKAVLDGRKSW---....--------------------.--------.......-------------------------------------------------.----------gssl..................................................................................................................................................................................................................................................
Q6STE7_9LUTE/172-238             ..........prp-GPSP.D.P..pP.PTP.E.PTPAK..EERFI.VY...SGVAHSNISAQGTDDSIIVRDIPDQRFRYVENENF------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------ywfqi.................................................................................................................................................................................................................................................
M4GJZ2_9LUTE/201-456             ...........ap--PTP.T.P...Q.PTPpA.PAPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGQLDSVTMYLWKDESWSIEQLPAGYRVNTQDRAIPYLLIPVEKGKY.SVFIQCEGFKAVKAKGGTNNGKMSGFIC-DNIN.LQG.WRAYAYSGCSISNYKTADSNVPGHPD...MRVNNCSFTD-QLVERDFSCSFHLEVP.QKG.YFGLEAPPIERSDHFNFVVSYANFTEKTMEWGSVSIAIDEVSD...GAYS---....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------gskwdkttamsarlrdlvsapseiytpva.........................................................................................................................................................................................................................
Q7T6J6_9LUTE/2-223               .........tmyl-----.-.-...-.---.-.-----..-----.--...-----------------------------WKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGANDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVND...GAYS---....--R.........S.K--.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------wdkttamsarlptqvsapsevytpeapeqptnegtesmppap............................................................................................................................................................................................................
F8RUM5_9LUTE/201-418             ...........ap--PTP.T.P...T.PTPpA.PTPAP..GPKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVA------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------i.....................................................................................................................................................................................................................................................
D4P4U7_9LUTE/201-265             ...........ap--PTP.T.P...I.PTPpA.PTPAP..ASKYL.GY...QGVPSNIVKTRGNSEYLDVGPLENVTMYLWQDES-------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------wsieql................................................................................................................................................................................................................................................
R4I816_9LUTE/9-412               ...........pgPSPTP.P.P...P.PPP.Q.PQPQP.rAPRFW.GY...EGNPQNKILTAENSRNIDSRPLNFVQMYKWEDERWDKVNLQAGYSRNDRRCMETYLTIPADKGKF.HVYLEADGEFVVKHIGGELDGSWLGNIAYDVSQ.-RG.WNIGNYKGCKITNYQSNTVFVAGHPD...ATMNGKSFDTARAVEVDWFASFELECDdEEG.SWAIYPPPIQKDSSYNYTVSYGNYTEKYCEWGAISVSID---E...DNDNGDV....PRR.........I.PRK.GAMAWS.TP-....EPSFSGDDSQ...RQD..fNTPSP..K-...........ERGSD...I..LE.SEE..K......KeednllD.LEEE......N.I....P...-...D......VDDD...DL.WKGI....S....R..A.S...AAGT..TEDd..................................raSTSS-R..L...RgnlKPK.G..LPKPQ---PTRTITE.FNPEPDLIEAWRP-DLAPGYSKADVAAATVIAGGSIHEGRDMLERREAKVMDSRKKW---....--------------------.--------.......-------------------------------------------------.----------gils..................................................................................................................................................................................................................................................
A5A2V0_BYDVP/219-571             .............PQPTP.A.P...Q.PAP.E.PTPAP.vPKRFF.EY...IGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAER....ITRha.....etP.IRS.KHILVS.EQY...eQPLPTIIDQG...LCD..vQTPEQ..EQtlv.....deeDKQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LM.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskpvDTSGNK..M...P...KPK.E..P--------------.-----EVLGTYQGQNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppva..................................................................................................................................................................................................................................................
B0FL02_BYDVP/565-649             ..........edv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPlarqKLREAAKAPTTLLYER-TPK.KSSNILTRylesnrsPTTPAAPSVSTVS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
B7TWD1_9LUTE/212-500             .............PDPTP.P.P...A.PPP.E.PTPAK..HERFI.VY...TGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQ.NKV.WNVGVQNNVTISNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTgPNA.SFFLVGPPVKKIAKYNYCISYGAWTDRDMEFGMVSVVLDEHLE...GVRGSQY....VRK.........T.LRP.GHISVN.RTH....RL--------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------qemppmredfseednsssdsntyktdnspltvhlvkagd...............................................................................................................................................................................................................
I1XV29_PLRV/214-698              .............SEPGP.S.P...Q.PTP.T.PTPQK..HERFI.AY...VGIPMLTIQARENDDQIILGSLGNQRMKYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYPNAD.SDY.WNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP.TDG.RFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEHLE...GTGSANR....VRR.........P.PRE.GHTYMA.SPR....EPEGKPVGNK...PRD...ETPIQ..TQ...........ERQPD...Q..TP.SDD..V......F......D.AGSV......N.N....G...G...S......TESL...QL.EFGV....N....S..D.S...TYDA..TVD.....................................GTDWPR..I...P...LPG.H..PPEPRVSGNSRTVTD.FSPEADLLENWDAEHFDPGYSKEDVAAATIIAHGSIQDGRSMLEKREENVKNKTSSWKPP....LPKAVSPAIAKLRSIRKSQP.LEGGTLKK.......DATDGVSSIGSGSLTGGTLKRKVTIEERLLQTLTTEQRLWYENLKKTNP.LAATQWLFEY......................................................................................................................................................................................................................................................
MCAPS_TYYVF/208-612              ............p-GPSP.G.P...S.PSP.Q.PTPQK..KYRFI.VY...TGVPVTRIMAQSTDDAISLYDMPSQRFRYIEDENMNWTNLDSRWYSQNSLKAIPMIIVPVPQGEW.TVEISMEGYQPTSSTTDPNKDKQDGLIAYNDDL.SEG.WNVGIYNNVEITNNKADNTLKYGHPD...MELNGCHFNQGQCLERDGDLTCHIKTTgDNA.SFFVVGPAVQKQSKYNYAVSYGAWTDRMMEIGMIAIALDEQ--...GSSGSVK....TER.........P.KRV.GHSMAV.STW....ETIKLPEKGN...SEG...YETSQ..RQ...........DSKTP...P..TA.SGG..S......-......D.TLDV......E.E....G...GlplP......VEEE...IP.DFVG....Dn.pwS..DlS...TKNS..QEEe..................................amSSESGL..R...P...QLK.P..P-GLPKPQPIRTIRN.FDPTPDLVEAWRP-DVNPGYSKADVAAATIIAGGSIKDGRSMIDKRNKAVLDGRKSW---....--------------------.--------.......-------------------------------------------------.----------gssl..................................................................................................................................................................................................................................................
Q2L3H7_9LUTE/201-479             ...........ap--PTP.T.P...T.PTPpA.PTPAP..ASKYL.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWQDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVND...GA-----....YSR.........S.KWD.KTTAMS.ARL....PTQVSAPSEV...YTP...ETPEQ..PT...........DEGTE...S..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------mppapnpalgpd..........................................................................................................................................................................................................................................
C7AXX1_BYDVP/38-187              .............PQPTP.A.P...Q.PAP.E.PTPAP.vPKRFF.EY...IGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGH--...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------......................................................................................................................................................................................................................................................
B3GQA1_PLRV/214-698              .............SEPGP.S.P...Q.PTP.T.PTPQK..HERFI.AY...VGIPMLTIQARENDDQIILGSLGNQRMKYIEDENQNYTNISSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNAD.SDY.WNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP.TDG.RFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEHLE...GTGSANR....VRR.........P.PRE.GHTYMA.SPR....EPEGKPVGNK...PRD...ETPIQ..TQ...........ERQPD...Q..TP.SDD..V......S......D.AGSV......N.S....G...G...S......TESL...RL.EFGV....N....S..D.S...TNDA..TVD.....................................GTHWPR..I...P...PPR.H..PPEPRVSGNSRTVTD.FSPKADLLENWDAEHFDPGYSKEDVAAATIIAHGSIQDGRSMLEKREENVKNKTSSWKPP....LPKAVSPAIAKLRSIRKSQP.LEGGTLKK.......DATDGVSSIGSGSLTGGTLKRKATIEERLLQTLTTEQRLWYENLKKTNP.LAATQWLFEY......................................................................................................................................................................................................................................................
I1Z187_PLRV/1-106                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.-----------------------------------------MLEKREENVKNKTSSWKPP....LPKAVSPAIAKLRSLRKSQP.LEGGTLKK.......DATDGVSSIGSGSLTGGTLKRKVTIEERLLQTLTTEQRLWYENLKKTNP.QAATQWLFEY......................................................................................................................................................................................................................................................
R9Q9K4_9LUTE/1-221               .............-----.-.-...-.---.-.-----..-----.--...------------------------------------------------------MYVFPVPEGAW.SVEISTEGYQPTASTTDPNKGKVDGMIAYSDDQ.SEV.WNVGINQNCNITNLKADNSWKYGHPD...MEINNCHFNQGQVLEMDGTISFHVETTgSDA.SFFLVGPAVQKQSKYNYAVSYGAWTDRDMELGLISVSLDEKDG...SRGSA--....MKK.........P.RRE.GHSKAV.STW....ETINLPEKEN...SEK...SITSQ..RQd.........fKTQPQ...Q..GF.SDA..G......S......E.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------dnkewdftpgtrmflpe.....................................................................................................................................................................................................................................
S4U5M9_9LUTE/1-75                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....-LREAANAPSTLLYE-KTPK.KSNNFLTRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRRSFGlTAAKEYKAQF......................................................................................................................................................................................................................................................
B0FL14_BYDVP/555-645             ....gqsiyaedv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPgtrqKLRDASKAPSTLLYD-KTPK.RSKSILSR.......FIEGNRSSVESAAPS------TAT-----TSNLTREQLREYTRIRNTLGlTAAKAYKAQF......................................................................................................................................................................................................................................................
E5GAA9_9LUTE/211-617             ......papapqp-PPPP.P.P...S.PSP.E.PQPCK..KDRFW.GY...EGVPQNKISAARNDQFIDVKSLNYVQMYKWEDDRWDRINMQANYSRNDRNYAEPYMIIPANKGKF.HVYVECNGQMAVKSIGGKADNSWNGMIAYDTS-.RRA.WDVGNYKGCVITNYQKNNTFVAGHPD...VELNNCKFTSSRGVECDCYLSFQLTCDdDDG.AWMLYAPPIPKGDKYNYSVSYGEYVDRNCEWGAVSISID---E...DNSTGNE....IKM.........K.PMK.GAMHWS.---....EPVDFARESQ...RQD..fKTPSP..-P...........ERGTD...D..LE.SEK..K......-......-.----......-.-....-...K...E......EENL...LN.ELE-....-....-..E.R...IPDA..NEDfwegmpvr....................ststtegdrASTGSR..L...R...GTL.K..PPGLPKPQPTRTITE.FRPNPDLVEAWRP-DLAPTYSKADVAAATVIAGGSVHEGREHLKRREEAVLNNRERWGPL....--------------------.--------.......-------------------------------------------------.----------savss.................................................................................................................................................................................................................................................
B1A410_9LUTE/212-500             .............PDPTP.P.P...A.PPP.E.PTPAK..HERFI.VY...TGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVPQGTW.SVEISCEGYQATSSTTDPHRGKSDGMIAYDDDQ.TKV.WNVGVQNNVTITNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTgPNA.SFFLAGPAVKKIAKYNFCISYGAWTDRDMEFGLVSVVLDEHLE...GVRGSQY....VRK.........T.LRP.GHISVN.RTH....RL--------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------qemppmredfseednsssdsntyktdnspltvhlvkagd...............................................................................................................................................................................................................
Q7T6K6_9LUTE/2-222               .........tmyl-----.-.-...-.---.-.-----..-----.--...-----------------------------WKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVND...GAYS---....--R.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------skwdkttamsarlpaqvsapsevytpeapeqptnegtesmppa...........................................................................................................................................................................................................
U5LV62_9LUTE/206-579             .........sepsPQPQP.E.P...K.PDP.Q.PTPEP.qHKRFF.EY...VGTPYAIIQTRESSDSIAVKSMNDQSFQYIENETSEQRTVQAWWTSNNGVQAQAAFVFPIPAGEY.SVNISCEGLQSVDHIGGNRDGYWIGLIAYQNQS.GDY.WGVGNYAGCDITNLLGTNTWRPGRED...LELDGCKFTNGQIVERDAVISFHVKAQgADP.KFYLMAPKTMKSDKYNYVVSYGGYTDKRMEFGSISVTVD---E...SDVEAQR....YNRhtst.vrktE.NRDyGWMSVL.PPY....DPDQMPEQEEeqpMVD...KEMDS..IP...........PVEPL...S..PT.SDT..E......A......E.RAFD......L.R....E...E...E......LTRA...RL.EYEA....A....T..E.S...IPDA..APD.....................................-----V..L...P...SKS.E..MSSRLIDHDGRSLPK.PQSK-EVLGTYQGQNITP----DDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppviae................................................................................................................................................................................................................................................
Q7T6J7_9LUTE/2-223               .........tmyl-----.-.-...-.---.-.-----..-----.--...-----------------------------WKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVND...GAYS---....--R.........S.K--.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------wdkttamsarlptqvsapsevytpeapeqptnegtesmppap............................................................................................................................................................................................................
A5A310_BYDVP/565-649             ..........edv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPiarqKLREAAKAPSTLLYE-KTPK.KSYNFLTRfveanrsPATPAAPTVSTVS------------------NMTREQLAEYTRIRRSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
Q45ZZ5_BYDVP/219-570             .............PQPTP.A.P...Q.PAP.E.PTPAP.vPKRFF.EY...IGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SINISCEGFQSVDHIGGNEDGYWIGMIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTFD---E...SDVEAKR....ITRha.....etP.IRS.KHILVS.ERY...eEPLPTITNQG...LCD..vKTPEQ..EQtlv.....deeDRQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LQ.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskplDTSGNI..I...P...KSK.E..P--------------.-----EVLGTYQGQNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppl...................................................................................................................................................................................................................................................
B0FKY4_BYDVP/566-649             ...........dv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPiarqKLREAAKAPSTLLYE-KTSK.KSNNFLTRfveanrsPTTPAAPTVSTAS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
F8RUH7_9LUTE/201-418             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVA------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------i.....................................................................................................................................................................................................................................................
Q70FV8_9LUTE/2-225               .........nvtm-----.-.-...-.---.-.-----..-----.--...---------------------------YLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVND...GAYS---....--R.........S.K--.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------wdkttamsarlptqvsapsevytpeapeqptnegtesmppap............................................................................................................................................................................................................
D7EZH8_9LUTE/206-610             ............a-EPSP.S.Pg.lS.PSP.Q.PTPQK..KYRFI.VY...TGVPVTRIMAQSTDDAISLYDMPSQRFRYIEDENMNWTNLDSRWYSQTSLKAVPMIIVPVPQGEW.TVEISMEGYQPTPSTTDPNKDKQDGLIAYNDDF.KEG.WNVGVYNNVEITNNKADNTLKYGHPD...MELNSCHFNQGQCLERDGDLTCHLKTTgDNA.SFFIVGPAVQKQSKYNYAASYGAWTDRMMEIGMIAIALDE--Q...GSSGSTK....IKR.........P.KRA.GHSMAV.STW....ETISFPKNEN...FEE...SSTSQ..RQ...........DFNTP...L..TH.GES..P......-......D.NLEV......G.V....G...GlplP......VENI...P-.DFDG....DdlwsN..I.S...TRKP..QEDe...................................aMTSKSG..F...K...PQL.K..PPGLPRPQPVRTIRN.FNPEPDLVEAWRP-DVNPGYSKEDVAAATVMYGGSVHEGRSMLAKRDQAVLDGRKSW---....--------------------.--------.......-------------------------------------------------.----------gss...................................................................................................................................................................................................................................................
F8RUN1_9LUTE/201-418             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKSF.GS...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKGESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFP-CDNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YLGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVA------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------i.....................................................................................................................................................................................................................................................
B1A422_9LUTE/212-501             .............PDPTP.P.P...A.PPP.E.PTPAK..HERFI.VY...TGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQ.NKV.WNVGVQNNVTISNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTgPNA.SFFLVGPPVKKIAKYNYCISYGAWTDRDMEFGMVSVVLDEHLE...GVRGSQY....VRK.........T.LRP.GHISVN.RSH....RL--------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------qemppmredfseedssssdnntyktdnspltvhlvkagde..............................................................................................................................................................................................................
Q91GX6_BYDVP/18-371              .............PQPTP.A.P...Q.PAP.E.PTPAP.vPKRFF.EY...IGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTFD---E...SDVEAKR....ITRha.....etP.IRS.KHILVS.ERY...eEPLPTITNQG...LCD..vKTPEQ..EQtlv.....deeDRQTV...S..TE.PDV..A......-......-.----......-.-....-...-...-......----...LQ.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskplDTSGNI..I...P...KSK.E..P--------------.-----EVLGTYQGQNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------pplar.................................................................................................................................................................................................................................................
S4U212_9LUTE/1-76                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....KLREAANAPSTLLYD-KTSK.KSNNFLTRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRRSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
A5A2Q8_BYDVP/219-574             .............PQPTP.A.P...Q.PAP.E.PTPAP.vPKRFF.EY...IGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAER....ITRha.....etP.IRS.KHILVS.EQY...eQPLPTVIDQG...LCD..vQTPEQ..EQtlv.....deeDKQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LM.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskpvDTSGNK..I...P...KPK.E..P--------------.-----EVLGTYQGQNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppiarqk...............................................................................................................................................................................................................................................
I1Z1C1_PLRV/1-106                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.-----------------------------------------MLEKREENVKNKTSSWKPP....LSKAVSPAIAKLRSIRKSQP.LEGGTLKK.......GSTDGVSSIGSGSLTGGTLKRKVTIEERLLQTLTTEQRLWYENLKKTNP.PAAIQWLYEY......................................................................................................................................................................................................................................................
E0A2S5_9LUTE/1-137               ...........ga-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.--T.WNVGEYNNVKITKLLNTSSWKKGHKD...VVLNGCHFNDGQVIERDSTMSFHCEVGhGGG.TILLVAPPVCKSDKYNYVVSYGEYTTKHMEFGSIAICFDEKND...GARAGKF....LGA.........PfPRA.GHVVRE.Q--....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------qteiarfpagsd..........................................................................................................................................................................................................................................
Q70FV4_9LUTE/2-239               ........nvtmy-----.-.-...-.---.-.-----..-----.--...----------------------------LWKDESWSIEQLPAGYRVNNRERAIPFVLFPIDKGRY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTVSNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKIMEWGSISVAIDEVND...G-----A....YSR.........S.KWD.KTTAMS.ARL....PTQVSAPSEV...YNP...ETPEE..SK...........DEGTE...S..TP.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------papnpalgpdnpatkep.....................................................................................................................................................................................................................................
B0FKT6_BYDVP/203-562             ..sstpepkptpaPTPAP.T.P...E.PKP.E.PTPAP.pPKRFF.EY...VGTPIGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEASgKDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEALR....MTRhs.....ecP.TRV.NNILID.EGY...cQPLSTITDQG...LCD..vQTPGQ..DQev......veeDRQTV...S..TE.SDI..A......-......-.----......-.-....-...-...-......----...LK.EYEA....A....T..A.E...IPDA..EEDalpsre........................qlsskpvDTSGEE..I...P...KPR.P..PS-NE----------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------vlgvyqgqpiyadd........................................................................................................................................................................................................................................
R4I782_9LUTE/11-411              .............PSPTP.P.P...P.PPP.Q.PQPQP.cAQRFW.GY...EGNPQNKILTAENSRNIDSRPLNFVQMYKWEDEKWDKVNLQAGYSRNDRRCMETYLTIPADKGKF.HVYLEADGEFVVKHIGGELDGSWLGNIAYDVSQ.-RG.WNIGNYKGCKIKNYQSNTVFVAGHPD...ATMNGKSFDTARAVEVDWFASFELECDdEEG.SWAIYPPPIQKDSSYKYTVSYGNYTEKYCEWGAISVSIDEDN-...---NGNV....PRR.........I.PRK.GAMAWS.TP-....EPSFSGNDSQ...RQD..fNTPSP..-K...........ERGSD...T..LE.SEE..K......K......E.EDNLldleeeN.I....P...-...D......VDDD...DL.WKGI....S....R..A.S...AAGT..TEDd..................................raSTSS-R..L...RgnlKPK.G..LPKPQ---PTRTITE.FNPEPDLIEAWRP-DLAPGYSKADVAAATVIAGGSIHEGRDMLERREAKVMDSRKKW---....--------------------.--------.......-------------------------------------------------.----------gils..................................................................................................................................................................................................................................................
F8RUF9_9LUTE/201-471             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVND...GAYS---....--R.........S.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------kwdkttamsarlptqvsapsevytpeapeqptnegtesmppa............................................................................................................................................................................................................
Q8B6K6_9LUTE/9-516               ...........pgPDPAP.Q.P...T.PTP.E.PTPAK..HERFI.AY...TGTLSTLISARQSSDSISLYSIRSQRIRYIEDENSSWTNIDAKWYSQNSVEAIPMFVYPVPEGTW.SIEISCEGYQAASSTSDPHRGKCDGMIAYDDDS.SKV.WNVGQQNNVTITNNKADNDWKYGHPD...LTINGDRFDQNQVVEKDGIISFHLVTTgPNA.SFFLVAPAVKKTAKYNFCVSYGDWTDRDMEFGMVSVVLDEHLE...GARSSQY....VRK.........S.PRP.GHFGVN.RSHr..lQDSFTPVEYV...SED...DSSSS..SSi........vsNRPST...P..VS.DSD..A......Q......F.AESL......K.G....K...L...P......TQSK...LP.P---....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------kgflsrlsakekeeisksrpsnvesqveplvkaygypsqtgvydaareilqakeaaenlaelerdlkeinrleprdvivqeeipdfvppsekvvqednpeytppiwrnadqavtvssyeppdwsrpayesgdppkkagtlkgtlskiggslrsgesslrgslrktrdqsdldnklsklsviqrsqyqrilnnlgktrareyid...........................................
R9UFV9_9LUTE/203-590             ..........pep-GPKP.K.P...D.PTP.T.PAPKA..PMRFF.EY...IGTPTGTIQSRETSDSISVSKLGDQAFQKIENERSNDVFLSSYWQYSNSVYAQAAFVIPIYKGSY.SVNISCEGMQSVDHIGGEQDGFWIGLVAYSNST.DDV.WGVGNYKGCTISNYLLTNSWRPGHKD...LKLNDCAFDQGQVVERDAVISFHVEAVgENP.SFYLLAPKTQKTDKYNYIVSYGGYTNKKMEFGTISITCD---E...SDVEALR....IARha.....nqA.VKE.NHQQIS.YGL....GNLLPPYSPD...RVE...VYPDI..TS..........sERTVE...T..RP.SEK..T......-......-.TFQH......F.T....Q...E...E......IEEI...DL.-YNL....A....T..S.E...IPDA..EQDvlptkq........................elsrkpiDSLGTQ..I...P...RPR.SmsPEYPR----------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------prslspenprpmsrspeysrpksrspepigtynsqniydddlp...........................................................................................................................................................................................................
Q2L3H1_9LUTE/201-475             ...........ap--PTP.T.P...T.PTPpA.PTPAP..ASKYL.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWQDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVND...GAY----....-SR.........S.KWD.KTTAMS.ARL....PTQVSAPSEV...YTP...XTPEQ..PT...........D----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------egtesmppapnpa.........................................................................................................................................................................................................................................
Q65862_9LUTE/11-333              ...........psPDPPP.P.P...S.PSP.E.PAPAK..EERFI.VY...SGVAHTIISAQSTDDSIIVRDIPDQRFRYVENENFYWFQIAAQWYSNTNTKAVPMFVFPVPIGEW.SVEISTEGYQATSSTTDPNKGRIDGLIAYDNS-.SEG.WNIGAGSNVTITNNKADNSWKYGHPD...LEINSCHFNQNQVLEKDGIISFHVKATeKEA.NFFLVAPPVQKTSKYNYAVSYGAWTDRDMEFGLITVTLD---E...KRGSGSP....TRK.........S.LRA.GHAGVT.TTTd..lVALPEMENSG...IET..sETPSApvTS...........SKAPL...P..TV.SDS..E......S......E.DD--......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------plsaapdvgfggtrllidtdiktipdpdvadafvns..................................................................................................................................................................................................................
E0A2S2_9LUTE/1-137               ...........ga-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.--T.WNVGEYNNVKITKLLNTSSWKKGHKD...VVLNGCHFNDGQVIERDSTMSFHCEVGhGGG.TILLVAPPVCKSDKYNYVVSYGEYTTKHMEFGSIAICFDEKHD...GARAGKF....LGA.........PfPRA.GHVVRE.Q--....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------qteiarfpagsd..........................................................................................................................................................................................................................................
S4U2J5_9LUTE/1-77                ............a-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....KLREAANAPSTLLYE-KTSK.KSNNFLSRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRRSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
B0FKW0_BYDVP/555-643             .....qpiyaddv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPiarqKLRDAAKAPSTMLYDK--AP.KSKSFLSR.......LVEGNRSKVETTAPS------TAT-----TSNLTREQLREYTRIRNSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
Q460A0_BYDVP/566-649             ...........dv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPlarqRLREAAKAPSTLLYER-TPK.KSNNFLTRfveanrsPTTPAAPTVSTTS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
S4U4J6_9LUTE/1-78                ...........rq-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....KLREAANAPSTLLYE-KTPK.KSNNFLTRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
A5A2W9_9LUTE/217-545             ............sPDPPP.P.P...S.PSP.E.PAPAK..EERFI.VY...SGVAHTTISAQSTDDSIIVRDIPDQRFRYVENENFYWFQIAAQWYSNTNTKAVPMFVFPVPIGEW.SVEISTEGYQATSSTTDPNKGRIDGLIAYDNS-.SEG.WNIGAGSNVTITNNKADNSWKYGHPD...LEINSCHFNQNQVLEKDGIISFHVKATeKEA.NFFLVAPPVQKTSKYNYAVSYGAWTDRDMEFGLITVTLD---E...KRGSGSP....TRK.........S.LRA.GHAEVT.TTTd..lVALPEMENFG...IET..sETPLApvTS...........SKAPL...P..TV.SDS..E......S......E.DD--......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------plsaapdvgfggtrllidtdiktipdpdvadalvnsahvgvdp...........................................................................................................................................................................................................
Q45ZY5_BYDVP/565-649             ..........edv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPlarqRLREAAKAPSTLLYER-TPK.KSNNFLTRfveanrsPTTPAAPTVSTTS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
B0FKT6_BYDVP/555-645             ....gqpiyaddv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPgtrqKLRDAAKAPSTLLYD-KTPK.RSKSILSR.......FIEGNRSSVESAAPS------TAT-----TSNLTREQLREYTRIRNSLGlTAAKEYKAR-l.....................................................................................................................................................................................................................................................
B1A452_9LUTE/212-500             .............PDPTP.P.P...A.PPP.E.PTPAK..HERFI.VY...TGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQ.NKV.WNVGVQNNVTISNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTgPNA.SFFLVGPPVKKIAKYNYCISYGAWTDRDMEFGMVSVVLDEHLE...GVRGSQY....VRK.........T.LRP.GHISVN.RTH....RL--------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------qemppmredfseednsssdsntyktdnspltvhlvkagd...............................................................................................................................................................................................................
Q8B6K2_9LUTE/9-321               ...........pgPDPAP.Q.P...T.PTP.E.PTPAK..HERFI.AY...TGTLSTLISARQSSDSISLYSIRSQRIRYIEDENSSWTNIDAKWYSQNSVEAIPMFVYPVPEGTW.SIEISCEGYQAASSTSDPHRGKCDGMIAYDDDS.SKV.WNVGQQNNVTITNNKADNDWKYGHPD...LTINGDKFDQNQVVEKDGIISFHLVTTgPNA.SFFLVAPAVKKTAKYNFCVSYGDWTDRDMEFGMVSVVLDEHLE...GARSSQY....VRK.........T.LRP.GHISVN.RSH....RLQEMPPTRE...DFS...EEDNS..SS...........DSNTY...K..TD.SSS..M......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------tvhlvkagdeenyttdqsddvdptlrdaevm.......................................................................................................................................................................................................................
S4U202_9LUTE/1-76                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....KLREAANAPSTLLYE-KTSK.KSNNFLTRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
A5A2Y6_BYDVP/565-649             ..........edv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPiarqKLREAANAPSTLLYE-KTPK.KSNNFLTRfveanrsPTTPAAPSVSTVS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
S4U4N7_9LUTE/1-71                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....-----ANAPSTLLYG-KTSK.KSNNFLTRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRRSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
F8RUI0_9LUTE/201-418             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVA------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------i.....................................................................................................................................................................................................................................................
Q91GX6_BYDVP/366-448             ............v-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPlarqRLREAAKAPSTLLYER-TPK.KSNNFLTRfveanrsPTTPAAPTVSTTS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
Q17S69_9LUTE/210-502             ........psptp--PPP.P.P...A.PAP.E.PQPCK..KYRFW.GY...EGVPQNKIVTAQNDRNIDVRGLNYVKFYKWEDDNWTEVNLQANYSVNNSQYAEPYMIIPASKGKF.HVYLECDGQMAVKSVGGKADNSWRGLIAYDTS-.RRM.WNVGNYKGCTIENYRKTDSFVLGHPD...VEVNDCKFDKARGVEADWYASFQLTCDdDEG.SWILYAPPIPKDSLYNYTVSYGEYTENMCEWGAVSISIDEDNS...STGNEVK....IK-.........P.GR-.GHL--V.HRA....LPEGTLEQQP...LED..vQVKEY..FW..........kENQSE...-..TT.SD-..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------sdgesfiskikgklpm......................................................................................................................................................................................................................................
F2X6V5_9LUTE/201-470             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVND...GAYS---....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------rskwdkttamsarlptqvsapsevyipeapeqptnegtesmpp...........................................................................................................................................................................................................
A0FLF6_BYDVP/219-572             .............PQPTP.A.P...Q.PAP.E.PTPAP.vPKRFF.EY...IGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAER....ITRha.....etP.IRS.KHILVS.EQY...eQPLPTIIDQG...LCD..vQTPEQ..EQtlv.....deeDKQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LM.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskpvDTSGNK..I...P...KPK.E..P--------------.-----EVLGTYQGQNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppiar.................................................................................................................................................................................................................................................
Q65877_BYDVR/364-448             ..........edv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPiarqKLREAAKTPSTLLYE-KTPK.KSNNFLTRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
A5A2S6_BYDVP/565-649             ..........edv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPiarqKLREAANAPSTLLYER-TPK.KSNNFLTRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
C7AXW9_BYDVP/38-187              .............PQPTP.A.P...Q.PAP.E.PTPAP.vPKRFF.EY...IGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGH--...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------......................................................................................................................................................................................................................................................
R9S4X7_SIMAS/215-306             ..........ept--PTP.E.P...T.PTP.E.PTPSP.aPEGPV.SVagpVTVNWDAPATRENGDPIDVSELGGYEIRYREEGATDYTYV-------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------lvedgyalskyvgdlygsyefev...............................................................................................................................................................................................................................
Q8V2F5_BLRV/210-518              ..........dpp-PPTP.A.P...T.PQP.Q.PTP-K..HERFI.VY...TGVPESRISAQSTDDSISVYSLQNQRLRYIEDENANWTNIEARWYSNNNVKATPMFIFPVPQGKW.SVEISTEGYQPTSSTTDPNNGKCDGLIAYSDDDkTDV.WNVGVQKNITLSNNKADNTWKYGHPD...LEINNCKFNNRQVLERDAYISFHVETTgPNA.SFFLVAPPVQKTARYNYAVSYGAWTDRMLEFGSVTVALDEHLE...GGNSSRY....IRR.........S.PRP.GHLEST.RTY....D---------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------lhllphmddliaanttavvdgygssisidrqvlvavdnhivdsgdetddlpgysssss............................................................................................................................................................................................
I1Z1B7_PLRV/214-698              .............SEPGP.S.P...Q.PTP.T.PTPQK..HERFI.AY...VGIPMLTIQARENDDQIILGSLGSQRMKYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNAD.SDY.WNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP.TDG.RFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEHLE...GTGSANR....VRR.........P.PRE.GHTYMA.SPR....EPEGKPVGNK...PRD...ETLIQ..TQ...........ERQPD...Q..TP.SDD..V......S......D.AGSV......N.S....G...G...S......TESL...RL.EFGI....N....S..D.S...TYDA..TVD.....................................GTDWPR..I...P...PPR.H..PPEPRVSGDSRTVTD.FSPNADLLENWDAEHFDPGYSKEDVAAATIIAHGSIQDGRSMLEKREENVKNKTSSWKPP....LSKAVSPAIAKLRSIRKSQP.LEGGTLKK.......GSTDGVSSIGSGSLTGGTLKRKVTIEERLLQTLTTEQRLWYENLKKTNP.PAAIQWLYEY......................................................................................................................................................................................................................................................
Q5UUW8_9LUTE/202-575             .........peptPQPQP.E.P...K.PDP.Q.PTPEP.qHKRFF.EY...VGTPYVIIQTRESSDSIAVKSMNDQSFQYIENETSEQRTVQAWWTSNNGVQAQAAFVFPIPAGEY.SVNISCEGLQSVDHIGGNRDGYWIGLIAYQNQS.GDY.WGVGNYAGCDITNLLGTNTWRPGHED...LELNGCKFTNGQIVERDAVISFHVKAQgADP.KFYLMAPKTMKSDKYNYVVSYGGYTDKRMEFGSISVTVD---E...SDVEAQR....YNRhtst.vrktE.NRDyGWMSVL.PPY....DPNQVPEQEE...EQP...MVDKE..MD...........SRSPV...E..PP.SPT..S......-......D.TEAE......R.AfdlrE...E...E......LTRA...RL.EYEA....A....T..E.S...IPDA..APD.....................................-----I..L...P...SKS.E..MSSRPIDHDGRSLPK.PQSK-EVLGTYQGQNITP----DDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppviae................................................................................................................................................................................................................................................
F8RUK4_9LUTE/201-418             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MRVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVA------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------i.....................................................................................................................................................................................................................................................
S4U4K0_9LUTE/1-75                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....-LREAANAPSTLLYE-KTPK.KSNNFLTRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRRSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
Q70FV5_9LUTE/2-233               ........nvtmy-----.-.-...-.---.-.-----..-----.--...----------------------------LWKDESWSIEQLPAGYRVNNRERAIPFVLFPVDKGRY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTVSNYRTSDSNVPGHPD...MRVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKIMEWGSISVAIDEVND...GAYS---....--R.........S.KWD.KTTAMS.AR-....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------lptqvsapsevynpekpeesknegtestppapnpalgpdn..............................................................................................................................................................................................................
Q9J1A7_9LUTE/219-572             .............PQPTP.T.P...Q.PTP.E.PTPAP.vPKRFF.EY...VGTPTGVISTRENSDSISVSKLGGQSMQYIENEKCESKVIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGIGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDGVISFHVDATgTDA.CFYLAAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTFD---E...SDVEAER....IARhs.....etP.ARH.NHILLS.ESY...eEPLPTIIDQG...LCD..vKTPEQ..EIvkv.....deeDRQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LQ.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsvkpvDSS---..-...-...---.-..----------GTPLP.KSKEPEVLGTYQGMNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppvar.................................................................................................................................................................................................................................................
B0FKW6_BYDVP/208-567             ........ptpap-APQP.T.P...Q.PAP.E.PTPAP.aPKRFF.EY...IGTPMGVISTRENTDSISVSQLGGQSMQYIENEKCETRTIDSFWSTNNNVAAQAAFVYPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGIIAYSNSS.DDN.WGIGNYRGCSFKNYLATNTWRPGHKD...LKLNDCQFTGEQIVERNSIISFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAIR....IAKhs.....atP.NRA.NHILVS.ERY...qDVLPTIENQG...LCD..vETPSQ..ETsiv.....eedDKQSV...S..TE.PEI..A......-......-.----......-.-....-...-...-......----...VK.EYEA....A....V..A.E...IPDA..EEDvlpske........................qlsskpvDTSGNT..I...P...RTK.E..P--------------.-----EVLGTYQGQNIYP----EDVPP---------------------------------....--------------------.--------.......-------------------------------------------------.----------aarqa.................................................................................................................................................................................................................................................
B0FKQ6_BYDVP/203-558             .sstpepkptpap-TPPP.Q.P...E.PKP.E.PTPAP.pPKRFF.EY...VGTPIGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVQASgKDA.CFYIMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEALR....MSRhs.....esP.TRV.NNILID.EGY...hQTLSPIQNLG...LCD..vQTPGQ..DEve.......edDKQTV...S..TE.SDI..A......-......-.----......-.-....-...-...-......----...LQ.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskpvDTSGEE..I...P...KPP.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------prdneilgvyqgqpiy......................................................................................................................................................................................................................................
B0FKU8_BYDVP/203-563             ..sstpepkptpaPTPAP.T.P...E.PKP.E.PTPAP.pPKRFF.EY...VGTPIGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDCYWIGLIAYSNSS.GDN.WGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEASgKDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAFR....MTRhs.....ecP.TRV.NNILID.EGY...cQPLSTITDQG...LCD..vQTPGQ..DQev......veeDRQTV...S..TE.SDI..A......-......-.----......-.-....-...-...-......----...LK.EYEA....A....I..A.E...IPDA..EEDalpsre........................qlsskpvDTSGEE..I...P...KPR.P..L--------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------snevlgvyqgqtiyaddv....................................................................................................................................................................................................................................
S4U5Q1_9LUTE/1-71                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....-----ANAPSTLLYD-KTSK.KSNNFLTRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRRSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
O92523_9LUTE/18-370              .............PQPTP.A.P...Q.PAP.E.PTPAP.vPERFF.EY...IGTPTGTISTRENSDSVSVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAER....ITRha.....ekS.IRS.KHTLVS.ERY...eEPLPTVTDQG...LCD..vKTPEQ..EQtlv.....deeDRQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LQ.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskplDTSGNI..I...P...KPK.E..P--------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------evlgtyqgwkqgqniypedv..................................................................................................................................................................................................................................
S4U194_9LUTE/1-76                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....KLREAANAPSTLLYE-KTSK.KSNNFLARfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRRSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
Q70FV1_9LUTE/2-234               ........nvtmy-----.-.-...-.---.-.-----..-----.--...----------------------------LWKDESWSIEQLPAGYRVNNRERAIPFVLFPVDKGRY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTVSNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.HFGLEAPPIEKSDHFNFVVSYANFTDKIMEWGSISVAIDEVND...GAY----....-SR.........S.KWD.KTTAMS.ARL....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------ptqvsapsevytpeapeesenegtestppapnpalgpdnp..............................................................................................................................................................................................................
B0FKW6_BYDVP/559-642             ...........dv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPaarqALREAARAPSTMLYD-KAPK.GAKSILSRfvegnrsKTNPAAPSVSTTS------------------NMTREQLKEYTRIRNSLGvTAAKEYKVQF......................................................................................................................................................................................................................................................
S4U208_9LUTE/1-77                ............a-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....KLREAANAPSTLLYE-KTPK.KSNNFLTRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRRSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
A5A2T2_BYDVP/213-566             .............PEPTP.A.P...Q.PAP.E.PTPAP.vPKRFF.EY...IGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAER....ITRha.....etP.IRS.KHILVS.EQY...eRPLPTIINQG...LCD..vQTPEQ..EQtlv.....deeDKQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LM.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskpvDTSGNK..I...P...KPK.E..P--------------.-----EVLGTYQGQNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppiar.................................................................................................................................................................................................................................................
A5A2V6_BYDVP/567-649             ............v-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPiarrKLREAANAPSTLLYE-KTPK.KSNNFLTRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
Q45GB7_9LUTE/208-612             ............p-GPSP.G.P...S.PSP.Q.PTPSK..KYRFI.VY...TGVPVTRIMAQSTDDAISLYDMPLQRFRYIEDENMNWTNLDSRWYSQNSLKAIPMIIVPVPQGEW.TVEISMEGYQPTSSTTDPNKDKQDGLIAYNDDL.KEG.WNVGVYNNVEITNNKADNTLKYGHPD...MELNSCHFNQGQCLERDGDLTCHVRTTgDNA.SFFIVGPAVQKQSKYNYAVSYGAWTDRMMEIGMIAIALDEQ--...GSSGSAK....IER.........P.KRV.GHSMAV.STW....ETINLPEKEN...SEE...FKTDQ..RQ...........DLKTP...P..AA.GG-..S......S......D.MLDI......V.Q....G...G...L......--PL...PV.E---....-....-..E.D...IPDS..IMDdpwsnipa.....................kssqegeaMTSKSG..F...K...PQL.K..PPGLPKPQPVRTIRN.FDPKPDLVEAWRP-DVNPGYSKEDVAAATVMYGGSVKEGRSMIDKRDKAVLDGRKSW---....--------------------.--------.......-------------------------------------------------.----------gssl..................................................................................................................................................................................................................................................
Q2L3I3_9LUTE/201-471             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVND...GAYS---....--R.........S.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------kwdkttamsarlptqvsapsevytpeapeqptnegtesmppa............................................................................................................................................................................................................
F8RUG8_9LUTE/201-418             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-HLVERDFSCSFHLEVP.QQG.LFGLEAPPIEKNDHFNFVVSCANFTDKILEWGSISVA------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------i.....................................................................................................................................................................................................................................................
B0FKN2_BYDVP/559-645             ........yaedv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPgtrqKLRDAAKAPSTLLYD-KTPK.RSKSILSR.......FIEGNRSSVESAAPS------TAT-----TSNLTREQLREYTRIRNTLGlTAAKAYKAQF......................................................................................................................................................................................................................................................
B0FKL4_BYDVP/219-570             .............PQPTP.A.P...Q.PAP.E.PTPAP.vPKRFF.EY...IGTPTGTISTRENSDSISVSKLGGQPMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAER....ITRha.....etP.IRS.KHILVS.ERY...vEPMPTIIDQG...LCD..vKTPEQ..EQtlv.....deeDKQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LQ.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskpmDTSGNK..I...P...KPK.E..P--------------.-----EVLGTYQGMNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppl...................................................................................................................................................................................................................................................
E0YC38_9LUTE/209-343             .........aptp-PPPP.P.P...S.PSP.E.PKPCK..KDRFW.GY...EGVPQNKISAARNNQFIDVKTLNYVQMYKWEDDRWDRVNMQASYARNDRNYAEPYMVIPANKGKF.HVYVECDGQMAVKSIGGKADNSWNGLIAYDVS-.RKA.WNIGNYK-------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------t.....................................................................................................................................................................................................................................................
A7XUE7_9LUTE/212-504             .............PDPTP.P.P...A.PPP.E.PTPAK..HERFI.VY...TGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQ.NKV.WNVGVQNNVTISNNKADADWKYGHPN...LTINGERFDQNQVVEKDGTVSFHLVTTgPNA.SFFLVGPPVKKIAKYNYCISYGAWTDRDMEFGLVSVVLDEHLE...GVRGSQY....VRK.........T.LRP.GHISVN.RSH....RL--------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------qemppmredfseednsssdsntyktdnspltvhivkagdeeny...........................................................................................................................................................................................................
B7TWE0_9LUTE/212-500             .............PDPTP.P.P...A.PPP.E.PTPAK..HERFI.VY...TGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQ.NKV.WNVGVQNNVTISNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTgPNA.SFFLVGPPVKKIAKYNFCISYGAWTDRDMEFGLVSVVLDEHLE...GVRGSQY....VRK.........T.LRP.GHISVN.RSH....RL--------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------qemppmredfseednsssdsntyktdnspltvhlvkagd...............................................................................................................................................................................................................
A5A316_BYDVP/219-572             .............PQPTP.A.P...Q.PSP.E.PTPAP.vPKRFF.EY...IGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAER....ITRha.....etP.IRS.KHILVS.EQY...eQPLPTIIDQG...LCD..vQTPEQ..EQtlv.....deeDKQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LM.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskpmDTSGNK..I...P...KPK.E..P--------------.-----EVLGTYQGQNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppiar.................................................................................................................................................................................................................................................
B0FKW0_BYDVP/203-552             .sstpepkptpap-TPPP.Q.P...E.PKP.E.PTPAP.pPKRFF.EY...VGTPIGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVQASgKDA.CFYIMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEALR....MSRhs.....esP.TRV.NNILID.EGY...hQTLPPIQNLG...LCD..vQTPGQ..DEve.......edDKQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LQ.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskpvDTSGEE..I...P...KPP.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------prdneilgvy............................................................................................................................................................................................................................................
F8RUE1_9LUTE/201-471             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKSF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFSLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVND...GAYS---....--R.........S.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------kwdkttamsarlptqvsapsevytpeapeqptnegtesmppa............................................................................................................................................................................................................
I1XV15_PLRV/1-106                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.-----------------------------------------MLEKREESVKRKTSSWKPP....LPKAVSPAIAELRSIRKTQP.LEGGTLNK.......GTTDGASTIGSGSLTGGTFKRKQTYEERLLQTLTTEQRLWYENLKKTDP.GAATQWLFE-n.....................................................................................................................................................................................................................................................
Q7T6J9_9LUTE/2-223               .........tmyl-----.-.-...-.---.-.-----..-----.--...-----------------------------WKDESWSIEQLSAGYRVNNRERAIPSVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVND...GAYS---....--R.........S.K--.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------wdkttamsarlptqvsapsevytpeapeqptnegtesmppap............................................................................................................................................................................................................
S4U197_9LUTE/1-76                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....KLREAANAPSTLLYE-KTSK.KSNNFLSRfveanrsPTTPAVPTVSTVS------------------NMTREQLAEYTRIRRSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
B0FKV4_BYDVP/560-645             ....pedvpsgtr-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.-----------------------------------------------------------Q....KLRDAAKAPSTLLYD-KTPK.RSKSILSR.......FIEGNRSSVESSAPS------TAT-----TSNLTREQLREYTRIRNTLGlTAAKEYKAR-l.....................................................................................................................................................................................................................................................
B0ZT75_9LUTE/206-579             .........pepsPQPQP.E.P...K.PDP.Q.PTPEP.qHKRFF.EY...VGTPYVIIQTRESSDSIAVKSMNDQSFQYIENETSEQRTVQAWWTSNNGVQAQAAFVFPIPAGEY.SVNISCEGLQSVDHIGGNRDGYWIGLIAYQNQS.GDY.WGVGNYAGCDITNLLGTNTWRPGRED...LELNGCKFTNGQIVERDAVISFHVKAQgADP.KFYLMAPKTMKSDKYNYVVSYGGYTDKRMEFGSISVTVD---E...SDVEAQR....YNRhtst.vrktE.NRDyGWMSVL.PPY....DPNQMPEQEE...EQP...MVDKE..MD...........SRPPVeplS..PT.SDT..E......A......E.RAFD......L.R....E...E...E......LTRA...RL.EYEA....A....T..E.S...IPDA..APD.....................................-----I..L...P...SKS.E..MSSRLIDHDGRSLPK.PQSK-EVLGTYQGQNITP----DDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppviae................................................................................................................................................................................................................................................
Q7T6K3_9LUTE/2-230               .........tmyl-----.-.-...-.---.-.-----..-----.--...-----------------------------WQDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYKTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFSLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVND...GAY----....-SR.........S.KWD.KTAAMS.ARL....PTQVSAPSEV...YTP...ETPEQ..PT...........DEGT-...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------esmppapnpalgpd........................................................................................................................................................................................................................................
Q70FV3_9LUTE/2-225               .........nvtm-----.-.-...-.---.-.-----..-----.--...---------------------------YLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVND...GAYS---....--R.........S.K--.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------wdkttamsarlptqvsapsevytpeapeqptnegtesmppap............................................................................................................................................................................................................
A5A2T2_BYDVP/561-643             ............v-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPiarqKLREAANAPSTLLYE-KTPK.KSNNFLTRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRKSLGlTAAKEYRAQF......................................................................................................................................................................................................................................................
A5A2X4_BYDVP/566-650             ...........dv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPmarqKLREAANAPSTLLYERRTPK.KSSNFLSRlvqanrsPTTPSAPSVSTTS------------------NMTREQLREYTRIRNSSGiTAAKAYKAQF......................................................................................................................................................................................................................................................
E5GAB5_9LUTE/211-615             ......papapqp-PPPP.P.P...S.PSP.E.PQPCK..KDRFW.GY...EGVPQNKISAARNDQFIDVKSLNYVQMYKWEDDRWDRINMQANYSRNDRNYAEPYMIIPASKGKF.HVYVECNGQMAVKSIGGKADNSWNGMIAYDTS-.RRA.WDVGNYKGCVITNYQKNNTFVAGHPD...VELNNCKFTSSRGVECDCYLSFQLTCDdDDG.AWMLYAPPIPKDDKYNYSVSYGEYVDRNCEWGAVSISID---E...DNSTGNE....IRM.........K.PMK.GAMHWS.---....EPVDFARESQ...RQD..fKTPSP..-P...........ERGTD...D..LE.SEK..K......-......-.----......-.-....-...K...E......EENL...LN.ELE-....-....-..E.R...IPDA..NEDfwegmpir....................ststtegdrASTGSR..L...R...GTL.K..PPGLPKPQPTRTITE.FRPNPDLVEAWRP-DLAPTYSKADVAAATVIAGGSVHEGREHLKRREEAVLNNRERWGP-....--------------------.--------.......-------------------------------------------------.----------lsav..................................................................................................................................................................................................................................................
A5A2S6_BYDVP/219-573             .............PQPTP.A.P...Q.PAP.E.PTPAP.vHKRFF.EY...IGTPTGTISTRENTDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAER....ITRha.....etP.IRS.KHILVS.EQY...eQPLPTIIDQG...LCD..vQTPEQ..EQtmv.....deeDKQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LM.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskpvDTSGNK..I...P...KPK.E..P--------------.-----EVLGTYQGQNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppiarq................................................................................................................................................................................................................................................
R9UH96_9LUTE/205-548             ...sgpepaptptPAPTP.T.P...T.PTP.K.PAPEP..AKRFF.EY...TGVPIVTIQTRETSDTIILNKFENQTLQYLEDETASTRTIEAWWNGNNNVSAQAAFIFPVPEGSY.SVNISCEGMQSVDHMGGTEDGYWIGLIAYNNST.TDN.WGVGNYQGCTITKFLATNTWRPGHKD...LKLNECSFTDGQIVERDAVMSFHVTATiKNA.SFYLMAPKTMKADKYNYVVSYGGYTNKRMEFGTITVTFD---E...SGSEASR....VKKhe.....gsM.LRH.NVVLFN.NWT....DPLPNL----...---...--PPQ..EA...........EHTAV...M..TG.DSS..-......-......-.--PE......N.S....D...T...E......AE--...-K.AYNL....A....T..R.F...IPDA..NEDvlpske........................dlskkpmDSRGYT..I...P...KPP.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------arveepevldqyny........................................................................................................................................................................................................................................
Q2L3F9_9LUTE/201-483             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLPAGYRVNNRERAIPFVLFPIDKGRY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTVSNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKIMEWGSISVAIDEVND...GA-----....YSR.........S.KWD.KTTAMS.ARL....PTQVSAPSEV...YNP...ETPEE..SE...........NEXTE...S..TP.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------papnpalgpdnpat........................................................................................................................................................................................................................................
A5A2Y0_BYDVP/219-572             .............PQPTP.A.P...Q.PAP.E.PTPAP.vPKRFF.EY...IGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETRVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAER....ITRha.....etP.IRS.KHILVS.ERY...vEPLPTIIDQG...LCD..vKTPEQ..EQtlv.....deeDRQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LQ.EYEA....A....T..A.E...IPDA..EEDvlpsre........................qlsskplDTSGNI..I...P...KPK.E..P--------------.-----EVLGTYQGQNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------pplar.................................................................................................................................................................................................................................................
Q91GX4_BYDVP/18-370              .............PQPTP.A.P...Q.PAP.E.PTPAP.vPKRFF.EY...VGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAKR....ITRha.....etP.IRS.KHTLVS.ERY...eEPLPTVIDQG...LCD..vKTPEQ..EQtlv.....eeeDRQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LQ.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskplDTSGNI..I...P...KPK.E..P--------------.-----EVLGTYQGQNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppla..................................................................................................................................................................................................................................................
S4U218_9LUTE/1-75                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....-LREAANAPSTLLYE-KTSK.KSNNFLTRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
E0A2S4_9LUTE/1-137               ...........ga-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.--T.WNVGEYNNVKITKLLNTSSWKKGHKD...VVLNGCHFNDGQVIERDSTMSFHCEVGhGGG.TILLVAPPVCKSDKYNYVVSYGEYTTKHMEFGSIAICFDEKHD...GARAGKF....LGA.........PfPRA.GHVVCE.QQT....E---------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------iarfpagsd.............................................................................................................................................................................................................................................
B0FKY4_BYDVP/219-572             .............PQPTP.A.P...Q.PAP.E.PTPAP.vPKRFF.EY...IGTPIGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYRGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAER....ITRht.....etP.IRS.KHILVS.EQY...gQPLPTIIDQG...LCD..vQTPEQ..EQtlv.....deeDKQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LM.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskpvDTSGNK..I...P...KSK.E..P--------------.-----EVLGTYQGQNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppiar.................................................................................................................................................................................................................................................
A5A2Z8_BYDVP/567-649             ............v-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPiarqKLREAANAPSTLLYE-KSSK.KSNNFLTRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
Q8QYP3_PLRV/214-698              .............SEPGP.S.P...Q.PTP.T.PTPQK..HERFI.AY...VGIPMLTIQARESDDQIILGSLGSQRMKYIEDENQNYTNISSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNAD.SDY.WNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP.TDG.RFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEHLE...GTGSANR....VRR.........P.PRE.GHTYMA.SPR....EPEGKPVGNK...PRD...ETPIQ..TQ...........ERQPD...Q..TP.SND..V......S......D.AGSV......N.T....G...G...S......TESL...QL.EFGV....N....S..D.S...TYDA..TVD.....................................GTDWPR..I...P...PPR.H..PPEPRVSGNSRTVND.FSPKADLLENWDAEHFDPGYSKEDVAAATIIAHGSIQDGRSILEKREENVKNKTSSWKLP....LPKAVSPAIATLRSIRKSQP.LEGGTLKK.......DATDGVSSIGSGSLTGGTLKRKVTIEERLLQTLTTEQRLWYENLKKTNP.LAATQWLYEY......................................................................................................................................................................................................................................................
Q8B6K8_9LUTE/11-310              .............PSPTP.P.P...S.PPP.E.PTPAK..RERFI.VY...TGTVSTLISARQNSDSISLYSIRDQRVRYIEDENANWTNIKAQWYSQSSVEAIPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQ.TKV.WNVGVQNNVTISNNKADADWKYGHPN...LTINGERFDQNQVVEKDGTISFHLVTTgPNA.SFFLVGPAVKKIAKYNYCISYGAWTDRDMEFGLVSVVLDEHLE...GARGSQY....VRK.........T.LRP.GHISVN.RSHr..lQDSFTPV---...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------eyvsdedsssnssivsnrpstpdndsdtqfaeslrgklpsqtq...........................................................................................................................................................................................................
F8RUL9_9LUTE/201-418             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVA------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------i.....................................................................................................................................................................................................................................................
Q84819_PLRV/5-489                .............SEPGP.S.P...Q.PTP.T.PTPQK..HERFI.AY...VGIPMLTIQARENDDQIILGSLGSQRMKYIEDENQNYTNVNSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNAD.SDY.WNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP.TDG.RFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEHLE...GTGSANR....VRR.........P.PRE.GHTYMA.SPR....EPEGKPVGNK...PRD...ETPIQ..TQ...........ERQPD...Q..TP.SDD..V......S......D.AGSV......N.S....G...G...S......TESL...QL.EFGV....N....S..D.S...TCDA..TVH.....................................GTDWPR..I...P...PPR.H..PPEPRVSGNSRTVTD.FSPKADLLENWDAEHFDPGYSKEDVAAATIIAHGSIQDGRTMLEKREENIKNKTSSWKPP....LPKAVSPAIAKLRSIRKSQP.LEGGTLKK.......DTTDGVSSIGSGSLTGGTLKRKVTIEENLLQTLTTEQRLWYENLKKTNP.LAATQWLFEY......................................................................................................................................................................................................................................................
I1XV20_PLRV/214-698              .............SEPGP.S.P...Q.PTP.T.PTPQK..HERFI.AY...VGIPMLTIQARGNDDQIILGSLGSQRMKYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNAD.SDY.WNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP.TDG.RFFLVGPAIQKTARYNYTISYGDWTDRDMELGLITVVLDEHLE...GTGSANR....VRR.........P.LRE.GHTYMA.SPR....EPEGKPVGNK...PRD...ETPIQ..TQ...........ERQPD...Q..TP.SDD..V......S......D.AGSV......N.S....G...G...S......TESL...RL.EFGV....N....S..D.S...TYDA..TVD.....................................GTDWPR..I...P...PPR.H..PPEPRVSGNSRTVTD.FSSKADLLENWDAEHFDPGYSKEDVAAATIIAHGSIQDGRSMLEKREESVKNKTSSWKLP....LPEAVSPAIAKLRSIRKSQP.LEGGTLKK.......DTTDGVSSIGSGSLTGGTLKRKATIEERLLQTLTTEQRLWYENLKKTDP.PAATQWMFEY......................................................................................................................................................................................................................................................
B5L2B7_9LUTE/208-612             ............p-GPSP.G.P...S.PSP.Q.PTPSK..KYRFI.VY...TGVPVTRIMAQSTDDAISLYDMPSQRFRYIEDENMNWTNLDSRWYSQNSLKAIPMIIVPVPQGEW.TVEISMEGYQPTSSTTDPNKDKQDGLIAYNDDL.KEG.WNVGVYNNVEITNNKADNTLKYGHPD...MELNSCHFNQGQCLERDGDLTCHVKTTgDNA.SFFIVGPAVQKQSKYNYAVSYGAWTDRMMEIGMIAIALDEQ--...GSSGSAK....IER.........P.KRV.GHSMAV.STW....ETINLPEKGN...SEE...FKTDQ..RQ...........DLKTP...P..AA.GG-..S......S......D.MLDI......V.Q....G...G...L......--PL...PV.EEDI....P....D..S.I...MDDP..WSDipakss.........................qedeaxSSKSGF..K...P...QL-.K..PPGLPKPQPVRTIXN.FDPKPDLVEAWRP-DVNPGYSKEDVAAATVMYGGSIKEGRSMIDKRDEAVLDGRKRW---....--------------------.--------.......-------------------------------------------------.----------gssl..................................................................................................................................................................................................................................................
A5A2W2_BYDVP/567-649             ............v-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPiarqKLRDAANAPSTLLYER-TPK.KSNNFLTRfmeanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
F8RUE7_9LUTE/201-473             ...........ap--PTP.H.P...T.PTPpA.PTPAP..ALKYL.GY...QGVPNNIVKTRGNSEYLDVGPLGNVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKIDHFNFVVSHANFTDKILEWGSISVAIDEVND...GAYS---....--R.........S.KWD.KTTAMS.AR-....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------lptqvsapsevytpeapeqpadegtesmppapn.....................................................................................................................................................................................................................
A5A2T8_BYDVP/219-570             .............PQPTP.A.P...Q.PTP.E.PTPAP.vPKRFF.EY...IGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYSNKRMEFGTISVTCD---E...SDVEAER....ITRha.....etP.IRS.KHILVS.EQY...eQPLPTIIDQG...LCD..vQTPEQ..EQtlv.....deeDKQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LM.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskpvDTSGNK..I...P...KPK.E..P--------------.-----EVLGTYQGQNIYP----DD------------------------------------....--------------------.--------.......-------------------------------------------------.----------vppi..................................................................................................................................................................................................................................................
Q7T6K2_9LUTE/2-236               .........tmyl-----.-.-...-.---.-.-----..-----.--...-----------------------------WKDESWSIEQLSAGYRVNNRERAIPFVLFPIDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTVSNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKIMEWGSISVAVDEVND...GA-----....YSR.........S.KWD.KTTAMS.ARL....PTQVSAPSEV...YNP...ETPEE..SE...........NEGTE...S..TP.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------papnpalgpdnpatke......................................................................................................................................................................................................................................
Q8QYR0_PLRV/1-106                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.-----------------------------------------MLEKREGNVKNKTSSWKLP....LPKAESPAIAKLRSIRKSQP.LEGGTLKK.......DTTDGVSSIGSGSLTGGTLKRKATIEEHLLQTLTTEQRLWYENLKKTNP.LAATQWLFKY......................................................................................................................................................................................................................................................
B0FKQ0_BYDVP/210-567             ..........pap-APQP.A.P...Q.PAP.E.PTPAP.vPKRFF.EY...IGTPMGVISTRENTDSISVSQLGGQSMQYIENEKCETRTIDSFWSTNNNVAAQAAFVYPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGIIAYSNSS.DDN.WGIGNYRGCSFKNYLATNTWRPGHKD...LKLNDCQFTGGQIVERDSIISFHVEATgADA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAIR....IAKhs.....atP.NRA.NHLLVS.EQY...qDALPTIENQG...LCD..vETPGQ..QTnvv.....eedDKQSV...S..TE.PEI..A......-......-.----......-.-....-...-...-......----...VK.EYEA....A....V..A.E...IPDA..EEDvlpske........................qlsskpvDTSGNT..I...P...RTK.E..P--------------.-----EILGTYQGQNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppvarqa...............................................................................................................................................................................................................................................
D2K8V5_9LUTE/201-265             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDES-------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------wsieql................................................................................................................................................................................................................................................
Q8B6K0_9LUTE/9-316               ...........pgPDPAP.Q.P...T.PTP.E.PTPAK..HERFI.AY...TGTLSTLISARQSSDSISLYSIRSQRIRYIEDENSSWTNIDAKWYSQNSVEAIPMFVYPVPEGTW.SIEISCEGYQAASSTSDPHRGKCDGMIAYDDDS.SKV.WNVGQQNNVTITNNKADNDWKYGHPD...LTINGDKFDQNQVVEKDGIISFHLVTTgPNA.SFFLVAPAVKKTAKYNFCVSYGDWTDRDMEFGMVSVVLDEHLE...GARSSQY....VRK.........T.LRP.GHISVN.RSH....RLQEMPPTRE...DFS...EEDNS..SS...........DSNTY...K..TD.S--..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------spmtvhlagdeenyttdqsddvdptlrda.........................................................................................................................................................................................................................
B1A428_9LUTE/212-491             .............PDPTP.P.P...A.PPP.E.PTPAK..HERFI.VY...TGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQ.TKV.WNIGVQNNVTISNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTgPNA.SFFLAGPAVKKIAKYNYCISYGAWTDRDMEFGMVSVVLDEHLE...GVRGSQY....VRK.........T.LRP.GHISVN.RTH....R---------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------lqemppmredfseednsssdsntykadnspl.......................................................................................................................................................................................................................
D4P4V5_9LUTE/201-477             ...........ap--PTP.T.P...T.PTPpA.PTPAP..ASKYL.GY...QGVPSNIVKTRGNSEYLDVGPLGNVTMYLWQDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYKTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFSLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVND...GAY----....-SR.........S.KWD.KTAAMS.ARL....PTQVSAPSEV...YTP...ETPEQ..PT...........DEGT-...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------esmppapnpalg..........................................................................................................................................................................................................................................
C7AXX2_BYDVP/38-187              .............PQPTP.A.P...Q.PAP.E.PTPAP.vPKRFF.EY...IGTPTGVISTRENSDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGH--...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------......................................................................................................................................................................................................................................................
Q5I4G6_BYDVP/203-562             .sstpepkptpap-TPPP.Q.P...E.PKP.E.PTPAP.pPKRFF.EY...VGTPIGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVQASgKDA.CFYIMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEALR....MSRhs.....esP.TRV.NNVLID.EGY...hQTLPPIQDFG...LCD..vQTPGQ..DEve.......edDKQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LQ.EYEA....A....T..A.E...IPDA..EEDvlpsre........................qlsskpvDTSGEE..I...P...KPP.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------prdneilgvyqgqpiyaddv..................................................................................................................................................................................................................................
Q19A29_BYDVP/15-242              .............PQPTP.A.P...Q.PAP.E.PTPAP.vPKRFF.EY...IGTPTGVISTRENSDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgSNA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTLSVTCD---D...SDV----....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------ee....................................................................................................................................................................................................................................................
S4U1A1_9LUTE/1-77                ............a-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....KLREAANAPSTLLYEK-TSK.KRNNFLTRlveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRRSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
B0FKT0_BYDVP/555-645             ....gqpiyaddv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPgtrqKLRDAAKAPSTLLYD-KTPK.RSKSILSR.......FIEGNRSSVESAAPS------TAT-----TSNLTREQLREYTRIRNSLGlTAAKEYKAR-l.....................................................................................................................................................................................................................................................
Q8QYN6_PLRV/214-698              .............SEPGP.S.P...Q.PTP.T.PTPQM..HERFI.AY...VGIPMLTIQARENDDQIILGSLGNQRMKYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNAD.SDY.WNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP.TDG.RFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEHLE...GTGSANR....VRR.........P.PRE.GHTYMA.SPR....EPEGKPVENK...PRD...ETPIQ..TQ...........ERQPD...Q..TP.SDD..V......S......D.AGSV......N.S....G...G...S......TESL...RL.EFGV....N....S..D.S...TYDA..TVD.....................................GTDWPR..I...P...PPR.H..PPEPRVSGNPRTVTD.FSTKADLLENWDAEHFDPGYSKEDVAAATIIAHGSIQDGRSMLEKREENVKNKTSSWKPP....LPKAVSPAIAKLRSIRKSQS.LEGGTLKK.......DATDGVSSIGSGSLTGGTLKRKATIEERLLQTLTTEQRLWYENLKKTNP.LAATQWLFEY......................................................................................................................................................................................................................................................
Q5CC80_BYDVP/564-648             ..........edv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPmarqRLREAAKAPSTLLYER-TPK.KSNNFLTRfmeanrsPTTPAAPTVSTTS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
Q8B6L6_9LUTE/9-298               ...........pgPDPAP.Q.P...T.PAP.E.PTPAK..HERFI.AY...TGTLSTLVSARQSSDSISLYSIRSQRIRYIEDENSSWTNIDAKWYSQNSVEAIPMFVYPVPEGTW.SIEISCEGYQAASSTSDPHRGKCDGMIAYDDDS.SKV.WNVGQQNNVTITNNKADNDWKYGHPD...LTINGDKFDQNQVVEKDGIISFHLVTTgPNA.SFFLVAPAVKKTAKYNFCVSYGDWTDRDMEFGMVSVVLDEHLE...GARSSQY....VRK.........T.PRS.GHVGVN.RSHr..lQDSSTPV---...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------eyvsdedssssngsivsirpstpdndseaqf.......................................................................................................................................................................................................................
B0FKR8_BYDVP/203-560             .sstpepkptpap-TPPP.Q.P...E.PKP.E.PTPAP.pPKRFF.EY...VGTPIGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWTGLIAYSNSS.GDN.WGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVQASgKDA.CFYIMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEALR....MSRhs.....esP.TRV.NNILID.EGY...hQTLPPIQNLG...LCD..vQTPGQ..DEve.......edDKQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LQ.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskpvDTSGEV..T...P...KPP.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------pkdneilgvyqgqpiyad....................................................................................................................................................................................................................................
B0FKX2_BYDVP/208-567             ........ptpap-APQP.T.P...Q.PAP.E.PTPAP.aPKRFF.EY...IGTPMGVISTRENTDSISVSQLGGQSMQYIENEKCETRTIDSFWSTNNNVAAQAAFVYPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGIIAYSNSS.DDN.WGIGNYRGCSFKNYLATNTWRPGHKD...LKLNDCQFTGGQIVERDSIISFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAIR....IAKhs.....atP.NRA.NHILVS.ERY...qDVLPTIENQG...LCD..vETPGQ..ETsiv.....eedDKQSV...S..TE.PEI..A......-......-.----......-.-....-...-...-......----...VK.EYEA....A....V..A.E...IPDA..EEDvlpske........................qlssrpvDTSGNT..I...P...RTK.E..P--------------.-----EVLGTYQGQNIYP----EDVPP---------------------------------....--------------------.--------.......-------------------------------------------------.----------aarqa.................................................................................................................................................................................................................................................
O93184_PEMV1/198-468             ..........pgp-DPGP.Q.P...P.PPP.P.PSPTP.vGARFW.GY...EGVTETRMVSERNDHDIDVKPLSFITMYKWEDESWTSVKLAASYLQNDQVEATPYFLIPSSKGKF.SVYIECEGFQAVKSIGGKSDGCWGGLIAY-NRK.KDG.WQARAYAGTLLSNYRSTTTVIDGHPD...CEVNDCKFLPDRGVESDLICSFHLEAE.DDS.YCLLQAPPIQKSSDYNYVVSYGGYTEKSIEWGSVSVSID-EVN...QTASASP....WRG.........R.ARK.LAIL--.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------qesavpppsppggvmdyrlgnregdqtg..........................................................................................................................................................................................................................
A5A2V6_BYDVP/219-572             .............PQPTP.A.P...Q.PAP.K.PTPAP.aPKRFF.EY...IGTPTGTISTRENSDSISVSELGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAER....ITRha.....eaP.IRS.KHILVS.EQY...eQPLPTIIDQG...LCD..vQTPEQ..EQtlv.....deeDKQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LM.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskpvDTSGNK..I...P...KPK.E..P--------------.-----EVLGTYQGQNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppiar.................................................................................................................................................................................................................................................
U5LV37_9LUTE/206-579             .........septPQPQP.E.P...K.PDP.Q.PTPEP.qHKRFF.EY...VGTPYVIIQTRESSDSIAVKSMNDQSFQYIENETSEQRTVQAWWTSNNGVQAQAAFVFPIPAGEY.SVNISCEGLQSVDHIGGNRDGYWIGLIAYQNQS.GDY.WGVGNYAGCDITNLLGTNTWRPGHED...LELNGCKFTNGQIVERDAVISFHVKAQgADP.KFYLMAPKTMKSDKYNYVVSYGGYTDKRMEFGSISVTVD---E...SDVEAQR....YNRhtst.vrktE.NRDyGWMSVL.PPY....DPDQVPEQEE...EQP...MVDKE..MDs........isPVEPP...S..PT.SDT..E......A......E.RAFD......L.R....E...E...E......LTRA...RL.EYEA....A....T..E.S...IPDA..APD.....................................-----I..L...P...SKS.E..MSSRPIDHDGRSLPK.PQSK-EVLGTYQGQNITP----DDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppviae................................................................................................................................................................................................................................................
D4P4W7_9LUTE/201-477             ...........ap--PTP.T.P...I.PTPpA.PTPAP..ASKYL.GY...QGVPSNIVKTRGNSEYLDVGPLENVTMYLWQDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYKTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.RQG.YFSLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVND...GAY----....-SR.........S.KWD.KTAAMS.ARL....PTQVSAPSEV...YTP...ETPEQ..PT...........DEGT-...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------esmppapnpalg..........................................................................................................................................................................................................................................
F8RUL3_9LUTE/201-418             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKYL.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGANDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVA------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------i.....................................................................................................................................................................................................................................................
Q9QQN6_9LUTE/4-274               ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVND...GAYS---....--R.........S.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------kwdkttamsarlptqvsapsevytpeapeqptnegtesmppa............................................................................................................................................................................................................
L0AN47_PLRV/1-106                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.-----------------------------------------MLEKREENVKNKTSSWKPP....LSKAVSPAIAKLRSIRKSQP.LEGGTLKK.......DATDGVSSIGSGSLTGGTLKRKVTIEERLLQTLTTEQRLWYENLKKTNP.PASTQWLFEY......................................................................................................................................................................................................................................................
Q8QYQ6_PLRV/214-698              .............SEPGP.S.P...Q.PTP.T.PTPQK..HERFI.AY...VGIPMLTIQARENDDQITLGSLGNQRMKYIEDENQSYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNAD.SDY.WNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP.TDG.RFFLVGPAIQKTAKYNYTISYGDWMDRDMELGLITVVLDEHLE...GTGSANR....VRR.........P.PRE.GHTYMA.SPR....EPEGKPVGNK...PRD...ETPIQ..TR...........ERQLD...Q..TP.SDD..V......S......D.AGSV......N.N....G...G...S......AESL...QL.EFGV....N....S..D.S...TYDA..TVD.....................................STDWPR..I...P...PPR.H..PPEPRVSGNSRTVTD.FSPKADLLENWDAEHFDPGYSKEDVAAATIIAHGSIQDGRSMLEKREENVKNKTSSWKPP....LPKAVSPAIAKLRSIRKSQP.LEGGILKK.......DATDGVSSIGSGSLTGGTLKRKVTIEERLLQTLTTEQRLWYENLKKTNP.LAATQWLFEY......................................................................................................................................................................................................................................................
G8Z1X3_9LUTE/209-612             ...........psPSPTP.P.P...P.PPP.Q.PQPQP.cAQRFW.GY...EGNPQNKILTAENSRNIDSRPLNFVQMYKWEDEKWDKVNLQAGYSRNDRRCMETYLTIPADKGKF.HVYLEADGEFVVKHIGGELDGSWLGNIAYDVSQ.-RG.WNIGNYKGCKIKNYQSNTTFVAGHPD...ATMNSKSFDSARAVEVDWYASFELECDdEEG.SWAIYPPPIQKDSSYNYTVSYGNYTEKYCEWGAISVSIDE--D...NNGSAPR....--R.........I.PRK.GAMAWS.TP-....EPSFSGDESQ...RQD..sKTPSP..E-...........ERGSD...T..LE.SET..K......K......E.EANL......Q.V....A...F...EeenipdVEDE...DI.WKGI....S....R..G.S...ETET..TEDd..................................raSTS-SR..L...RgnlKPQ.G..LPKP---QPTRTITQ.FNPNPDLVEAWRP-DLAPGYSKADVAAATVIAGGSIHEGRDMLRRREESVMDSRKKW---....--------------------.--------.......-------------------------------------------------.----------gvls..................................................................................................................................................................................................................................................
Q91QP6_9LUTE/11-313              .............PDPTP.P.P...A.PPP.E.PTPAK..HERFI.VY...TGTLSTLISARQNSDSISLYSIRDQRIRYIENENANWANIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGVIAYDDDQ.NKV.WNVGVQNNVTITNNKADADWKYGHPD...LTINGERFDQRQVVEKDGTISFHLVTTgPNA.SFFLVGPPVKKIAKYNFCISYGAWTDRDMEFGLVSVVLDEHLE...GVRGSQY....VRK.........T.LRP.GHISVN.RSH....RLQE------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------mppmredfseednsssdsntyktdnspmtvhfvkagdkesyttdqsddvep...................................................................................................................................................................................................
H9NAC9_9LUTE/201-265             ...........ap--PTP.T.P...T.PTP.SaPTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDES-------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------wsieql................................................................................................................................................................................................................................................
K4GSW3_9LUTE/212-504             .............PDPTP.P.P...A.PPP.E.PTPAK..HERFI.VY...TGTMSTLISARQNSDSISLYSIRDQRIRYIEDENANWTNIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQ.NKV.WNIGVQNNVTITNNKADADWKYGHPD...LTINGERFDQKQVVEKDGTISFHLVTTgPNA.SFFLAGPAVKKTAKYNFCISYGAWTDRDMEFGLVSVVLDEHLE...GVRGSQY....VRK.........T.LRP.GHVSVN.RSH....R---------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------lqdcftpveyvsdedsssssssivsnrpstpdhdsdaqfaeslr..........................................................................................................................................................................................................
Q9JH75_9LUTE/4-274               ...........ap--PTP.T.P...T.PTPpA.PTPAP..AXKYX.GY...QGVPXNIVKTRGNSEYLDVGPLENVTMYLWXDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYXTSDSNVPGHPD...MKVNGGSFTD-QLVERDXSCSFHLEVP.QQG.YFXLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVND...GAYS---....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------rskwdktxamsarlptqvsaxsevytpeapeqptnegtesmppa..........................................................................................................................................................................................................
Q9J1A7_9LUTE/565-649             ..........edv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPvarqKLREAAKAPSTMLYD-KAPK.GSKSILSRfvegnrsKATPAAPTVSTTS------------------NMTREQLREYTRIRNSLGvTAAKEYKAQF......................................................................................................................................................................................................................................................
Q65848_9LUTE/212-567             .............--PTP.Q.P...Q.PSP.Q.PQPEP.tKPRFYaNY...SGTPIVNISTRETTDSISVKKLGLQTLMYNSDEVHENRQIRSWWYSDNNVESQAAFVFPVPEGEF.SVQVTAEGLQSVDHIGGNYDGYWIGLIAYGNDT.SDN.WGIGIYNRCSITDLINTASWRPGHKD...MELNGCKFSD-QVVERDAIMSFKIHAQ.KDA.SFYLVAPKTKKSDKYNYVVSYGGYTEKRMEFGTISVTIDERNDearSQWHTQQ....LFR.........P.GQS.E--ILH.ERA....NPLSTFVPVP...DTN..fERNED..TNppvsvsspepeVNLNL...E..DI.SHE..L......T......E.KGRE......P.T....P...D...P......QDDLa.rRLeEYER....A....A..S.E...VPDFalTQD.....................................GEETPS..Is.lA...PPK.P..PGLPK----------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------spepaqtyr.............................................................................................................................................................................................................................................
B3FGT5_9LUTE/207-502             ..........sap-TPTPpP.P...A.PSP.E.PTPCK..GARFW.GY...EGNPQSKIQTAENNRNIDSRPLNYVSMYRWEDEKWDQVNLQAGYSRNDRRCMETYFVIPANKGKF.HVYLEADGEFVVKHIGGDLDGSWLGNIAYDVSQ.-RG.WNIGNYKGCSIKNYQSKTTFVAGHPD...ASMNGKNFDAARAVEVDWFASFELECDdDEG.SWRIYPPPIQKDSSYNYTVSYGNYTEKYCEWGAVSISID----...EDNATGR....VPQ.........K.IKP.RKGVMT.WST...pEPERQPVEQT...PVQ...EPSET..SGlda.....pptTKQED...E..TT.D--..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------dlggrfkepqipef........................................................................................................................................................................................................................................
U5LVB0_9LUTE/206-579             .........peptPQPQP.E.P...K.PDP.Q.PTPEP.qHKRFF.EY...VGTPYVIIQTRESSDSIAVKLMNDQSFQYIENETSEQRTVQAWWTSNNGVQAQAAFVFPIPAGEY.SVNISCEGLQSVDHIGGNRDGYWIGLIAYQNQS.GDY.WGVGNYAGCDITNLLGTNTWRPGHED...LELNGCKFTNGQIVERDAVISFHVKAQgADP.KFYLMAPKTMKSDKYNYVVSYGGYTDKRMEFGSISVTVD---E...SDVEAQR....YNRhtst.vrktE.NRDyGRMSVL.PPY....DPNQLPEQEE...EQP...MVDKE..MD...........SRSPV...E..PP.SPT..S......-......D.TEAE......R.AfdlrE...E...E......LTRA...RL.EYEA....A....T..E.S...IPDA..APD.....................................-----I..L...P...SKS.E..MSSRPIDHDGRSLPK.PQSK-EVLGTYQGQNITP----DDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppviae................................................................................................................................................................................................................................................
A5A2X4_BYDVP/219-573             .............PQPTP.A.P...Q.PAP.E.PTPAP.vPKRFF.EY...IGTPTGTISTRENTDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgKDA.SFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAER....ITRha.....etP.IRS.KHILVS.ERY...aEPLPTIVNQG...LCD..vKTPEQ..EQtlv.....dedDRQTV...S..TE.SDI..A......-......-.----......-.-....-...-...-......----...LQ.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskpmDTSGNL..I...P...KPK.E..P--------------.-----EVLGTYQGQNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppmarq................................................................................................................................................................................................................................................
Q8B6L0_9LUTE/11-309              .............PSPTP.P.P...A.PPP.E.PTPAK..HERFI.VY...TGTVSTLISARQNSDSISLYSIRDQRVRYIEDENANWTNIKAQWYSQSSVEAIPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQ.TKV.WNVGVQNNVTISNNKADADWKYGHPN...LTINGERFDQNQVVEKDGTISFHLVTTgPNA.SFFLVGPAVKKIAKYNYCISYGAWTDRDMEFGLVSVVLDEHLE...GARGSQY....VRK.........T.LRP.GHISVN.RSHr..lQDSFTPV---...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------eyvsdedsssnssivsnrpstpdndsdtqfaeslrgklpsqt............................................................................................................................................................................................................
V9PPM1_PLRV/214-698              .............SEPGP.S.P...Q.PTP.T.PTPQK..HERFI.AY...VGIPMLTIQARENDDQIILGSLGNQRMKYIEDENQNYTNISSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNAD.SDY.WNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP.TDG.RFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEHLE...GTGSANR....VRR.........P.PRE.GHTYMA.SPR....EPEGKPVGNK...PRD...ETPIQ..TQ...........ERQPD...Q..TP.SDD..V......S......D.AGSV......N.S....G...D...S......TESL...RL.EFGA....N....S..D.S...TYDA..TVD.....................................GTDWPR..I...P...PPR.H..PPEPRVSGNSRTVTD.FSPKADLLENWDAEHFDPGYSKEDVAAATIIAHGSIQDGRSMLEKREENVKNKTSSWKPP....LSKAVSPAIAKLRSIRKSQP.LEGGTLKK.......DTTDGVSSIGSGSLTGGTLKRKATIEERLLQTLTTEQRLWYENLKKTNP.PAATQWLFEY......................................................................................................................................................................................................................................................
B0FKS4_BYDVP/556-643             ......piyaddv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPiarqKLRDAAKAPSTMLYDK--AP.KSKSFLSR.......FVEGNRSKLETTAPS------TAT-----TSNLTREQLREYTRIRNSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
I1XV33_PLRV/1-106                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.-----------------------------------------MLEKREENVKNKTSSWKPP....LPKAVSPAIAKLRSIRKSQP.LEGGTLKK.......DATDGVSSIGSGSLTGGTLKRKVTIEERLLQTLTTEQRLWYENLKKTNP.LAATQWLFEY......................................................................................................................................................................................................................................................
Q5I4G6_BYDVP/556-643             ......piyaddv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPiarqKLRDASKAPSTMLYDKAPKP.K--SFLSR.......LVEGNRSKVDTSAP------STAT-----TSNLTREQLREYTRIRNSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
G3E244_9LUTE/1-259               ............m-----.-.-...-.---.-.-----..-----.--...-----------------------------------NWTNVDARWYSSNNVKAVPMYVFPVPEGTW.SVEISTEGYQPTASTTDPNKGKVDGMIAYSDDQ.SEV.WNVGINQNCNITNLKADNSWKYGHPD...MEINNCHFNQGQVLEMDGTISFHVETTgSDA.SFFLVGPAVQKQSKYNYAVSYGAWTDRDMELGLISVSLDEKDG...SRGSA--....MKR.........P.RRE.GHLKAV.STW....ETINLPEKEN...SEK...SITSQ..RQd.........fKTQPQ...Q..GF.SDA..G......S......E.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------dnkewdftpgtrmflpedfeeprevqnddllrdrg...................................................................................................................................................................................................................
T1VY69_9LUTE/199-464             .........spps--PEP.S.P...E.PPP.QpPAPTP.aRCRFW.GY...EGIPSVSVSSAENDRDVEVHALSTIDLYKFEDENWSTVHLRAGYSTNDRVHAQPYIVFPIEKGEF.DVYIECEGFQAVKSIGGKADGSWEGLIAYSTSD.S-G.WLVSEYVGVSITKYQSSTAFVGGHPD...TRLNDCSFKQDRAVECDIVCSFRLSADsDNA.KWLLYAPWIQKAAEYNYIVSYGAYTEKTCELGSISVNIDEVNE...QQGPSPA....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------skrwgrrrldrerklvktlvnqpssnleeak.......................................................................................................................................................................................................................
S4U2K1_9LUTE/1-76                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....KLREAANAPSTLLYE-KTSK.KSNNFLTRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
U5LU52_9LUTE/206-580             .........peptPQPQP.E.P...K.PDP.Q.PTPEP.qHKRFF.EY...VGTPYVIIQTRESSDSIAVKSMNDQSFQYIENETSEQRTVQAWWTSNNGVQAQAAFVFPIPAGEY.SVNISCEGLQSVDHIGGNRDGYWIGLIAYQNQS.GDY.WGVGNYAGCDITNLLGTNTWRPGHED...LELNGCKFTNGQIVERDAVISFHVKAQgADP.KFYLMAPKTMKSDKYNYVVSYGGYTDKRMEFGSISVTVD---E...SDVEAQR....YNRhtst.vrktE.NRDyGWMSVL.PPY....DPNQVPEQEE...EQP...MVDKE..MY...........SRSPV...E..PP.SPT..S......-......D.TEAE......R.AfdmrE...E...E......LTRA...RL.EYEA....A....T..E.S...IPDA..APD.....................................-----I..L...P...SKS.E..MSSRPIDHDGRSLPK.PQSK-EVLGTYQGQNITP----DDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppviaek...............................................................................................................................................................................................................................................
G3E226_9LUTE/1-280               ............m-----.-.-...-.---.-.-----..-----.--...-----------------------------------NWTNVDARWYSSNNVKAVPMYVFPVPEGTW.SVEISTEGYQPTASTTDPNKGKVDGMIAYSDDQ.SEV.WNVGINQNCNITNLKADNSWKYGHPD...MEINNCHFNQGQVLEMDGTISFHVETTgSDA.SFFLVGPAVQKQSKYNYAVSYGAWTDRDMELGLISVSLDEKDG...SRGSA--....MKR.........P.RRE.GHSKAV.STW....ETINLPEKEN...SEK...SITSQ..RQd.........sKTQPQ...Q..GF.SDA..G......S......E.D---......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------nkewdftpgtrmflpedfeepreaqnddllrdrgivvdpslleipdspppradhk...............................................................................................................................................................................................
F8VCF6_9LUTE/210-512             ...........pgPDPAP.Q.P...T.PTP.E.PTPAK..HERFI.AY...TGTLSTLISARQSSDSISLYSIRSQRIRYIEDENSSWTNIDAKWYSQNSVEAIPMFVYPVPEGTW.SIEISCEGYQAASSTSDPHRGKCDGMIAYDDDS.SKV.WNVGQQNNVTITNNKADNDWKYGHPD...LTINGDRFDQNQVVEKDGIISFHLVTTgPNA.SFFLVAPAVKKTAKYNFCVSYGDWTDRDMEFGMVSVVLDEHLE...GARSSQY....VRK.........T.LRP.GHISVN.RSH....R---------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------lqempptredfseedngssvntyitdnspitvhlvdneenyttdqsddvdpt..................................................................................................................................................................................................
A5A334_BYDVP/219-572             .............PQPTP.A.P...Q.PTP.E.PTPTP.vPKRFF.EY...VGTPTGVISTRENSDSISVSKLGGQSMQYIENEKCESKVIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGIGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDGVISFHVDATgTDA.CFYLAAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTFD---E...SDVEAER....IARhs.....etP.ARL.NHILVS.EAY...eEPLPTIIDQG...LCD..vKTPEQ..ETlev.....dedDKQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LQ.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsvkpvDSSGTL..L...P...KPK.E..P--------------.-----EVLGTYQGMNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppvar.................................................................................................................................................................................................................................................
Q91QQ6_9LUTE/9-307               ...........pgPSPAP.P.P...A.PPP.E.PTPAK..HERFI.VY...TGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTNIKAHWYSQSSVEAIPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQ.TKV.WNVGVQNNVTISNNKADADWKYGHPN...LTINGERFDQNQVVEKDGTISFHLVTTgPNA.SFFLVGPAVKKIAKYNYCISYGAWTDRDMEFGLVSVVLDEHLE...GVRGSQY....VRK.........T.LRP.GHISVN.RSHr..lQ---------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------dsftpveyvsdedsssnssivsnrpstpdndsdtqplkvklpsqtq........................................................................................................................................................................................................
F8RUK7_9LUTE/201-418             ...........ap--PTP.T.P...I.PTPpA.PTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPLVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFDLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVA------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------i.....................................................................................................................................................................................................................................................
S4U1A7_9LUTE/1-78                ...........rq-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....KLREAANAPSTLLYE-KTSK.KSNNFLTRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
B3GQB0_PLRV/214-698              .............SEPGP.S.P...Q.PTP.T.PTPQK..HERFI.AY...VGIPMLTIQARENDDQIILGSLGSQRMKYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNAD.SDY.WNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP.TDG.RFFLVGPAIQKTARYNYTISYGDWTDRDMELGLITVVLDEHLE...GTGSANR....VRR.........P.LRE.GHTYMA.SPR....EPEGKPVGNK...PRD...ETPIQ..TQ...........ERQPD...Q..TP.SDD..V......S......D.AGSV......N.S....G...G...S......TESL...RL.EFGV....N....S..D.S...TYDA..TVD.....................................GTDWPR..I...P...PPR.H..PPEPRVSGNSRTVTD.FSPKADLLENWDAEHFDPGYSKEDVAAATIIAHGSIQDGRSMLEKREENVKNKTSSWKPP....LPKAVSPAIAKLRSIRKSQP.LEKGTLKE.......DATDGVSSIGSGSLTGGTLKRKATIEERLLQTLTTEQRLWYENLKKTNP.LAATQWMFEY......................................................................................................................................................................................................................................................
B0FKX8_BYDVP/567-649             ............v-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPitrqKLREAAKAPSTLLYE-KTSK.KSNNFLTRfveanrsPTTPAAPTVSTAS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
Q45ZZ5_BYDVP/566-649             ...........dv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPlarqRLREAAKAPSTLLYER-TPK.KSENFLTRfveanrsPTTPAAPTVSTTS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
Q9IZG0_BYDVP/219-573             .............PQPEP.A.P...Q.PAP.E.PTPAP.vPKRFF.EY...IGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNST.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAER....ITRha.....etP.IRS.KHILVS.EQY...eQPLPTIIDQG...LCD..vQTPEQ..EQtlv.....deeDKQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LM.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskpvDTSGYK..I...P...KPK.E..P--------------.-----EVLGTYQGQNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppiarq................................................................................................................................................................................................................................................
D2K8X0_9LUTE/201-265             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDES-------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------wsieql................................................................................................................................................................................................................................................
S4U214_9LUTE/1-77                ............a-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....KLREAANAPSTLLYE-KTPK.KSNNFLTRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRRSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
A5A2U4_BYDVP/566-649             ...........dv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPivrqKLREAAKAPSTLLYE-KTPK.KSNNFLTRfveanrsPTTPAAPTVSTAS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
Q7T6K4_9LUTE/2-232               .........tmyl-----.-.-...-.---.-.-----..-----.--...-----------------------------WQDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYKTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFSLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVND...GAY----....-SR.........S.KWD.KTAAMS.ARL....PTQVSAPSEV...YTP...ETPEQ..PT...........DEGT-...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------esmppapnpalgpdnp......................................................................................................................................................................................................................................
Q3YB89_9LUTE/212-490             .............PDPTP.P.P...A.PPP.E.PTPAK..HERFI.VY...TGTLSTLISARQNSDSISLYPIRDQRVRYIEDENANWAYIKAQWYSQNSVEAVPMFIYPVPQGTW.SVEISCEGYQATSSTTDPHRGKSDGMIAYDDDQ.TKV.WNVGVQNNVTITNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTgPNA.SFFLAGPAVKKIAKYNFCISYGAWTDRDMEFGLVSVVLDEHLE...GVRGSQY....VRK.........T.LRP.GHISVN.RPH....R---------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------lqimpptreddsdgyssssdsntyktdnsp........................................................................................................................................................................................................................
MCAPS_BYDVP/564-649              ..........edv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPmarqKLREAANAPSTLLYERRTPK.KSGNFLSRlveanrsPTTPTAPSVSTTS------------------NMTREQLREYTRIRNSSGiTAAKAYKAQF......................................................................................................................................................................................................................................................
B0FKR8_BYDVP/557-643             .......iyaddv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPiarqKLRDAAKAPSTLLYDK--AP.KSKSFLSRfvegnrsKTETTAPSTATTS------------------NLTREQLREYTRIRNSLGiTAAREYKAQF......................................................................................................................................................................................................................................................
B0FKV4_BYDVP/203-568             ..sstpepkptpaPTPAP.T.P...E.PKP.E.PTPAP.pPKRFF.EY...VGTPIGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEASgKDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEALR....IIRhs.....ecP.TRV.NNILID.EGY...iQPLSTITDQG...LCD..vQTPGQ..DQev......veeDRQTV...S..TE.SDI..A......-......-.----......-.-....-...-...-......----...LK.EYEA....A....I..A.E...IPDA..EEDalpsre........................qlsskpvDTSGEE..I...P...KPR.P..P--------------.---SNEVLGVYQGQPIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------psgtr.................................................................................................................................................................................................................................................
S6CRN9_BYDVP/562-649             .......iypedv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPvarqKLREAARAPSTMLYD-KAPK.GSKSILSRfvegnrsKATPAAPSMSTNS------------------NMTREQLREYTRIRNSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
S4U5P6_9LUTE/1-69                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....-------APSTLLYE-KTSK.KSNNFLTRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
B7TWD4_9LUTE/212-497             .............PDPTP.P.P...A.PPP.E.PTPAK..HERFI.VY...TGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTNIQAQWYSQNSVEAIPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQ.KKV.WNVGVQNNVTISNNKADADWKYGHPN...LTINGERFDQNQVVEKDGTISFHLVTTgPNA.SFFLVGPPVKKIAKYNYCISYGAWTDRDMEFGMVSVVLDEHLE...GVRGSQY....VRK.........T.LRP.GHISVN.RSH....RL--------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------qemppmredfseednsssdsntyktdnspltvhlvk..................................................................................................................................................................................................................
Q8B6M0_9LUTE/9-517               ...........pgPDPAP.Q.P...T.PTP.E.PTPAK..HERFI.AY...TGTLSTLVSARQSSDSISLYSIRSQRIRYIEDENSSWTNIDAKWYSQNSVEAIPMFVYPVPEGTW.SIEISCEGYQAVSSTSDPHRGKCDGMIAYDDDS.SKV.WNVGQQNNVTITNNKADNDWKYGHPD...LTINGDKFDQNQVVEKDGIISFHLVTTgPNA.SFFLVAPAVKKTAKYNFCVSYGDWTDRDMEFGMVSVVLDEHLE...GARSSQY....VRK.........S.PRS.GHVGVN.RSH....RLQDNFVPTE..yVSD...EDSNS..SSsi.......vsNRPST...P..DN.DSD..A......Q......F.AESI......K.G....K...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------lpsqtklppkgflsrlsvkekeeisnskpsnveglvgplvaaygypsqtgvydaareilqakeaaenlaelerdlkeinkleppdvivqeeipdfvppsektlkeddpyyvppiwqnadqavlvstyeppdwsrpayesgdplkktgtlkgtlsksggslrsgesslrgslrktqdqtdldnklsklsviqrsqyqrilnnlgktrarayidg.................................
C8CBB0_9LUTE/208-655             ............p-PPGP.S.P...P.PSP.S.PPPPV..PSRFW.GY...EGNPQCKILTAENNRNIDSRPLNFVSMYKWEDEKWDKVNLQAGYSRNDRRCMETYFVIPASRGKF.HVYLEADGEFVVKHIGGDCDGNWLGNIAYDVSQ.-RG.WNIGDYKGCRISNYQSNTVFVAGHPD...AEMNGKHFDAARAVEVDWFASFELTCDdEDG.AWRIYPPPIQKDSSYNYTVSYGDYTEKYCEWGAVSVSIDE-DN...STGTKSR....IK-.........P.HK-.GVMMWS.YPEkensEGESESETDQ...GKD..lKTPDA..TT...........---LV...D..FE.SDD..N......S......S.SKSA......E.S....I...P...D......NTDL...-N.PWNAvvssK....S..D.R...PFKQ..EDDrvstssrlsgnlrrpgsgnpqlrsplgrekapepsesDLDAAR..IkglP...PPR.E..Q-LPG-FKPTRSIST.FNPEPDLVEAWRPG-TGPGYSKEDVAAATILAHGSIADGRSMLDKRDQEVLRSRSSWGTG....--------------------.--------.......-------------------------------------------------.----------gflkkmktsss...........................................................................................................................................................................................................................................
W8Q9Y2_BYDVP/21-249              .............PEPTP.A.P...Q.PTP.E.PTPAP.aPKRFF.EY...VGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYRGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgNDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAE-....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------......................................................................................................................................................................................................................................................
B5KLA7_9LUTE/1-373               ...........ma-----.-.-...-.---.-.-----..-----.--...----------QSTDDAISLYDMPSQRFRYIEDENMNWTNLDSRWYSQNSLKAIPMVIVPVPQGEW.TVEISMEGYQPTSSTTDPNKDKQDGLIAYNDDL.KEG.WNVGVYNNVEITNNKADNTLKYGHPD...MELNSCHFNQQQCLERDGDLTCHIKTTgDNA.SFFIVGPAVQKQSKYNYAVSYGAWTDRMMEIGMIAIALDE--Q...GSSGSAR....TER.........P.KRV.GHSMAV.STW....ETINLPEKED...SEK...LKTGQ..RQ...........DLKTP...F..TI.SES..S......-......D.VKGI......EkR....D...L...P......S---...--.---S....G....H..D.D...IPDF..IGNdpwsnvsi.....................rklqeeeaMTSKSG..L...R...PQL.K..PPGLPKPQPVRTIGN.FNPTPELVESWRP-DVNPGYSKEDVAAATILYGGSIKDGRSMIDKRDKAVLDGRKHW---....--------------------.--------.......-------------------------------------------------.----------gssl..................................................................................................................................................................................................................................................
B0FKK2_BYDVP/557-643             .......iyaddv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPiarqKLRDAAKAPSTLLYDK--AP.KSKSFLSRfvegnrsKTETTAPSTATTS------------------NLTREQLREYTRIRNSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
S4U4J3_9LUTE/1-75                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....-LREAANAPSTLLYE-KTPK.KSNNFLTRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRRSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
A5A2Z2_BYDVP/219-572             .............PQPTP.A.P...Q.PAP.E.PTPAP.aPKRFF.EY...IGTPTGTISTRGNSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAER....TTRha.....etP.IRS.KHILVS.EQY...eQPLPTIIDQG...LCD..vQTPEQ..EQtlv.....deeDKQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LM.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskpvDTSGNK..I...P...KPK.E..P--------------.-----EVLGTYQGQNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppiar.................................................................................................................................................................................................................................................
F8RUG5_9LUTE/201-418             ...........ap--PTP.T.P...Q.PTPpA.PAPAP..APKYF.GY...QGVPNNIIKTRGNSEYLDVGQLDSVTMYLWKDESWSIEKLSAGYRVNNRDRAIPYLLIPVEKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFIC-DNVN.LQG.WRAYAYTGCSISNYKTADSNVPGHPD...MRVNNCSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTEKIMEWGSVSIA------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------i.....................................................................................................................................................................................................................................................
B5L2B5_9LUTE/208-612             ............p-GPSP.G.P...S.PSP.Q.PTPQK..KYRFI.VY...TGVPVTRIMAQSTDDAISLYDMPSQRFRYIEDENMNWTNLDSRWYSQNSLKAIPMIIVPVPQGEW.TVEISMEGYQPTSSTTDPNKDKQDGLIAYSDDL.KEG.WNVGVYNNVEITNNKADNTLKYGHPD...MELNGCHFNQGQCLERDGDLTCHVKTTgDNA.SFFIVGPAVQKQSKYNYAVSYGAWTDRMMEIGMIAIALDEQ-G...SSGSA-K....TER.........P.KRV.GHSMAV.STW....ETINLPEKEN...SEE...FKTDQ..RQ...........DLNTP...P..TT.GGS..F......-......D.MLDI......V.Q....G...G..lP......---L...PV.E---....-....-..E.N...IPDS..IMDdpwsnipa....................kssqedeavSSKSGF..K...P...QLK.P..PGLPR-PQPVRTIRN.FDPNPDLVEAWRP-DVNPGYSKEDVAAATVMYGGSIKEGRSMIDKRDKAVLDGRKSW---....--------------------.--------.......-------------------------------------------------.----------gssl..................................................................................................................................................................................................................................................
B0FEU2_PLRV/214-698              .............SEPGP.S.P...Q.PTP.T.PTPQK..HERFI.AY...VGIPMLTIQARENDDQIILGSLGSQRMKYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNAD.SDY.WNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP.TDG.RFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEHLE...GTGSANR....VRR.........L.PRE.GHTHMA.SPH....EPEGKPVGNK...PRD...ETPIQ..TQ...........ERQPD...Q..TP.SDD..V......S......D.AGSV......N.S....G...G...S......TESL...QL.EFGA....N....S..D.S...TYDA..TVD.....................................GTDWPR..I...P...PPR.H..PPEPRVSGNSRTVTD.FSPKADLLENWDAEHFDPGYSKEDVAAATIIAHGSIQDGRSMLEKREENVKNKTSSWKPP....LSEAVSPAIAKLRSIRKSQP.LEGGTLKK.......DVTDGVSSIGSGSLTGGTLKRKETIEERLLQTLTTEQRLWYENLKKTNP.PAAIQWLYEY......................................................................................................................................................................................................................................................
S6CRN9_BYDVP/219-571             .............PQPAP.S.P...Q.PAP.E.PTPAP.aPKRFF.EY...VGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSLWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNST.GDN.WGVGNYRGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVDATgNDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAER....IARhs.....etP.ARM.NHILVS.ERY...eEPLPTIIDQG...LCD..lETPEQ..ETllv.....deeDRQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LQ.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlstkpvDTSGTP..L...P...KPK.E..P--------------.-----EVLGTH-------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------qgmniypedvppva........................................................................................................................................................................................................................................
B0FKN2_BYDVP/212-563             ...........paPTPAP.A.P...E.PKP.E.PTPAP.pPKRFF.EY...VGTPVGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEASgKDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEALR....MTRhs.....ecP.TRV.NNILID.EGF...cQPLSTTTDQG...LCD..vQTPGQ..EQev......veeDRQTV...S..TG.SDI..A......-......-.----......-.-....-...-...-......----...LM.EYEA....A....T..A.E...IPDA..EEDalpsre........................qlsskpvDTSGEE..I...P...KPR.P..P-NNEVL--------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------gvyqgqpiyaedv.........................................................................................................................................................................................................................................
J7FCG7_9LUTE/209-549             ........paptp--PPP.P.P...G.PPP.E.PTPCK..GARFW.GY...EGNPQSKIQTAQNYRNIDFRPLNYVSMYRWEDEKWDKVELQAGYSRNDRRCMETYFEVPASKGKF.HVYLEADGEFVVKHIGGDLDGSWLGNIAYDVSQ.-RG.WNVGNHKGCNIKNYQSNTSFVAGHPD...ATMNGKQFDKARAVEVDWYASFELECD.DDGgSWRIYPPPIQKDSSYNYTVSYGNYTDKYCEWGAVSISIDED-N...PTGRAPQ....SIK.........P.R-K.G-VMTW.SMP....EPERQLAEQT...PAE...EPSE-..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------tsglggpplikfgedstgsqgdhitksqipeastpmhqivrdlggltdstnraprgvaewiqvdadpvneeeyssdg.........................................................................................................................................................................
F8RUM8_9LUTE/201-418             ...........ap--PTP.P.P...T.PTPpA.PTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVA------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------i.....................................................................................................................................................................................................................................................
F8RUH1_9LUTE/201-418             ...........ap--PTP.I.P...Q.PTPpA.PAPAP..APKYF.GY...QGVPNNIIKTRGNSEYLDVGQLDSVTMYLWKDESWSIEKLSAGYRVNNRDRAIPYLLIPVEKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFIC-DNVN.LQG.WRAYAYTGCSISNYKTADSNVPGLPD...MRVNNCSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTEKIMEWGSVSIA------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------i.....................................................................................................................................................................................................................................................
C7AXW8_BYDVP/38-187              .............PQPTP.A.P...Q.PAP.E.PTPAP.vPKRFF.EY...IGTPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GEN.WGVGNYKGCSSPIVLATNTWRPGH--...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------......................................................................................................................................................................................................................................................
F8RUF3_9LUTE/201-470             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVND...GAYS---....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------rskwdkttamsarlptqvsapsevytpeapeqpttegtesmpp...........................................................................................................................................................................................................
B1A446_9LUTE/212-504             .............PDPTP.P.P...A.PPP.E.PTPAK..HERFI.VY...TGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQ.TKV.WNIGVQNNVTISNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTgPNA.SFFLAGPAVKKIAKYNYCISYGAWTDRDMEFGMVSVVLDEHLE...GVRGSQY....VRK.........T.LRP.GHISVN.RTH....RLQE------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------mppmredfseednsssdsntnktdnspltvhlvkagdeeny.............................................................................................................................................................................................................
Q8B6L8_9LUTE/9-309               ...........pgPDPAP.Q.P...T.PTP.E.PTPAK..HERFI.AY...TGTLSTLISARQSSDSISLYSIRSQRIRYIEDENSSWTNIDAKWYSQNSVEAIPMFVYPVPEGTW.SIEISCEGYQAASSTSDPHRGKCDGMIAYDDDS.SKV.WNVGQQNNVTITNNKADNDWKYGHPD...LTINGDRFDQNQVVEKDGIISFHLVTTgPNA.SFFLVAPAVKKTAKYNFCVSYGDWTDRDMEFGMVSVVLDEHLE...GARSSQY....VRK.........T.PRS.GHVGVN.RSH....RLQDNFVPTE...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------yvsdedsssnssivsnrpstpdndsdaqfaesmkgklpsqt.............................................................................................................................................................................................................
B0FL08_BYDVP/219-571             .............PQPTP.A.P...Q.PAP.E.PTPAP.aPKRFF.EY...IGIPTGTISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNYVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAER....ITRha.....ktP.IRS.KHILVS.EQY...eQPLPTIIDQG...LCD..vQTPEQ..EQtlv.....deeDKQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LM.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskpvDTSGNK..I...P...KPK.E..P--------------.-----EVLGTYQGQNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppia..................................................................................................................................................................................................................................................
A5A2U4_BYDVP/219-572             .............PQPTP.A.P...Q.PAP.E.PTPAP.vPKRFF.EY...IGTPTGIISTRENSDSISVSKLGGQSMQYIENEKCETKVIDSFWSTNNNVSAQAVFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAER....ITRha.....etP.IRS.KHILVS.EQY...eQPLPTIIDQG...LCD..vQTPEQ..EQtlv.....deeDKQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LM.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskpvDTSGNK..I...P...KSK.E..P--------------.-----EVLGTYQGQNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppivr.................................................................................................................................................................................................................................................
A5A2V0_BYDVP/567-649             ............v-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPvarqKLREAANAPSTLLYER-TPK.KSNNFLTRfveanrsPTTPAAPTVSTAS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
B1A416_9LUTE/212-500             .............PDPTP.P.P...A.PPP.E.PTPAK..HERFI.VY...TGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAIPMFIYPVPQGTW.SVEISCEGYQATSSTTDPHRGKSDGMIAYDDDQ.TKV.WNVGVQNNVTITNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTgPNA.SFFLAGPAVKKIAKYNFCISYGAWTDRDMEFGLVSVVLDEHLE...GVRGSQY....VRK.........T.LRP.GHISVN.RTH....RL--------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------qemppmredfseednsssdsntyktdnspltvhlvkagd...............................................................................................................................................................................................................
Q80FH7_9LUTE/201-471             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISVAIDEVND...GAYS---....--R.........S.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------kwdkttamsarlptqvsapsevytpeapeqptnegtesmppa............................................................................................................................................................................................................
MCAPS_PLRVW/213-697              .............PEPGP.S.P...Q.PTP.T.PTPQK..HERFI.AY...VGIPMLTIQARESDDQIILGSLGSQRMKYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNAD.SDY.WNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP.TDG.RFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEHLE...GTGSANR....VRR.........P.PRE.GHTYMA.SPR....EPEGKPVGNK...PRD...ETPIQ..TQ...........ERQPD...Q..TP.SDD..V......S......D.AGSV......N.S....G...G...S......TESL...QL.EFGA....N....S..D.S...TYDA..TVD.....................................GTDWPR..I...P...PPR.H..PPEPRVSGNSRTVTD.FSPKADLLENWDAKHFDPGYSKEDVAAATIIAHGSIQDGRSMLEKREENVKNKTSSWKPP....LPKAVSPAIAKLRSIRKSQP.LEGGTLKK.......DATDGVSSIGSGSLTGGTLKRKETIEERLLQTLTTEQRLWYENLKKTNP.LAATQWLFEY......................................................................................................................................................................................................................................................
F8RUM2_9LUTE/201-418             ...........ap--PTP.T.P...T.PTPpA.PTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLENVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCTISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVSYANFTDKILEWGSISA-------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------ai....................................................................................................................................................................................................................................................
F8RUI6_9LUTE/201-418             ...........ap--PTP.T.P...T.PTPpA.LTPAP..APKYF.GY...QGVPNNIVKTRGNSEYLDVGPLKNVTMYLWKDESWSIEQLSAGYRVNNRERAIPFVLFPVDKGKY.SVFIQCEGFKAVKAKGGTNDGKMSGFLC-DNAN.LAG.WRAYAYSGCIISNYRTSDSNVPGHPD...MKVNGGSFTD-QLVERDFSCSFHLEVP.QQG.YFGLEAPPIEKSDHFNFVVAHANFTDKILEWGSISVA------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------i.....................................................................................................................................................................................................................................................
Q84817_PLRV/5-489                .............SEPGP.S.P...Q.PTP.T.PTPQK..HERFI.AY...VGIPMLTIQARENDDQIILGSLGSQRMKYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNAD.SDY.WNVGEADGVKISKLRNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP.TDG.RFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEHLE...GTGSASR....MRR.........P.LRE.GHTYMA.SPR....EPEGKPVGNK...PRD...ETPIQ..TQ...........ERQPD...Q..TP.SDD..V......S......D.AGSV......N.S....G...G...S......TESL...QL.EFGV....N....S..D.S...TYDA..TVD.....................................GTDWPR..I...P...PPR.H..PPEPRVSGNSRTVTD.FSSKADLLENWDAEHFDPGYSKEDVAAATIIAHGSIQDGRSMLEKREENVKNKTSSWKPP....LPKAVSPAIAKLRSIRKSQP.LEGGTLKK.......DATDGVSSIGSGSLTGGTLKRKATIEERLLQTLTTEQRLWYENLKKTNP.PAATQWLFEY......................................................................................................................................................................................................................................................
B0FKK8_BYDVP/203-563             ..sstpepkptpaPTPAP.T.P...E.PKP.E.PTPAP.pPKRFF.EY...VGTPIGVISTRENTDSISVSKLGGQSMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEASgKDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEALR....MTRhs.....ecP.TRV.NNILID.EGY...cQPLSTITDQG...LCD..vQTPGQ..DQev......veeDRQTV...S..TE.SDI..A......-......-.----......-.-....-...-...-......----...LK.EYEA....A....I..A.E...IPDA..EEDalpsre........................qlsskpvDTSGEE..I...P...KPR.P..PS-NE----------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------vlgvyqgqpiyaddv.......................................................................................................................................................................................................................................
E0A2S6_9LUTE/1-137               ...........ga-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.--T.WNVGEYNNVKITKLLNTSSWKKGHKD...VVLNGCHFNDGQVIERDSTMSFHCEVGhGGG.TILLVAPPVCKSDKYNYVVPYGEYTTKHMEFGSIAICFDEKHG...GARAGKF....LGA.........PfPRA.GHVVCE.QQT....E---------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------iarfpagsd.............................................................................................................................................................................................................................................
B0FL08_BYDVP/565-649             ..........edv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPiarqKLREAANAPSTLLYE-KTPK.KSNNFLTRfvdanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRKSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
Q8QYR3_PLRV/214-698              .............SEPGP.S.P...Q.PTP.T.PTPQK..PKRFI.AY...VGIPMLTIQARENDDQIILGSLGSQRMEYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPRGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNAD.SDY.WNVGEADGVKISKLRNDNTYRQGHPD...LEINSCHFREGQLLERDATISFHVEAP.TDG.RFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEHLE...GTGSANR....VRR.........P.PRE.GHTYMA.SPR....KPEGKPVGNK...PRD...ETPIQ..TQ...........ERQPD...Q..TP.SDD..V......S......D.AGSV......N.S....G...G...S......TESL...RL.EFGV....N....S..D.S...TYDA..TVD.....................................STDWPR..I...P...PPR.H..PPEPRVSGNSRTVTD.FSPKADLLENWDAEHFDPGYSKEDVAAATIIAHGSIQDGRSMLEKREGNVKNKTSSWKLP....LPKAESPAIAKLRSIRKSQP.LEGGTLKK.......DTTDGVSSIGSGSLTGGTLKRKATIEEHLLQTLTTEQRLWYENLKKTNP.LAATQWLFKY......................................................................................................................................................................................................................................................
Q8QYR8_PLRV/214-698              .............SEPGP.S.P...Q.PTP.T.PTPQK..HERFI.AY...VGIPMLTIQARENDDQIILGSLGSQRMKYIEDENQNYTNVSSEYYSQSSMQAVPMYYFNVPKGQW.SVDISCEGYQPTSSTSDPNRGRSDGMIAYSNAD.SDY.WNVGEADGVKISKLCNDNTYRQGHPE...LEINSCHFREGQLLERDATISFHVEAP.TDG.RFFLVGPAIQKTAKYNYTISYGDWTDRDMELGLITVVLDEHLE...GTGSAYR....VRR.........P.PRE.GHTYMA.SPR....EPEGKPVGNK...PRD...ETPIQ..TQ...........ERQPD...Q..TP.SDD..V......S......D.AGSV......N.S....G...G...S......TESL...QL.EFGP....N....S..D.S...TYDA..TVD.....................................GTDWPR..I...P...PPR.H..PPKPRVSGDSRTVTD.FSPKADLLENWDAEHFDPGYSKEDVAAATIIAHGSIQDGRSMLEKREENVKNKTSSWKPP....LPKAVSPAIAKLRSIRKSQP.LEGGTLKK.......DATDGVSSIGSGSLTGGTLKRKVTIEERLLQTLTTEQRLWYENLKKTNP.PAAIQWLHEY......................................................................................................................................................................................................................................................
T1VY64_9LUTE/199-463             .........spps--PEP.S.P...E.PPP.QpPAPTP.aRCRFW.GY...EGIPSVSVSSAENDRDVEVHALSTIDLYKFEDENWSTVHLRAGYSTNDRVHAQPYIVFPIEKGEF.DVYIECEGFQAVKSIGGKADGSWEGLIAYSTSD.S-G.WLVSEYVGVSITKYQSSTAFVGGHPD...TRLNDCSFKQDRAVECDIVCSFRLSADsDNA.KWLLYAPWIQKTSEYNYIVSYGAYTEKTCELGSISVNIDEVNE...QQGPSPA....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------skrwgrrrldrerqlvktlvnqpssnleea........................................................................................................................................................................................................................
A5A2W2_BYDVP/219-573             .............PQPTP.A.P...Q.PAP.E.PTPAP.vPKRFF.EY...IGTPTGTISTRENSDSISVSKLGGQLMQYIENEKCETKVIDSFWSTNNNVSAQAAFVYPVPEGSY.SVNISCEGFQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCSFKNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVEATgTDA.CFYLMAPKTMKTDKYNYVVSYGGYTNKRMEFGTISVTCD---E...SDVEAER....ITRha.....etP.IRS.KHILVS.EQY...eQPLPTIIDQG...LCD..vQTPEQ..EQtlv.....deeDKQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LM.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskpvDTSGNK..I...P...KPK.E..P--------------.-----EVLGTYQGQNIYP----EDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppiarq................................................................................................................................................................................................................................................
S4U192_9LUTE/1-76                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....KLREAANAPSTLLYE-KTPK.KSNNFLSRfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRRSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
B0ZT87_9LUTE/206-579             .........peptPQPQP.E.P...K.PDP.Q.PTPKP.qHKRFF.EY...VGTPYAIIQTRESSDSIAVKSMNDQSFQYIENETSEQRTVQAWWTSNNGVQAQAAFVFPIPAGEY.SVNISCEGLQSVDHIGGNRDGYWIGLIAYQNQS.GDY.WGVGNYAGCDITNLLGTNTWRPGHED...LELNGCKFTNGQIVERDAVISFHVKAQgADP.KFYLMAPKTMKSDKYNYVVSYGGYTDKRMEFGSISVTVD---E...SDVEAQR....YNRhtst.vrktE.NRDyGWMSVL.PPY....DPNQMPEQEE...EQP...MVDKE..MD...........PRSPV...E..PP.SPT..S......-......D.TEAE......R.AfdlrE...E...E......LTRA...RL.EYEA....A....T..E.S...IPDA..APD.....................................-----I..L...P...SKS.E..MSSRPIDHDGRSLPK.PQSK-EVLGTYQGQNITP----DDV-----------------------------------....--------------------.--------.......-------------------------------------------------.----------ppviae................................................................................................................................................................................................................................................
B0FKM6_BYDVP/203-554             .sstpepkptpap-TPPP.Q.P...E.PKP.E.PTPAP.pPKRFF.EY...VGTPTGVISTRENTDSISVSKLGGQLMQYIENEKCETKTIDSFWSTNNNVSAQAAFVFPVPEGSY.SVNISCEGLQSVDHIGGNEDGYWIGLIAYSNSS.GDN.WGVGNYKGCVFTNFLATNTWRPGHKD...LKLNDCQFTDGQIVERDAVMSFHVQASgKDA.CFYIMAPKTMKTDKYNYVVSYGGYANKRMEFGTISVTCD---E...SDVEALR....MSRhs.....esP.TRV.NNILID.EGY...hQTLSPIQNLG...LCD..vQTPGQ..DEve.......edDKQTV...S..TE.PDI..A......-......-.----......-.-....-...-...-......----...LL.EYEA....A....T..A.E...IPDA..EEDvlpske........................qlsskpvDTSGEE..I...P...KPP.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------prdneilgvyqg..........................................................................................................................................................................................................................................
B1A443_9LUTE/212-500             .............PDPTP.P.P...A.PPP.E.PTPAK..HERFI.VY...TGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWTYIKAQWYSQNSVEAVPMFIYPVPQGTW.SIEISCEGYQATSSTTDPHRGKSDGMIAYDDDQ.TKV.WNIGVQNNVTISNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTgPNA.SFFLAGPAVKKIAKYNYCISYGAWTDRDMEFGMVSVVLDEHLE...GVRGSQY....IRK.........T.LRP.GHISVN.RTH....RL--------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------qemppmredfseednsssdsntyktdnspltvhfvkagd...............................................................................................................................................................................................................
B1A449_9LUTE/212-500             .............PDPTP.S.P...T.PPP.E.PTPAK..HERFI.VY...TGTLSTLISARQNSDSISLYSIRDQRVRYIEDENANWAYIKAQWYSQNSVEAVPMFIYPVPQGTW.SVEISCEGYQATSSTTDPHRGKSDGMIAYDDDQ.TKV.WNVGVQNNVTITNNKADADWKYGHPN...LTINGERFDQQQVVEKDGTVSFHLVTTgPNA.SFFLAGPAVKKIAKYNFCISYGAWTDRDMEFGLVSVVLDEHLE...GVRGSQY....VRK.........T.LRP.GHISVN.RSH....RL--------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------qemppmredfseednsssdsntyktdnspltvhlvkagd...............................................................................................................................................................................................................
G1K0U2_9LUTE/210-716             ...........pgPDPAP.Q.P...T.PTP.E.PTPAK..HERFI.AY...TGTLSTLISARQSSDSISLYSIRNQRIRYIEDENSSWANIDAKWYSQNSVEAIPMFVYPVPEGTW.SIEISCEGYQAASTTSDPHRGKCDGMIAYDDDS.SKV.WNVGQQNNVTITNNKADNDWKYGHPD...LTINGDRFDQNQVVEKDGIISFHLVTTgPNA.SFFLVAPAVKKTAKYNFCVSYGDWTDRDMEFGMVSVVLDEHLE...GARSSQY....IRK.........S.PRP.GHFGVN.RSHr..lQDSFTPVEYV...SED...DSSSS..SSi........vsNRPST...P..VS.DSE..V......Q......F.AESL......K.G....K...L...P......TQ--...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....--------------------.--------.......-------------------------------------------------.----------sklppkgflsrlsvkekeeisksrpsnvenqveplvkaygypsqtgvydaareilqakeaaenlaelerdlkeinrleppdiivqeeipdfvppsekvvqednreyippiwrnadqavavssyeppdwsqsayesgypsrkvgslrgtlsklggslksgesslrgslrktqdqsdldyklsklnvlqrsqyqrilanlgktrarayi.......................................
S4U2L1_9LUTE/1-71                .............-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.------------------------------------------------------------....-----ANAPSTLLYE-KTSK.KSNNFLARfveanrsPTTPAAPTVSTVS------------------NMTREQLAEYTRIRRSLGlTAAKEYKAQF......................................................................................................................................................................................................................................................
B0FKZ0_BYDVP/555-645             ....gqpiyaddv-----.-.-...-.---.-.-----..-----.--...-----------------------------------------------------------------.---------------------------------.---.--------------------------...---------------------------.---.-------------------------------------------...-------....---.........-.---.------.---....----------...---...-----..--...........-----...-..--.---..-......-......-.----......-.-....-...-...-......----...--.----....-....-..-.-...----..---.....................................------..-...-...---.-..---------------.----------------------------------------------------------PPgtrqKLRDAAKAPSTLLYD-KTPK.RSKSILSR.......FIEGNRSSVESAAPS------TAT-----TSNLTREQLREYTRIRNTLGlTAAKAYKAQF......................................................................................................................................................................................................................................................
#=GC seq_cons                    ...............PtP...P...t.PsP.t.PsPt.....+ah..Y....Gh...hl.sptssc.l.l..ht..ph.hhcsEp.pht.lpu.a.spsp.pA.shhlhPlspGpa.SV.IpsEGhpsspthssspcGh..Ghls.sssp..ts.Wtsh.hpssphpN.hssss.h.GH.-...hplNstpFsp.QhlE+Dh.hSFHl.ss..pu..Fhl.uP.h.Kps+aNaslSYusaTs+.hEhG.lolshD...t...t...............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
//
DBGET integrated database retrieval system