GenomeNet

Database: Pfam
Entry: PRP38
LinkDB: PRP38
Original site: PRP38 
#=GF ID   PRP38
#=GF AC   PF03371.11
#=GF DE   PRP38 family
#=GF AU   Bateman A, Winge P
#=GF SE   Winge P
#=GF GA   22.40 22.40;
#=GF TC   22.60 22.50;
#=GF NC   22.10 22.10;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 80369284 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   1508195
#=GF RT   PRP38 encodes a yeast protein required for pre-mRNA splicing and
#=GF RT   maintenance of stable U6 small nuclear RNA levels. 
#=GF RA   Blanton S, Srinivasan A, Rymond BC; 
#=GF RL   Mol Cell Biol 1992;12:3939-3947.
#=GF RN   [2]
#=GF RM   9582287
#=GF RT   Progression through the spliceosome cycle requires Prp38p
#=GF RT   function for U4/U6 snRNA dissociation. 
#=GF RA   Xie J, Beickman K, Otte E, Rymond BC; 
#=GF RL   EMBO J 1998;17:2938-2946.
#=GF DR   INTERPRO; IPR005037;
#=GF CC   Members of this family are related to the pre mRNA splicing 
#=GF CC   factor PRP38 from yeast [1].  Therefore all the members of this
#=GF CC   family could be involved in splicing.  This conserved region
#=GF CC   could be involved in RNA binding. The putative domain is about
#=GF CC   180 amino acids in length. PRP38 is a unique component of the
#=GF CC   U4/U6.U5 tri-small nuclear ribonucleoprotein (snRNP) particle
#=GF CC   and is necessary for an essential step late in spliceosome
#=GF CC   maturation [2]. 
#=GF SQ   1030
#=GS A0A023G8Y0_9ACAR/10-175   AC A0A023G8Y0.1
#=GS B0WBK2_CULQU/28-212       AC B0WBK2.1
#=GS B9H3J6_POPTR/3-167        AC B9H3J6.1
#=GS I0Z2X4_9CHLO/2-166        AC I0Z2X4.1
#=GS A0A024S8J4_HYPJE/26-193   AC A0A024S8J4.1
#=GS Q8CI29_MOUSE/122-171      AC Q8CI29.1
#=GS C5FIK5_ARTOC/25-209       AC C5FIK5.1
#=GS C5K6I2_PERM5/108-276      AC C5K6I2.1
#=GS PRP38_ARATH/10-175        AC Q8LB54.1
#=GS D3BAL0_POLPA/154-210      AC D3BAL0.1
#=GS W7J9T8_PLAFA/11-175       AC W7J9T8.1
#=GS J9I2Y7_9SPIT/195-356      AC J9I2Y7.1
#=GS V7PM72_9APIC/175-337      AC V7PM72.1
#=GS S4RRN6_PETMA/37-156       AC S4RRN6.1
#=GS H2MEA7_ORYLA/10-179       AC H2MEA7.1
#=GS C5P519_COCP7/20-209       AC C5P519.1
#=GS G4TPS2_PIRID/10-173       AC G4TPS2.1
#=GS L2G882_COLGN/24-191       AC L2G882.1
#=GS C4Y6R0_CLAL4/3-178        AC C4Y6R0.1
#=GS U9TVS5_RHIID/10-166       AC U9TVS5.1
#=GS U3JLV7_FICAL/10-175       AC U3JLV7.1
#=GS F2QY71_PICP7/19-184       AC F2QY71.1
#=GS G5AIQ4_PHYSP/37-201       AC G5AIQ4.1
#=GS G8YPM8_PICSO/12-188       AC G8YPM8.1
#=GS C1LKB2_SCHJA/27-211       AC C1LKB2.1
#=GS W5KVG4_ASTMX/10-175       AC W5KVG4.1
#=GS U1GVC6_ENDPU/19-185       AC U1GVC6.1
#=GS H2S675_TAKRU/10-175       AC H2S675.1
#=GS W2YXI6_PHYPR/11-61        AC W2YXI6.1
#=GS R7W8W3_AEGTA/3-200        AC R7W8W3.1
#=GS W5FCD2_WHEAT/10-175       AC W5FCD2.1
#=GS H0Z2D2_TAEGU/48-232       AC H0Z2D2.1
#=GS F2DPG5_HORVD/10-175       AC F2DPG5.1
#=GS G3N4L7_GASAC/1-34         AC G3N4L7.1
#=GS W7HV93_9PEZI/23-186       AC W7HV93.1
#=GS T1H306_MEGSC/10-175       AC T1H306.1
#=GS W5MGQ8_LEPOC/10-175       AC W5MGQ8.1
#=GS W5L4F4_ASTMX/24-208       AC W5L4F4.1
#=GS W7R241_YEASX/15-219       AC W7R241.1
#=GS A0A034WTY6_BACDO/1-136    AC A0A034WTY6.1
#=GS J5QUK8_TRIAS/111-203      AC J5QUK8.1
#=GS W2XZF6_PHYPR/9-173        AC W2XZF6.1
#=GS W7EZG4_PLAF8/11-175       AC W7EZG4.1
#=GS S7QHR4_GLOTA/10-173       AC S7QHR4.1
#=GS I3MZU9_SPETR/10-159       AC I3MZU9.1
#=GS F6UQW2_HORSE/10-175       AC F6UQW2.1
#=GS S8BH21_PENO1/20-204       AC S8BH21.1
#=GS D7FPC2_ECTSI/168-227      AC D7FPC2.1
#=GS G2WEF9_YEASK/15-219       AC G2WEF9.1
#=GS V3ZLZ8_LOTGI/10-175       AC V3ZLZ8.1
#=GS R7QB68_CHOCR/10-172       AC R7QB68.1
#=GS F7A5D9_CALJA/47-231       AC F7A5D9.1
#=GS M4A2I4_XIPMA/25-209       AC M4A2I4.1
#=GS M3K4S3_CANMX/17-194       AC M3K4S3.1
#=GS B2RTE3_MOUSE/10-175       AC B2RTE3.1
#=GS M0SG80_MUSAM/10-174       AC M0SG80.1
#=GS Q4YH72_PLABA/10-175       AC Q4YH72.1
#=GS L8FWG2_PSED2/22-189       AC L8FWG2.1
#=GS D8LWY4_BLAHO/35-198       AC D8LWY4.1
#=GS W2SQD8_NECAM/544-708      AC W2SQD8.1
#=GS E2A1P6_CAMFO/10-175       AC E2A1P6.1
#=GS Q2H4I5_CHAGB/105-167      AC Q2H4I5.1
#=GS D6X552_TRICA/24-208       AC D6X552.1
#=GS C5JEY9_AJEDS/20-214       AC C5JEY9.1
#=GS A0A022V6K5_TRIRU/20-222   AC A0A022V6K5.1
#=GS L5LMJ2_MYODS/10-175       AC L5LMJ2.1
#=GS Q4E0F0_TRYCC/9-176        AC Q4E0F0.1
#=GS W4FTM1_9STRA/9-142        AC W4FTM1.1
#=GS Q4N1F2_THEPA/1-29         AC Q4N1F2.1
#=GS T1K3B4_TETUR/10-175       AC T1K3B4.1
#=GS H2WNF1_CAEJA/10-112       AC H2WNF1.2
#=GS C0NU08_AJECG/20-213       AC C0NU08.1
#=GS W4GRF9_9STRA/57-221       AC W4GRF9.1
#=GS F2D6U3_HORVD/3-165        AC F2D6U3.1
#=GS U6Q036_HAECO/10-175       AC U6Q036.1
#=GS S7NNI0_MYOBR/1-75         AC S7NNI0.1
#=GS T5BSA3_AJEDE/20-214       AC T5BSA3.1
#=GS B8MD54_TALSN/20-183       AC B8MD54.1
#=GS C1E4N5_MICSR/10-173       AC C1E4N5.1
#=GS M7YZV4_TRIUA/3-177        AC M7YZV4.1
#=GS F7GLK3_MONDO/52-236       AC F7GLK3.1
#=GS F2EBP1_HORVD/3-150        AC F2EBP1.1
#=GS G8F4J3_MACFA/47-231       AC G8F4J3.1
#=GS B9W9B9_CANDC/17-194       AC B9W9B9.1
#=GS B8AYN3_ORYSI/3-166        AC B8AYN3.1
#=GS E9BER6_LEIDB/4-144        AC E9BER6.1
#=GS E2QU96_CANFA/10-175       AC E2QU96.2
#=GS W8CCF0_CERCA/1-69         AC W8CCF0.1
#=GS A0A022WWU5_TRIRU/20-222   AC A0A022WWU5.1
#=GS B3LIF1_YEAS1/15-219       AC B3LIF1.1
#=GS F7ISR6_CALJA/47-92        AC F7ISR6.1
#=GS C5LME5_PERM5/21-137       AC C5LME5.1
#=GS K8EY77_9CHLO/10-176       AC K8EY77.1
#=GS G3NPB2_GASAC/10-174       AC G3NPB2.1
#=GS W5QC53_SHEEP/39-223       AC W5QC53.1
#=GS J4G8D4_FIBRA/10-193       AC J4G8D4.1
#=GS F7VQJ3_SORMK/24-191       AC F7VQJ3.1
#=GS H2N6K2_PONAB/47-231       AC H2N6K2.1
#=GS L1LC98_BABEQ/10-175       AC L1LC98.1
#=GS K7VH92_MAIZE/1-55         AC K7VH92.1
#=GS F4P219_BATDJ/9-173        AC F4P219.1
#=GS G2PZZ7_THIHA/24-191       AC G2PZZ7.1
#=GS G3MKB7_9ACAR/10-175       AC G3MKB7.1
#=GS E2LWB8_MONPE/10-120       AC E2LWB8.1
#=GS A0A044QM65_ONCVO/10-175   AC A0A044QM65.1
#=GS E9EAI6_METAQ/24-191       AC E9EAI6.1
#=GS W9QWY7_9ROSA/10-174       AC W9QWY7.1
#=GS G1LCH7_AILME/47-231       AC G1LCH7.1
#=GS K3VWG0_FUSPC/25-192       AC K3VWG0.1
#=GS C4YCT7_CANAW/17-194       AC C4YCT7.1
#=GS K7IUN1_NASVI/10-175       AC K7IUN1.1
#=GS V2XVC5_MONRO/10-173       AC V2XVC5.1
#=GS C3ZRP3_BRAFL/7-191        AC C3ZRP3.1
#=GS B0EVD9_ENTDS/7-169        AC B0EVD9.1
#=GS D0NHN2_PHYIT/9-173        AC D0NHN2.1
#=GS S4PIQ1_9NEOP/10-175       AC S4PIQ1.1
#=GS L7IN74_MAGOY/23-190       AC L7IN74.1
#=GS M7WFG7_ENTHI/7-169        AC M7WFG7.1
#=GS A8PRE0_MALGO/10-174       AC A8PRE0.1
#=GS PRP38_SCHPO/14-177        AC Q9UUD2.1
#=GS W7AJL3_PLAVN/162-324      AC W7AJL3.1
#=GS G4V8E6_SCHMA/26-210       AC G4V8E6.1
#=GS Q5CUQ1_CRYPI/3-168        AC Q5CUQ1.1
#=GS I2H5J2_TETBL/16-213       AC I2H5J2.1
#=GS W2LCN0_PHYPR/37-201       AC W2LCN0.1
#=GS C7YSE8_NECH7/25-192       AC C7YSE8.1
#=GS I7APR0_ENCRO/2-164        AC I7APR0.1
#=GS S7MIS8_MYOBR/56-199       AC S7MIS8.1
#=GS W4ZDU0_STRPU/160-344      AC W4ZDU0.1
#=GS S3DD72_GLAL2/21-188       AC S3DD72.1
#=GS A9P852_POPTR/3-167        AC A9P852.1
#=GS A0A022U9J0_9EURO/20-222   AC A0A022U9J0.1
#=GS A0C3P9_PARTE/86-247       AC A0C3P9.1
#=GS A0A024TF87_9STRA/1-98     AC A0A024TF87.1
#=GS W7FGB7_PLAFA/173-328      AC W7FGB7.1
#=GS G0S1D3_CHATD/24-191       AC G0S1D3.1
#=GS H9JEJ8_BOMMO/23-207       AC H9JEJ8.1
#=GS E3QPI7_COLGM/24-191       AC E3QPI7.1
#=GS Q4GZ20_TRYB2/36-208       AC Q4GZ20.1
#=GS K7GHE6_PELSI/10-175       AC K7GHE6.1
#=GS W6UMV2_ECHGR/10-175       AC W6UMV2.1
#=GS Q0DKA8_ORYSJ/3-101        AC Q0DKA8.2
#=GS J9EVG5_WUCBA/10-175       AC J9EVG5.1
#=GS A0A044STF6_ONCVO/47-231   AC A0A044STF6.1
#=GS C6TC14_SOYBN/4-165        AC C6TC14.1
#=GS L7ML70_9ACAR/10-175       AC L7ML70.1
#=GS M0W6M8_HORVD/1-69         AC M0W6M8.1
#=GS PR38A_PONAB/10-175        AC Q5RDD2.1
#=GS G0NBD0_CAEBE/55-239       AC G0NBD0.1
#=GS Q6C616_YARLI/15-178       AC Q6C616.1
#=GS I1CST4_RHIO9/2-153        AC I1CST4.1
#=GS M4C7M0_BRARP/10-175       AC M4C7M0.1
#=GS A0A024J8U9_GEOCN/21-190   AC A0A024J8U9.1
#=GS M9N2Z2_ASHG1/14-224       AC M9N2Z2.1
#=GS E1GES1_LOALO/47-231       AC E1GES1.2
#=GS R1EST0_EMIHU/1-175        AC R1EST0.1
#=GS G5C765_HETGA/86-176       AC G5C765.1
#=GS F6SY19_ORNAN/10-72        AC F6SY19.1
#=GS Q86DZ4_SCHJA/31-121       AC Q86DZ4.1
#=GS H2S676_TAKRU/10-175       AC H2S676.1
#=GS A0A059B3E7_EUCGR/58-223   AC A0A059B3E7.1
#=GS C7GXQ4_YEAS2/15-219       AC C7GXQ4.1
#=GS G1NFA1_MELGA/10-175       AC G1NFA1.2
#=GS F4WXJ8_ACREC/37-220       AC F4WXJ8.1
#=GS M2T688_COCH5/23-228       AC M2T688.1
#=GS W9KGY1_FUSOX/25-192       AC W9KGY1.1
#=GS W0W035_ZYGBA/14-210       AC W0W035.1
#=GS G3R6P3_GORGO/47-231       AC G3R6P3.1
#=GS A9UMD4_XENTR/10-175       AC A9UMD4.1
#=GS H9EQH0_MACMU/10-175       AC H9EQH0.1
#=GS G5C765_HETGA/10-77        AC G5C765.1
#=GS X8JDK6_9HOMO/10-173       AC X8JDK6.1
#=GS T1I5E1_RHOPR/4-188        AC T1I5E1.1
#=GS W2WM02_PHYPR/11-61        AC W2WM02.1
#=GS A0A022W1X8_TRIRU/20-222   AC A0A022W1X8.1
#=GS G3UEL4_LOXAF/10-175       AC G3UEL4.1
#=GS W9RQ05_9ROSA/3-101        AC W9RQ05.1
#=GS F4K753_ARATH/1-113        AC F4K753.1
#=GS A5K4Y5_PLAVS/10-175       AC A5K4Y5.1
#=GS W2ZJH7_PHYPR/37-201       AC W2ZJH7.1
#=GS K1W8G5_TRIAC/58-194       AC K1W8G5.1
#=GS B0EPX8_ENTDS/2-162        AC B0EPX8.1
#=GS V5EEC2_PSEBG/10-174       AC V5EEC2.1
#=GS F8MZ43_NEUT8/24-191       AC F8MZ43.1
#=GS N1JK20_BLUG1/21-188       AC N1JK20.1
#=GS E7KNP5_YEASL/15-219       AC E7KNP5.1
#=GS W7A7D1_9APIC/10-175       AC W7A7D1.1
#=GS W4IBB9_PLAFA/173-335      AC W4IBB9.1
#=GS G0N8A9_CAEBE/10-175       AC G0N8A9.1
#=GS F7CZ30_MACMU/10-176       AC F7CZ30.1
#=GS A6QTF5_AJECN/40-234       AC A6QTF5.1
#=GS A0A024X1V7_PLAFC/173-335  AC A0A024X1V7.1
#=GS C0HBS4_SALSA/30-182       AC C0HBS4.1
#=GS X0GIC7_FUSOX/25-192       AC X0GIC7.1
#=GS B0D223_LACBS/10-173       AC B0D223.1
#=GS S0DNK7_GIBF5/25-192       AC S0DNK7.1
#=GS W1QC60_OGAPD/14-179       AC W1QC60.1
#=GS A0A022QWG5_MIMGU/4-166    AC A0A022QWG5.1
#=GS W2GFA6_PHYPR/9-173        AC W2GFA6.1
#=GS M9LTE5_PSEA3/10-174       AC M9LTE5.1
#=GS Q69YH0_HUMAN/47-92        AC Q69YH0.1
#=GS U6JTB6_EIMAC/135-297      AC U6JTB6.1
#=GS F2RND2_TRIT1/20-222       AC F2RND2.1
#=GS C3ZFR3_BRAFL/10-175       AC C3ZFR3.1
#=GS K3YT29_SETIT/10-175       AC K3YT29.1
#=GS D8QUJ9_SELML/10-175       AC D8QUJ9.1
#=GS M4BZA9_HYAAE/9-147        AC M4BZA9.1
#=GS H3ATS7_LATCH/10-175       AC H3ATS7.1
#=GS W6KZR3_9TRYP/4-141        AC W6KZR3.1
#=GS C6HES4_AJECH/20-214       AC C6HES4.1
#=GS W6Z5M9_COCMI/23-230       AC W6Z5M9.1
#=GS D3PHD0_LEPSM/10-175       AC D3PHD0.1
#=GS Q4Y906_PLACH/157-319      AC Q4Y906.1
#=GS M5XCM3_PRUPE/1-41         AC M5XCM3.1
#=GS R4GD49_ANOCA/32-216       AC R4GD49.1
#=GS W5JA90_ANODA/10-175       AC W5JA90.1
#=GS B4GH52_DROPE/10-175       AC B4GH52.1
#=GS A4RVT9_OSTLU/18-191       AC A4RVT9.1
#=GS D3ZGL5_RAT/10-175         AC D3ZGL5.1
#=GS E3LKU1_CAERE/55-239       AC E3LKU1.1
#=GS C1LKB0_SCHJA/27-211       AC C1LKB0.1
#=GS G3PQV1_GASAC/24-208       AC G3PQV1.1
#=GS A8PAN6_BRUMA/37-84        AC A8PAN6.2
#=GS H2TYE1_TAKRU/22-206       AC H2TYE1.1
#=GS G0UIZ7_TRYCI/9-185        AC G0UIZ7.1
#=GS K0SGM5_THAOC/41-200       AC K0SGM5.1
#=GS F6UKW2_XENTR/35-219       AC F6UKW2.1
#=GS T2M9T2_HYDVU/17-182       AC T2M9T2.1
#=GS U3JJ31_FICAL/52-200       AC U3JJ31.1
#=GS Q4N084_THEPA/10-175       AC Q4N084.1
#=GS L8H6U6_ACACA/87-250       AC L8H6U6.1
#=GS B8LLN1_PICSI/10-175       AC B8LLN1.1
#=GS A4I1H4_LEIIN/272-441      AC A4I1H4.1
#=GS J3P436_GAGT3/24-191       AC J3P436.1
#=GS W5FVI4_WHEAT/10-175       AC W5FVI4.1
#=GS A8PII6_BRUMA/10-175       AC A8PII6.2
#=GS H3ERC6_PRIPA/1-43         AC H3ERC6.1
#=GS H0V3G0_CAVPO/48-232       AC H0V3G0.1
#=GS S9WYR5_9TRYP/4-144        AC S9WYR5.1
#=GS E0VHT3_PEDHC/1-176        AC E0VHT3.1
#=GS T0KFN0_COLGC/1-66         AC T0KFN0.1
#=GS F6I4Q5_VITVI/10-175       AC F6I4Q5.1
#=GS F2TX53_SALR5/41-247       AC F2TX53.1
#=GS B0WP85_CULQU/10-175       AC B0WP85.1
#=GS C0PCD4_MAIZE/3-167        AC C0PCD4.1
#=GS W9C3G0_9HELO/21-188       AC W9C3G0.1
#=GS Q4U8Q2_THEAN/128-301      AC Q4U8Q2.1
#=GS R7Z359_CONA1/20-205       AC R7Z359.1
#=GS W7PU90_YEASX/15-219       AC W7PU90.1
#=GS E9EM03_METAR/88-255       AC E9EM03.1
#=GS M8A466_TRIUA/3-167        AC M8A466.1
#=GS W9S3F4_9ROSA/21-93        AC W9S3F4.1
#=GS V4TZ97_9ROSI/4-144        AC V4TZ97.1
#=GS A0A022RAJ0_MIMGU/10-174   AC A0A022RAJ0.1
#=GS G0RPR5_HYPJQ/26-193       AC G0RPR5.1
#=GS T0RRR2_9STRA/9-173        AC T0RRR2.1
#=GS J5QUK8_TRIAS/12-58        AC J5QUK8.1
#=GS M2Z5Y8_MYCFI/16-183       AC M2Z5Y8.1
#=GS B3L5D4_PLAKH/10-175       AC B3L5D4.1
#=GS F0YB92_AURAN/58-222       AC F0YB92.1
#=GS I4Y8C3_WALSC/10-173       AC I4Y8C3.1
#=GS M3D6M0_SPHMS/19-186       AC M3D6M0.1
#=GS X6N3G1_RETFI/102-235      AC X6N3G1.1
#=GS M8BB00_AEGTA/3-167        AC M8BB00.1
#=GS U6J7B2_ECHGR/27-211       AC U6J7B2.1
#=GS M7BW90_CHEMY/1-176        AC M7BW90.1
#=GS L8GYB7_ACACA/10-175       AC L8GYB7.1
#=GS F4X868_ACREC/10-175       AC F4X868.1
#=GS W2INL0_PHYPR/21-185       AC W2INL0.1
#=GS A9RTY4_PHYPA/10-175       AC A9RTY4.1
#=GS M5W7Z5_PRUPE/18-176       AC M5W7Z5.1
#=GS C8VB07_EMENI/20-212       AC C8VB07.1
#=GS E7Q418_YEASB/15-219       AC E7Q418.1
#=GS N1PRZ9_MYCP1/19-186       AC N1PRZ9.1
#=GS B6HM45_PENCW/20-204       AC B6HM45.1
#=GS A0A023F3W8_TRIIF/10-175   AC A0A023F3W8.1
#=GS D8LWJ8_BLAHO/10-174       AC D8LWJ8.1
#=GS C5MCZ6_CANTT/17-194       AC C5MCZ6.1
#=GS W2NI78_PHYPR/37-201       AC W2NI78.1
#=GS F4K754_ARATH/4-106        AC F4K754.1
#=GS W7TQL1_9STRA/10-174       AC W7TQL1.1
#=GS A0A024G6E6_9STRA/44-209   AC A0A024G6E6.1
#=GS I6ND91_ERECY/14-229       AC I6ND91.1
#=GS W4XFI6_STRPU/10-175       AC W4XFI6.1
#=GS R1CRP3_EMIHU/49-231       AC R1CRP3.1
#=GS E0S9J6_ENCIT/2-163        AC E0S9J6.1
#=GS J9J8A1_9SPIT/306-471      AC J9J8A1.1
#=GS R0F627_9BRAS/1-113        AC R0F627.1
#=GS V9KXU6_CALMI/10-175       AC V9KXU6.1
#=GS A8NG64_COPC7/10-173       AC A8NG64.2
#=GS G6CYI7_DANPL/22-206       AC G6CYI7.1
#=GS A4F2M0_MARPO/1-85         AC A4F2M0.1
#=GS Q01B71_OSTTA/20-189       AC Q01B71.1
#=GS A8NFA1_BRUMA/47-231       AC A8NFA1.2
#=GS W4FS00_9STRA/9-173        AC W4FS00.1
#=GS S2JJG8_MUCC1/10-170       AC S2JJG8.1
#=GS G9NT24_HYPAI/26-193       AC G9NT24.1
#=GS M2S990_COCSN/23-231       AC M2S990.1
#=GS M5XBU6_PRUPE/4-166        AC M5XBU6.1
#=GS G2WYK7_VERDV/26-193       AC G2WYK7.1
#=GS J9HJD8_AEDAE/67-225       AC J9HJD8.1
#=GS F8Q691_SERL3/10-173       AC F8Q691.1
#=GS E9C863_CAPO3/29-194       AC E9C863.2
#=GS C5Z170_SORBI/3-167        AC C5Z170.1
#=GS C1BSW5_LEPSM/10-175       AC C1BSW5.1
#=GS G3GW00_CRIGR/10-175       AC G3GW00.1
#=GS W7FG85_PLAFA/11-175       AC W7FG85.1
#=GS X0JRB7_FUSOX/25-192       AC X0JRB7.1
#=GS I1IIQ1_BRADI/10-175       AC I1IIQ1.1
#=GS F0VM92_NEOCL/10-175       AC F0VM92.1
#=GS E4UUK9_ARTGP/20-208       AC E4UUK9.1
#=GS F0XXJ0_AURAN/10-174       AC F0XXJ0.1
#=GS F0XUL2_GROCL/25-192       AC F0XUL2.1
#=GS K7H0X5_CAEJA/52-236       AC K7H0X5.1
#=GS S7UGR0_TOXGO/10-175       AC S7UGR0.1
#=GS W9WA46_9EURO/19-185       AC W9WA46.1
#=GS X0J3G6_FUSOX/25-192       AC X0J3G6.1
#=GS C5DR46_ZYGRC/14-208       AC C5DR46.1
#=GS PR38A_MOUSE/10-175        AC Q4FK66.1
#=GS F9F8Y6_FUSOF/25-192       AC F9F8Y6.1
#=GS M1VHD9_CYAME/26-187       AC M1VHD9.1
#=GS M7TF93_EUTLA/22-189       AC M7TF93.1
#=GS B7P4Y8_IXOSC/14-198       AC B7P4Y8.1
#=GS C5L5B5_PERM5/95-139       AC C5L5B5.1
#=GS F0ZBH7_DICPU/5-166        AC F0ZBH7.1
#=GS B6TYH0_MAIZE/10-175       AC B6TYH0.1
#=GS W7F1W5_PLAF8/173-335      AC W7F1W5.1
#=GS G5AX24_HETGA/10-161       AC G5AX24.1
#=GS N1R8N2_FUSC4/25-192       AC N1R8N2.1
#=GS U5GDA8_POPTR/8-141        AC U5GDA8.1
#=GS E1GF58_LOALO/10-175       AC E1GF58.2
#=GS I7J7H2_BABMI/10-175       AC I7J7H2.1
#=GS H0GGJ6_SACCK/15-219       AC H0GGJ6.1
#=GS E9GW90_DAPPU/10-175       AC E9GW90.1
#=GS J9MZ54_FUSO4/25-192       AC J9MZ54.1
#=GS W9YRJ2_9EURO/19-185       AC W9YRJ2.1
#=GS M2XT21_GALSU/10-174       AC M2XT21.1
#=GS A7TN57_VANPO/14-211       AC A7TN57.1
#=GS D2H2D9_AILME/10-175       AC D2H2D9.1
#=GS A7SXQ7_NEMVE/10-175       AC A7SXQ7.1
#=GS M4G3L5_MAGP6/24-191       AC M4G3L5.1
#=GS B7S4A9_PHATC/10-166       AC B7S4A9.1
#=GS G9KIQ1_MUSPF/15-199       AC G9KIQ1.1
#=GS E3N791_CAERE/10-175       AC E3N791.1
#=GS J3S0W7_CROAD/10-175       AC J3S0W7.1
#=GS E7KCV7_YEASA/15-219       AC E7KCV7.1
#=GS D8R3L1_SELML/5-169        AC D8R3L1.1
#=GS W2M316_PHYPR/9-173        AC W2M316.1
#=GS W5I894_WHEAT/3-165        AC W5I894.1
#=GS J3MB67_ORYBR/4-166        AC J3MB67.1
#=GS Q07G58_XENTR/35-219       AC Q07G58.1
#=GS S9WUU7_9TRYP/1-95         AC S9WUU7.1
#=GS U6HI82_ECHMU/1-99         AC U6HI82.1
#=GS E7LUN2_YEASV/15-219       AC E7LUN2.1
#=GS E4YWX6_OIKDI/10-175       AC E4YWX6.1
#=GS A9RSQ4_PHYPA/6-170        AC A9RSQ4.1
#=GS W4IUL8_PLAFP/173-302      AC W4IUL8.1
#=GS F1S580_PIG/50-234         AC F1S580.1
#=GS V7BIY7_PHAVU/10-175       AC V7BIY7.1
#=GS W2J6G6_PHYPR/37-201       AC W2J6G6.1
#=GS F6ZP02_CIOIN/10-175       AC F6ZP02.2
#=GS E1F9P4_GIAIA/1-141        AC E1F9P4.1
#=GS K3ZVF4_SETIT/1-99         AC K3ZVF4.1
#=GS W9PRI6_FUSOX/25-192       AC W9PRI6.1
#=GS R9XGB2_ASHAC/14-224       AC R9XGB2.1
#=GS G6DFN0_DANPL/10-175       AC G6DFN0.1
#=GS B3LAT7_PLAKH/162-322      AC B3LAT7.1
#=GS M0T4J1_MUSAM/3-167        AC M0T4J1.1
#=GS A1DES8_NEOFI/20-209       AC A1DES8.1
#=GS A0A034WSN4_BACDO/1-69     AC A0A034WSN4.1
#=GS F2SN07_TRIRC/20-222       AC F2SN07.1
#=GS U3IDW8_ANAPL/1-111        AC U3IDW8.1
#=GS C1GJF7_PARBD/20-214       AC C1GJF7.1
#=GS V6T9Z4_GIAIN/1-159        AC V6T9Z4.1
#=GS A0A024V1Q9_PLAFA/173-335  AC A0A024V1Q9.1
#=GS H9JWH7_BOMMO/10-175       AC H9JWH7.1
#=GS M0Z3R6_HORVD/3-165        AC M0Z3R6.1
#=GS J3JTY1_DENPD/10-175       AC J3JTY1.1
#=GS Q5B458_EMENI/20-200       AC Q5B458.1
#=GS Q4YX53_PLABA/179-341      AC Q4YX53.1
#=GS E6ZP67_SPORE/10-174       AC E6ZP67.1
#=GS L7M882_9ACAR/14-198       AC L7M882.1
#=GS D6WU66_TRICA/10-175       AC D6WU66.1
#=GS Q7RLR8_PLAYO/1-56         AC Q7RLR8.1
#=GS M3SAC5_ENTHI/2-162        AC M3SAC5.1
#=GS X2JF51_DROME/24-141       AC X2JF51.1
#=GS Q01G50_OSTTA/1-144        AC Q01G50.1
#=GS Q86IV3_DICDI/48-212       AC Q86IV3.1
#=GS J9JZ53_ACYPI/30-214       AC J9JZ53.2
#=GS U4L199_PYROM/27-190       AC U4L199.1
#=GS W2R409_PHYPN/9-173        AC W2R409.1
#=GS V9I991_APICE/37-156       AC V9I991.1
#=GS B9G228_ORYSJ/10-169       AC B9G228.1
#=GS W4IFC1_PLAFA/11-175       AC W4IFC1.1
#=GS K1Q5L4_CRAGI/7-191        AC K1Q5L4.1
#=GS M1C6B4_SOLTU/5-167        AC M1C6B4.1
#=GS X6NM44_RETFI/10-176       AC X6NM44.1
#=GS A0A015NFA3_9GLOM/10-174   AC A0A015NFA3.1
#=GS B8C555_THAPS/10-167       AC B8C555.1
#=GS F6V7L2_ORNAN/39-223       AC F6V7L2.1
#=GS F2UNQ1_SALR5/10-175       AC F2UNQ1.1
#=GS S6C9M3_BABBO/10-175       AC S6C9M3.1
#=GS A0A023BDW0_GRENI/56-217   AC A0A023BDW0.1
#=GS C4WV68_ACYPI/10-175       AC C4WV68.1
#=GS W4ZVL3_WHEAT/3-167        AC W4ZVL3.1
#=GS G4N721_MAGO7/23-190       AC G4N721.1
#=GS G5BQU6_HETGA/49-233       AC G5BQU6.1
#=GS H0XNF3_OTOGA/49-233       AC H0XNF3.1
#=GS G3JII3_CORMM/24-191       AC G3JII3.1
#=GS B4L223_DROMO/28-212       AC B4L223.1
#=GS I1F011_AMPQE/9-103        AC I1F011.1
#=GS Q29IQ7_DROPS/30-214       AC Q29IQ7.2
#=GS B5VJ21_YEAS6/15-219       AC B5VJ21.1
#=GS G7E6U1_MIXOS/10-174       AC G7E6U1.1
#=GS B7FY05_PHATC/41-205       AC B7FY05.1
#=GS C6LNE4_GIAIB/1-137        AC C6LNE4.1
#=GS F7ALV5_CALJA/25-209       AC F7ALV5.1
#=GS M7YUL5_TRIUA/10-175       AC M7YUL5.1
#=GS A0A016WJT5_9BILA/10-175   AC A0A016WJT5.1
#=GS A8IDN7_CHLRE/1-167        AC A8IDN7.1
#=GS A0A016STJ3_9BILA/62-272   AC A0A016STJ3.1
#=GS A0A023AF08_TRIRU/20-222   AC A0A023AF08.1
#=GS M2Y140_GALSU/5-87         AC M2Y140.1
#=GS A2G7A6_TRIVA/40-205       AC A2G7A6.1
#=GS G3N166_BOVIN/47-231       AC G3N166.1
#=GS W5DUT1_WHEAT/1-85         AC W5DUT1.1
#=GS A7APG3_BABBO/171-333      AC A7APG3.1
#=GS T1HNK6_RHOPR/10-175       AC T1HNK6.1
#=GS Q7JVL3_DROME/10-175       AC Q7JVL3.1
#=GS E9DBR1_COCPS/20-209       AC E9DBR1.1
#=GS Q3LVY1_BIGNA/2-154        AC Q3LVY1.1
#=GS K7ULE7_MAIZE/2-80         AC K7ULE7.1
#=GS W7AWH2_PLAVN/10-175       AC W7AWH2.1
#=GS T1E7P8_ANOAQ/10-175       AC T1E7P8.1
#=GS L5K4Z1_PTEAL/49-233       AC L5K4Z1.1
#=GS T1EG64_HELRO/7-191        AC T1EG64.1
#=GS W2X6R7_PHYPR/37-201       AC W2X6R7.1
#=GS E1C6A8_CHICK/10-175       AC E1C6A8.1
#=GS C5K487_PERM5/81-218       AC C5K487.1
#=GS K7V8Q5_MAIZE/76-246       AC K7V8Q5.1
#=GS M1CAV6_SOLTU/10-175       AC M1CAV6.1
#=GS W8C0X7_CERCA/22-206       AC W8C0X7.1
#=GS D3BAL0_POLPA/67-159       AC D3BAL0.1
#=GS W3XIF8_9PEZI/20-186       AC W3XIF8.1
#=GS E2AHT2_CAMFO/35-218       AC E2AHT2.1
#=GS X0MXW1_FUSOX/25-192       AC X0MXW1.1
#=GS I3MQ15_SPETR/10-175       AC I3MQ15.1
#=GS E9AIG4_LEIBR/4-150        AC E9AIG4.1
#=GS H2ZFB4_CIOSA/10-175       AC H2ZFB4.1
#=GS J3K9F1_COCIM/20-209       AC J3K9F1.1
#=GS M4BIY1_HYAAE/37-167       AC M4BIY1.1
#=GS U9UJB9_RHIID/7-167        AC U9UJB9.1
#=GS W5MMD1_LEPOC/32-216       AC W5MMD1.1
#=GS G0TR81_TRYVY/9-151        AC G0TR81.1
#=GS K2N6A4_TRYCR/38-206       AC K2N6A4.1
#=GS L1ICQ1_GUITH/10-169       AC L1ICQ1.1
#=GS U7PR73_SPOS1/25-192       AC U7PR73.1
#=GS I4DPU4_PAPXU/1-69         AC I4DPU4.1
#=GS C4LZA0_ENTHI/2-162        AC C4LZA0.1
#=GS A2Q158_MEDTR/10-175       AC A2Q158.1
#=GS Q28XW5_DROPS/10-175       AC Q28XW5.2
#=GS F7G6K1_MONDO/12-177       AC F7G6K1.1
#=GS A1CAF4_ASPCL/20-209       AC A1CAF4.1
#=GS G9KIQ0_MUSPF/9-174        AC G9KIQ0.1
#=GS I1EAR9_AMPQE/1-144        AC I1EAR9.1
#=GS A8X8F6_CAEBR/10-175       AC A8X8F6.1
#=GS C0S7Y8_PARBP/20-214       AC C0S7Y8.1
#=GS F6QPW1_MACMU/47-231       AC F6QPW1.1
#=GS J3M4G7_ORYBR/3-166        AC J3M4G7.1
#=GS A0A022ZJB0_TRIRU/20-222   AC A0A022ZJB0.1
#=GS U6PD84_HAECO/69-253       AC U6PD84.1
#=GS M1W229_CLAP2/24-191       AC M1W229.1
#=GS L1J4V0_GUITH/160-321      AC L1J4V0.1
#=GS W2QD97_PHYPN/37-201       AC W2QD97.1
#=GS G0UJS9_TRYCI/201-333      AC G0UJS9.1
#=GS A0A022R4J6_MIMGU/5-166    AC A0A022R4J6.1
#=GS C5X6Q2_SORBI/10-175       AC C5X6Q2.1
#=GS R7QBZ5_CHOCR/53-171       AC R7QBZ5.1
#=GS N4X126_COCH4/23-228       AC N4X126.1
#=GS R9P9R0_PSEHS/10-175       AC R9P9R0.1
#=GS E5RYR9_TRISP/10-175       AC E5RYR9.1
#=GS E1BVP9_CHICK/50-234       AC E1BVP9.2
#=GS T1KXQ5_TETUR/61-245       AC T1KXQ5.1
#=GS A0A024X5A6_PLAFC/11-175   AC A0A024X5A6.1
#=GS K1WAK9_MARBU/21-188       AC K1WAK9.1
#=GS B6QEC1_PENMQ/20-208       AC B6QEC1.1
#=GS T1JGX1_STRMM/10-175       AC T1JGX1.1
#=GS W7X6X1_TETTS/10-175       AC W7X6X1.1
#=GS U6IHZ2_HYMMI/10-175       AC U6IHZ2.1
#=GS K2G720_ENTNP/7-169        AC K2G720.1
#=GS G1SEF5_RABIT/10-175       AC G1SEF5.1
#=GS Q54J00_DICDI/3-165        AC Q54J00.2
#=GS N9TDB6_ENTHI/7-169        AC N9TDB6.1
#=GS K3ZF04_SETIT/3-166        AC K3ZF04.1
#=GS I3JV42_ORENI/25-209       AC I3JV42.1
#=GS W7AKF8_9APIC/252-414      AC W7AKF8.1
#=GS G1THN5_RABIT/1-139        AC G1THN5.2
#=GS B2ATX0_PODAN/63-230       AC B2ATX0.1
#=GS V8PH37_OPHHA/10-175       AC V8PH37.1
#=GS H2MLH7_ORYLA/25-209       AC H2MLH7.1
#=GS W5MME7_LEPOC/32-216       AC W5MME7.1
#=GS B4QGS9_DROSI/10-175       AC B4QGS9.1
#=GS V7BAP5_PHAVU/3-165        AC V7BAP5.1
#=GS Q7PMU1_ANOGA/45-223       AC Q7PMU1.4
#=GS U5EXJ0_9DIPT/10-175       AC U5EXJ0.1
#=GS K6UDH3_9APIC/10-45        AC K6UDH3.1
#=GS B8P4M7_POSPM/8-160        AC B8P4M7.1
#=GS G8BDC4_CANPC/23-200       AC G8BDC4.1
#=GS B7F7E9_ORYSJ/3-166        AC B7F7E9.1
#=GS V9IAK5_APICE/37-115       AC V9IAK5.1
#=GS L7JXS8_TRAHO/4-152        AC L7JXS8.1
#=GS F9X714_MYCGM/19-186       AC F9X714.1
#=GS N6U570_DENPD/23-207       AC N6U570.1
#=GS A0A024VKM8_PLAFA/173-302  AC A0A024VKM8.1
#=GS B4M6P8_DROVI/28-212       AC B4M6P8.1
#=GS V9DTB5_PHYPR/11-61        AC V9DTB5.1
#=GS B2GUF6_XENTR/35-178       AC B2GUF6.1
#=GS Q7RLR7_PLAYO/177-256      AC Q7RLR7.1
#=GS C9ZJZ9_TRYB9/195-343      AC C9ZJZ9.1
#=GS B2WHZ6_PYRTR/23-234       AC B2WHZ6.1
#=GS B3N7K4_DROER/10-175       AC B3N7K4.1
#=GS C5LD14_PERM5/10-181       AC C5LD14.1
#=GS B4HSN2_DROSE/10-175       AC B4HSN2.1
#=GS A0A023B5L5_GRENI/10-175   AC A0A023B5L5.1
#=GS B0WBK3_CULQU/28-153       AC B0WBK3.1
#=GS R1F3N7_EMIHU/15-180       AC R1F3N7.1
#=GS Q2QKC4_WHEAT/10-175       AC Q2QKC4.1
#=GS Q7SHZ0_NEUCR/24-191       AC Q7SHZ0.2
#=GS E7NHW7_YEASO/15-219       AC E7NHW7.1
#=GS G2R425_THITE/24-192       AC G2R425.1
#=GS B0JYW3_XENTR/10-175       AC B0JYW3.1
#=GS E3KGQ2_PUCGT/10-176       AC E3KGQ2.1
#=GS W6Q0P6_PENRO/20-204       AC W6Q0P6.1
#=GS A0A058ZG82_9EUKA/14-178   AC A0A058ZG82.1
#=GS Q95Y35_CAEEL/55-239       AC Q95Y35.1
#=GS J9B997_WUCBA/47-231       AC J9B997.1
#=GS W0T4H3_KLUMA/14-213       AC W0T4H3.1
#=GS M7YQW6_TRIUA/1-101        AC M7YQW6.1
#=GS K7JAP2_NASVI/32-188       AC K7JAP2.1
#=GS PR38A_DANRE/10-175        AC Q6DHU4.1
#=GS A0A034WTL0_BACDO/22-206   AC A0A034WTL0.1
#=GS A5K1F2_PLAVS/159-321      AC A5K1F2.1
#=GS G7XH18_ASPKW/20-207       AC G7XH18.1
#=GS K7H0X6_CAEJA/52-236       AC K7H0X6.1
#=GS F2PU74_TRIEC/20-222       AC F2PU74.1
#=GS S6EYV6_ZYGB2/14-210       AC S6EYV6.1
#=GS Q5F399_CHICK/50-103       AC Q5F399.1
#=GS R0L3G4_ANAPL/1-110        AC R0L3G4.1
#=GS M2MPP1_BAUCO/19-184       AC M2MPP1.1
#=GS M2RVJ4_ENTHI/2-162        AC M2RVJ4.1
#=GS Q756P8_ASHGO/14-224       AC Q756P8.1
#=GS C5Z3V3_SORBI/3-166        AC C5Z3V3.1
#=GS R8BK18_TOGMI/23-190       AC R8BK18.1
#=GS M7NMD2_PNEMU/15-179       AC M7NMD2.1
#=GS W6MI80_9ASCO/16-181       AC W6MI80.1
#=GS G2XP06_BOTF4/21-188       AC G2XP06.1
#=GS X0BDR0_FUSOX/25-192       AC X0BDR0.1
#=GS Q4Z0V3_PLABA/10-175       AC Q4Z0V3.1
#=GS B6K0B4_SCHJY/16-179       AC B6K0B4.1
#=GS C5K8A2_PERM5/121-217      AC C5K8A2.1
#=GS Q8MR43_DROME/24-208       AC Q8MR43.1
#=GS G8ZTX6_TORDC/14-208       AC G8ZTX6.1
#=GS A9V7J1_MONBE/525-692      AC A9V7J1.1
#=GS A0A058Z0D6_9EUKA/4-170    AC A0A058Z0D6.1
#=GS R7VC16_CAPTE/10-175       AC R7VC16.1
#=GS H3H0K3_PHYRM/37-201       AC H3H0K3.1
#=GS W2KVC3_PHYPR/21-185       AC W2KVC3.1
#=GS K3WW49_PYTUL/39-203       AC K3WW49.1
#=GS R7Q9W9_CHOCR/53-171       AC R7Q9W9.1
#=GS I2FP71_USTH4/10-174       AC I2FP71.1
#=GS N1P3X3_YEASC/15-219       AC N1P3X3.1
#=GS U6CYF9_NEOVI/1-71         AC U6CYF9.1
#=GS B2RDP2_HUMAN/10-58        AC B2RDP2.1
#=GS K8FDN6_9CHLO/1-120        AC K8FDN6.1
#=GS G1KHK2_ANOCA/10-175       AC G1KHK2.2
#=GS Q6FNB5_CANGA/14-216       AC Q6FNB5.1
#=GS T5ACD4_OPHSC/26-193       AC T5ACD4.1
#=GS K3XXF9_SETIT/3-166        AC K3XXF9.1
#=GS Q4P5L4_USTMA/10-174       AC Q4P5L4.1
#=GS F4PA36_BATDJ/1-156        AC F4PA36.1
#=GS D2VCT3_NAEGR/48-213       AC D2VCT3.1
#=GS H0ZFB3_TAEGU/10-175       AC H0ZFB3.1
#=GS H2KVI1_CLOSI/10-175       AC H2KVI1.1
#=GS M2RIP2_CERS8/10-173       AC M2RIP2.1
#=GS I1MBS7_SOYBN/4-166        AC I1MBS7.1
#=GS S9VCB1_9TRYP/46-243       AC S9VCB1.1
#=GS I1QLT6_ORYGL/10-175       AC I1QLT6.1
#=GS A0A023GJY8_9ACAR/14-198   AC A0A023GJY8.1
#=GS B6AGF3_CRYMR/3-168        AC B6AGF3.1
#=GS Q4Q9W3_LEIMA/270-441      AC Q4Q9W3.1
#=GS W9QIC3_9ROSA/10-174       AC W9QIC3.1
#=GS V5I0G7_IXORI/14-198       AC V5I0G7.1
#=GS E9IFJ0_SOLIN/10-175       AC E9IFJ0.1
#=GS K9FTW7_PEND1/20-204       AC K9FTW7.1
#=GS Q5CPB2_CRYHO/4-168        AC Q5CPB2.1
#=GS I7IHC0_BABMI/77-240       AC I7IHC0.1
#=GS I1PSX7_ORYGL/3-166        AC I1PSX7.1
#=GS U6MKH2_9EIME/136-301      AC U6MKH2.1
#=GS B3S4R2_TRIAD/10-175       AC B3S4R2.1
#=GS G3Y0M7_ASPNA/20-209       AC G3Y0M7.1
#=GS A0A059JZU0_TRIRU/20-222   AC A0A059JZU0.1
#=GS V9KJZ8_CALMI/61-245       AC V9KJZ8.1
#=GS M7XZP0_RHOT1/10-174       AC M7XZP0.1
#=GS Q4QCT1_LEIMA/4-144        AC Q4QCT1.1
#=GS S6BKY2_BABBO/10-107       AC S6BKY2.1
#=GS F6SUR6_MONDO/10-175       AC F6SUR6.2
#=GS E1ZPB8_CHLVA/2-179        AC E1ZPB8.1
#=GS J3MVI2_ORYBR/10-175       AC J3MVI2.1
#=GS W2S0L2_9EURO/19-185       AC W2S0L2.1
#=GS N4U2P3_FUSC1/25-192       AC N4U2P3.1
#=GS F0XVG8_AURAN/1-161        AC F0XVG8.1
#=GS A4HE72_LEIBR/304-441      AC A4HE72.1
#=GS H2KT99_CLOSI/29-213       AC H2KT99.1
#=GS PR38A_HUMAN/10-175        AC Q8NAV1.1
#=GS Q5DGL2_SCHJA/27-211       AC Q5DGL2.1
#=GS A4RRH8_OSTLU/10-175       AC A4RRH8.1
#=GS H2R123_PANTR/10-175       AC H2R123.1
#=GS I6UEY9_ENCHA/2-166        AC I6UEY9.1
#=GS G3VUT2_SARHA/10-175       AC G3VUT2.1
#=GS S3BY96_OPHP1/25-192       AC S3BY96.1
#=GS A3GFM9_PICST/15-192       AC A3GFM9.2
#=GS W9IMM9_FUSOX/25-192       AC W9IMM9.1
#=GS PR38B_RAT/47-231          AC Q6AXY7.1
#=GS G3TY10_LOXAF/47-231       AC G3TY10.1
#=GS L9KRQ0_TUPCH/10-175       AC L9KRQ0.1
#=GS G3MTI6_9ACAR/14-198       AC G3MTI6.1
#=GS Q57XW0_TRYB2/195-343      AC Q57XW0.1
#=GS Q2U457_ASPOR/20-209       AC Q2U457.1
#=GS D7MIA4_ARALL/4-168        AC D7MIA4.1
#=GS U3IFV6_ANAPL/4-188        AC U3IFV6.1
#=GS G5B2Y6_HETGA/1-99         AC G5B2Y6.1
#=GS U5FR78_POPTR/10-175       AC U5FR78.1
#=GS G3I797_CRIGR/6-93         AC G3I797.1
#=GS K9FM30_PEND2/20-204       AC K9FM30.1
#=GS H0WS15_OTOGA/10-175       AC H0WS15.1
#=GS Q8II38_PLAF7/11-175       AC Q8II38.1
#=GS V9FB38_PHYPR/37-201       AC V9FB38.1
#=GS E3RUL4_PYRTT/23-233       AC E3RUL4.1
#=GS B4NNL6_DROWI/10-175       AC B4NNL6.1
#=GS A0A059ADM4_EUCGR/1-112    AC A0A059ADM4.1
#=GS C1H036_PARBA/67-261       AC C1H036.1
#=GS E6NU38_JATCU/10-175       AC E6NU38.1
#=GS Q6CS55_KLULA/14-213       AC Q6CS55.1
#=GS G8YR38_PICSO/12-187       AC G8YR38.1
#=GS G1Q147_MYOLU/28-211       AC G1Q147.1
#=GS I3ND88_SPETR/50-234       AC I3ND88.1
#=GS Q7PX02_ANOGA/10-175       AC Q7PX02.4
#=GS W7TLT3_9STRA/33-198       AC W7TLT3.1
#=GS W6XT96_COCCA/23-228       AC W6XT96.1
#=GS PR38B_HUMAN/47-231        AC Q5VTL8.1
#=GS F7HY13_CALJA/10-175       AC F7HY13.1
#=GS W5HDU6_WHEAT/23-68        AC W5HDU6.1
#=GS E9AUQ4_LEIMU/4-145        AC E9AUQ4.1
#=GS G3QMW7_GORGO/10-175       AC G3QMW7.1
#=GS W7JYK7_PLAFO/173-335      AC W7JYK7.1
#=GS Q9FHS8_ARATH/4-159        AC Q9FHS8.1
#=GS N4VSA6_COLOR/24-191       AC N4VSA6.1
#=GS E4YZY4_OIKDI/10-175       AC E4YZY4.1
#=GS L7LUD5_9ACAR/14-223       AC L7LUD5.1
#=GS J6E9Q7_SACK1/15-219       AC J6E9Q7.1
#=GS S8GGV4_TOXGO/10-175       AC S8GGV4.1
#=GS R1EHA8_BOTPV/20-176       AC R1EHA8.1
#=GS W2VPF5_PHYPR/9-173        AC W2VPF5.1
#=GS G0VC19_NAUCC/15-211       AC G0VC19.1
#=GS A0A024W143_PLAFA/173-335  AC A0A024W143.1
#=GS V4ZI95_TOXGO/10-175       AC V4ZI95.1
#=GS C8Z8W9_YEAS8/15-219       AC C8Z8W9.1
#=GS W2MYS7_PHYPR/11-61        AC W2MYS7.1
#=GS PR38B_DANRE/25-209        AC Q6P7Y3.1
#=GS H2ZEL3_CIOSA/29-213       AC H2ZEL3.1
#=GS A1YKG0_BRASY/3-151        AC A1YKG0.1
#=GS B8B2Q7_ORYSI/4-173        AC B8B2Q7.1
#=GS B3MXQ1_DROAN/35-219       AC B3MXQ1.1
#=GS S7UNW7_TOXGO/142-303      AC S7UNW7.1
#=GS F1L9R6_ASCSU/10-175       AC F1L9R6.1
#=GS W4KIC8_9HOMO/10-173       AC W4KIC8.1
#=GS U6J4Q3_ECHGR/1-99         AC U6J4Q3.1
#=GS B4P3Y2_DROYA/10-175       AC B4P3Y2.1
#=GS Q6IP13_XENLA/17-182       AC Q6IP13.1
#=GS A7F153_SCLS1/21-188       AC A7F153.1
#=GS S9VFC1_9TRYP/46-243       AC S9VFC1.1
#=GS H2ARW2_KAZAF/14-210       AC H2ARW2.1
#=GS N9V888_ENTHI/2-162        AC N9V888.1
#=GS L8X0R2_THACA/10-163       AC L8X0R2.1
#=GS C5GJR6_AJEDR/20-214       AC C5GJR6.1
#=GS K3W962_PYTUL/10-174       AC K3W962.1
#=GS E9AXK8_LEIMU/273-441      AC E9AXK8.1
#=GS B7QBZ1_IXOSC/10-175       AC B7QBZ1.1
#=GS M3Y690_MUSPF/10-175       AC M3Y690.1
#=GS A0A024Y362_YEASX/15-219   AC A0A024Y362.1
#=GS K4B140_SOLLC/10-175       AC K4B140.1
#=GS E9QD55_DANRE/25-170       AC E9QD55.1
#=GS A0A026WAG5_CERBI/37-224   AC A0A026WAG5.1
#=GS Q8RUP2_ORYSJ/23-76        AC Q8RUP2.1
#=GS S4RLN9_PETMA/10-137       AC S4RLN9.1
#=GS A5C7T6_VITVI/10-175       AC A5C7T6.1
#=GS A1YKF9_BRASY/3-165        AC A1YKF9.1
#=GS A6ZV57_YEAS7/15-219       AC A6ZV57.1
#=GS W8BTB5_CERCA/10-175       AC W8BTB5.1
#=GS A0A028JMB5_TRIRU/20-222   AC A0A028JMB5.1
#=GS A0A016STM2_9BILA/62-272   AC A0A016STM2.1
#=GS S9XEH7_SCHCR/14-177       AC S9XEH7.1
#=GS A0A024UYP7_PLAFA/11-175   AC A0A024UYP7.1
#=GS E9IDC1_SOLIN/82-265       AC E9IDC1.1
#=GS A0A010R8A1_9PEZI/24-191   AC A0A010R8A1.1
#=GS H9K930_APIME/10-175       AC H9K930.1
#=GS C9S9P5_VERA1/26-193       AC C9S9P5.1
#=GS W9YWJ5_9EURO/19-185       AC W9YWJ5.1
#=GS B5X2T8_SALSA/10-175       AC B5X2T8.1
#=GS W5AB44_WHEAT/3-167        AC W5AB44.1
#=GS X1YD78_ANODA/10-175       AC X1YD78.1
#=GS F4PZZ0_DICFS/118-283      AC F4PZZ0.1
#=GS B9G228_ORYSJ/166-246      AC B9G228.1
#=GS H3FY63_PRIPA/61-245       AC H3FY63.1
#=GS G0W4U6_NAUDC/16-223       AC G0W4U6.1
#=GS D8SIA1_SELML/5-138        AC D8SIA1.1
#=GS Q8SUF7_ENCCU/2-164        AC Q8SUF7.1
#=GS K2GU44_ENTNP/2-162        AC K2GU44.1
#=GS S9YKY6_9CETA/13-80        AC S9YKY6.1
#=GS I1HL97_BRADI/3-166        AC I1HL97.1
#=GS G3WWZ2_SARHA/30-174       AC G3WWZ2.1
#=GS C4JA01_MAIZE/1-55         AC C4JA01.1
#=GS PR38A_XENLA/10-175        AC Q4FZQ6.1
#=GS R4X9K4_TAPDE/21-184       AC R4X9K4.1
#=GS M3XUF9_MUSPF/49-233       AC M3XUF9.1
#=GS W8BU66_CERCA/1-136        AC W8BU66.1
#=GS E2BCA0_HARSA/10-175       AC E2BCA0.1
#=GS W9ZJQ2_FUSOX/25-192       AC W9ZJQ2.1
#=GS E4XHG4_OIKDI/82-282       AC E4XHG4.1
#=GS A0A023F4I6_TRIIF/24-208   AC A0A023F4I6.1
#=GS H3B6U1_LATCH/36-219       AC H3B6U1.1
#=GS A0A016ST41_9BILA/62-272   AC A0A016ST41.1
#=GS G4U7T3_NEUT9/24-191       AC G4U7T3.1
#=GS C1MPU3_MICPC/21-183       AC C1MPU3.1
#=GS PRP38_YEAST/15-219        AC Q00723.1
#=GS I1F795_AMPQE/2-83         AC I1F795.1
#=GS M0U4G2_MUSAM/3-166        AC M0U4G2.1
#=GS K4DTH9_TRYCR/9-176        AC K4DTH9.1
#=GS K6UDH3_9APIC/42-122       AC K6UDH3.1
#=GS M3UPS3_ENTHI/7-169        AC M3UPS3.1
#=GS A0A026WC55_CERBI/10-175   AC A0A026WC55.1
#=GS V7PDY7_9APIC/10-175       AC V7PDY7.1
#=GS R0L434_ANAPL/3-187        AC R0L434.1
#=GS K7HSD9_CAEJA/1-166        AC K7HSD9.1
#=GS G1XLI7_ARTOA/22-185       AC G1XLI7.1
#=GS R9ACJ1_WALI9/10-173       AC R9ACJ1.1
#=GS B8BCS7_ORYSI/10-175       AC B8BCS7.1
#=GS F7H0L0_MACMU/47-189       AC F7H0L0.1
#=GS W5EZF1_WHEAT/1-99         AC W5EZF1.1
#=GS U6HES1_ECHMU/27-211       AC U6HES1.1
#=GS W7E3G4_COCVI/23-228       AC W7E3G4.1
#=GS A0A024WI92_PLAFA/173-335  AC A0A024WI92.1
#=GS F0VCL2_NEOCL/132-293      AC F0VCL2.1
#=GS PR38B_MOUSE/48-232        AC Q80SY5.1
#=GS B9PT26_TOXGO/142-303      AC B9PT26.1
#=GS M0Z3R7_HORVD/3-165        AC M0Z3R7.1
#=GS PR38A_MACFA/10-175        AC Q8HXH6.1
#=GS J4W4G8_BEAB2/24-191       AC J4W4G8.1
#=GS D2V594_NAEGR/1-165        AC D2V594.1
#=GS H0V990_CAVPO/21-205       AC H0V990.1
#=GS M3VYN3_FELCA/10-175       AC M3VYN3.1
#=GS PR38A_XENTR/10-175        AC Q28H87.1
#=GS A0A024W6R0_PLAFA/11-175   AC A0A024W6R0.1
#=GS H0V4L8_CAVPO/10-175       AC H0V4L8.1
#=GS A0A015N4G5_9GLOM/7-171    AC A0A015N4G5.1
#=GS W4ZSU7_WHEAT/50-203       AC W4ZSU7.1
#=GS H2ZEL4_CIOSA/4-188        AC H2ZEL4.1
#=GS Q4UCH1_THEAN/10-175       AC Q4UCH1.1
#=GS B4F7Y9_MAIZE/3-166        AC B4F7Y9.1
#=GS M0X6G7_HORVD/3-166        AC M0X6G7.1
#=GS G0PED8_CAEBE/1-148        AC G0PED8.1
#=GS V4AYJ2_LOTGI/4-188        AC V4AYJ2.1
#=GS I3JLV3_ORENI/10-175       AC I3JLV3.1
#=GS S8F818_TOXGO/142-303      AC S8F818.1
#=GS U6MUF7_9EIME/120-282      AC U6MUF7.1
#=GS G1NUQ8_MYOLU/10-176       AC G1NUQ8.1
#=GS B4JL98_DROGR/29-213       AC B4JL98.1
#=GS S8D204_9LAMI/10-175       AC S8D204.1
#=GS E6R495_CRYGW/9-172        AC E6R495.1
#=GS K7GEC3_PELSI/50-234       AC K7GEC3.1
#=GS Q9VYE9_DROME/24-208       AC Q9VYE9.1
#=GS D2HBF7_AILME/36-220       AC D2HBF7.1
#=GS Q2H4I5_CHAGB/24-112       AC Q2H4I5.1
#=GS D8QIS6_SCHCM/10-173       AC D8QIS6.1
#=GS M7BDA2_CHEMY/30-111       AC M7BDA2.1
#=GS U6LVE5_9EIME/1-146        AC U6LVE5.1
#=GS Q4CZI2_TRYCC/9-176        AC Q4CZI2.1
#=GS R7SBP5_TREMS/8-160        AC R7SBP5.1
#=GS G0QNU7_ICHMG/10-175       AC G0QNU7.1
#=GS G1PFY0_MYOLU/28-212       AC G1PFY0.1
#=GS W6KQG9_9TRYP/4-158        AC W6KQG9.1
#=GS W9XE09_9EURO/19-185       AC W9XE09.1
#=GS F5HEN9_CRYNB/9-170        AC F5HEN9.1
#=GS L8IKN7_9CETA/10-175       AC L8IKN7.1
#=GS G3IJU9_CRIGR/1-120        AC G3IJU9.1
#=GS C5DED7_LACTC/14-227       AC C5DED7.1
#=GS M3XER9_FELCA/48-232       AC M3XER9.1
#=GS J9VL34_CRYNH/9-172        AC J9VL34.2
#=GS G5AUI5_HETGA/10-175       AC G5AUI5.1
#=GS G5DX06_SILLA/4-168        AC G5DX06.1
#=GS E5S6X1_TRISP/427-611      AC E5S6X1.1
#=GS A0A024GSS3_9STRA/10-174   AC A0A024GSS3.1
#=GS A0A024XRX9_YEASX/15-219   AC A0A024XRX9.1
#=GS F1Q7F0_DANRE/25-209       AC F1Q7F0.1
#=GS B4J994_DROGR/10-175       AC B4J994.1
#=GS S2JQG7_MUCC1/11-174       AC S2JQG7.1
#=GS Q6BW00_DEBHA/12-188       AC Q6BW00.1
#=GS G3MFX1_9ACAR/105-174      AC G3MFX1.1
#=GS L7M8D1_9ACAR/10-175       AC L7M8D1.1
#=GS T1JA16_STRMM/13-197       AC T1JA16.1
#=GS G5A621_PHYSP/9-173        AC G5A621.1
#=GS B3NWQ4_DROER/26-210       AC B3NWQ4.1
#=GS C6TI40_SOYBN/10-175       AC C6TI40.1
#=GS G9N2S0_HYPVG/26-193       AC G9N2S0.1
#=GS M9PHQ4_DROME/24-177       AC M9PHQ4.1
#=GS B4R4A9_DROSI/197-381      AC B4R4A9.1
#=GS Q8RWB1_ARATH/4-168        AC Q8RWB1.1
#=GS Q0U5G5_PHANO/25-223       AC Q0U5G5.1
#=GS L5LXA6_MYODS/1-171        AC L5LXA6.1
#=GS G8C0B1_TETPH/14-216       AC G8C0B1.1
#=GS W2THV3_NECAM/65-249       AC W2THV3.1
#=GS I0YZI6_9CHLO/10-175       AC I0YZI6.1
#=GS M5ELW3_MALS4/10-174       AC M5ELW3.1
#=GS B8C9N6_THAPS/41-204       AC B8C9N6.1
#=GS M3ZTE6_XIPMA/10-175       AC M3ZTE6.1
#=GS V6U1Q1_GIAIN/1-137        AC V6U1Q1.1
#=GS T0QUG7_9STRA/50-213       AC T0QUG7.1
#=GS Q7RC31_PLAYO/10-175       AC Q7RC31.1
#=GS C1LKA9_SCHJA/27-211       AC C1LKA9.1
#=GS A0A022TM69_TRIRU/20-222   AC A0A022TM69.1
#=GS K0SK04_THAOC/10-174       AC K0SK04.1
#=GS B8NUH3_ASPFN/20-209       AC B8NUH3.1
#=GS M5G439_DACSP/10-173       AC M5G439.1
#=GS W7MMC8_GIBM7/25-192       AC W7MMC8.1
#=GS B4Q236_DROYA/28-212       AC B4Q236.1
#=GS M4EH49_BRARP/4-168        AC M4EH49.1
#=GS U5FGX6_POPTR/3-167        AC U5FGX6.1
#=GS K0KUA6_WICCF/15-175       AC K0KUA6.1
#=GS W5UFD4_ICTPU/10-175       AC W5UFD4.1
#=GS I1H1P3_BRADI/3-165        AC I1H1P3.1
#=GS S7NM55_MYOBR/1-94         AC S7NM55.1
#=GS H2N7E1_PONAB/19-176       AC H2N7E1.1
#=GS H3CJ03_TETNG/10-177       AC H3CJ03.1
#=GS Q18942_CAEEL/10-175       AC Q18942.1
#=GS B9FRG0_ORYSJ/4-145        AC B9FRG0.1
#=GS F7GLJ8_MONDO/12-196       AC F7GLJ8.1
#=GS H8WYB4_CANO9/18-195       AC H8WYB4.1
#=GS A0A024TH67_9STRA/55-219   AC A0A024TH67.1
#=GS S9PW36_SCHOY/14-177       AC S9PW36.1
#=GS F4PGM1_DICFS/1-133        AC F4PGM1.1
#=GS W5DV57_WHEAT/3-53         AC W5DV57.1
#=GS K6VGZ7_9APIC/165-327      AC K6VGZ7.1
#=GS E9GQD3_DAPPU/32-216       AC E9GQD3.1
#=GS A0A016P7Z6_GIBZA/25-192   AC A0A016P7Z6.1
#=GS M7WBI1_ENTHI/2-162        AC M7WBI1.1
#=GS B4ZYI9_CAEBE/55-212       AC B4ZYI9.1
#=GS V5GRF0_ANOGL/25-209       AC V5GRF0.1
#=GS U6IAL5_HYMMI/27-211       AC U6IAL5.1
#=GS S9XCT7_9CETA/1-124        AC S9XCT7.1
#=GS I1BHD0_RHIO9/11-174       AC I1BHD0.1
#=GS F6UK93_HORSE/47-231       AC F6UK93.1
#=GS E4YKK0_OIKDI/82-282       AC E4YKK0.1
#=GS W4WLI1_ATTCE/10-175       AC W4WLI1.1
#=GS T1EDF2_HELRO/10-175       AC T1EDF2.1
#=GS F1LD56_ASCSU/4-173        AC F1LD56.1
#=GS H1VMK2_COLHI/24-191       AC H1VMK2.1
#=GS G1LRX0_AILME/10-175       AC G1LRX0.1
#=GS Q17D08_AEDAE/10-175       AC Q17D08.1
#=GS A0A024VIV8_PLAFA/154-331  AC A0A024VIV8.1
#=GS H0GV28_SACCK/15-219       AC H0GV28.1
#=GS B0Y458_ASPFC/33-222       AC B0Y458.1
#=GS F8P4X8_SERL9/10-173       AC F8P4X8.1
#=GS D7LFT1_ARALL/10-175       AC D7LFT1.1
#=GS W9N9A5_FUSOX/25-192       AC W9N9A5.1
#=GS V9D4R0_9EURO/19-185       AC V9D4R0.1
#=GS A2QN12_ASPNC/20-209       AC A2QN12.1
#=GS C4R8X3_PICPG/19-184       AC C4R8X3.1
#=GS E1ZNW2_CHLVA/10-175       AC E1ZNW2.1
#=GS G3PQV2_GASAC/24-208       AC G3PQV2.1
#=GS D8LU65_ECTSI/4-146        AC D8LU65.1
#=GS E4YYX7_OIKDI/82-113       AC E4YYX7.1
#=GS K2R9I0_MACPH/20-208       AC K2R9I0.1
#=GS R7TJL4_CAPTE/7-191        AC R7TJL4.1
#=GS H2PZJ2_PANTR/47-231       AC H2PZJ2.1
#=GS D4AX30_ARTBC/20-222       AC D4AX30.1
#=GS F0ULM3_AJEC8/20-214       AC F0ULM3.1
#=GS H3G9C3_PHYRM/9-173        AC H3G9C3.1
#=GS A4HYV7_LEIIN/4-144        AC A4HYV7.1
#=GS A0CFN0_PARTE/86-247       AC A0CFN0.1
#=GS V4NLP3_EUTSA/4-168        AC V4NLP3.1
#=GS K4FUA1_CALMI/10-175       AC K4FUA1.1
#=GS L9KRH9_TUPCH/54-238       AC L9KRH9.1
#=GS K4BPW0_SOLLC/5-167        AC K4BPW0.1
#=GS W4W0X9_ATTCE/37-225       AC W4W0X9.1
#=GS C1ML42_MICPC/10-175       AC C1ML42.1
#=GS I3SX28_MEDTR/10-175       AC I3SX28.1
#=GS F7AMT8_CALJA/47-190       AC F7AMT8.1
#=GS E7QER7_YEASZ/15-219       AC E7QER7.1
#=GS A0A022XS47_TRISD/20-222   AC A0A022XS47.1
#=GS E2B9R7_HARSA/37-220       AC E2B9R7.1
#=GS W4IT64_PLAFP/11-175       AC W4IT64.1
#=GS B4NCI0_DROWI/51-235       AC B4NCI0.1
#=GS D4CZ38_TRIVH/20-222       AC D4CZ38.1
#=GS N6TV19_DENPD/10-175       AC N6TV19.1
#=GS B3SEX8_TRIAD/10-175       AC B3SEX8.1
#=GS S9X1J3_9CETA/10-175       AC S9X1J3.1
#=GS E6X8B2_CELAD/97-274       AC E6X8B2.1
#=GS E9C6I2_CAPO3/6-173        AC E9C6I2.1
#=GS W3VHI3_9BASI/10-174       AC W3VHI3.1
#=GS C9ZID8_TRYB9/36-208       AC C9ZID8.1
#=GS V4T5N8_9ROSI/10-175       AC V4T5N8.1
#=GS U3JST2_FICAL/1-134        AC U3JST2.1
#=GS D3B1N8_POLPA/3-164        AC D3B1N8.1
#=GS A0A022YNJ3_TRIRU/20-222   AC A0A022YNJ3.1
#=GS G3TI91_LOXAF/47-231       AC G3TI91.1
#=GS T2MCG1_HYDVU/16-200       AC T2MCG1.1
#=GS W7J6P1_PLAFA/173-335      AC W7J6P1.1
#=GS G3VXQ4_SARHA/1-133        AC G3VXQ4.1
#=GS D8TND3_VOLCA/10-177       AC D8TND3.1
#=GS B9SR85_RICCO/3-167        AC B9SR85.1
#=GS M5XQR0_PRUPE/1-124        AC M5XQR0.1
#=GS U5HBW6_USTV1/10-174       AC U5HBW6.1
#=GS V5G3J8_BYSSN/20-207       AC V5G3J8.1
#=GS I8IE99_ASPO3/20-209       AC I8IE99.1
#=GS D8SIA0_SELML/5-72         AC D8SIA0.1
#=GS S8A531_DACHA/22-185       AC S8A531.1
#=GS G1QM59_NOMLE/48-232       AC G1QM59.1
#=GS M4DKE9_BRARP/10-175       AC M4DKE9.1
#=GS V9IBJ2_APICE/37-220       AC V9IBJ2.1
#=GS W5AKT7_WHEAT/3-167        AC W5AKT7.1
#=GS G7KFW5_MEDTR/3-166        AC G7KFW5.1
#=GS R0K0D1_SETT2/23-218       AC R0K0D1.1
#=GS F4RZW6_MELLP/10-174       AC F4RZW6.1
#=GS Q4XAT0_PLACH/10-175       AC Q4XAT0.1
#=GS C1FDQ5_MICSR/10-174       AC C1FDQ5.1
#=GS B3MDH3_DROAN/10-175       AC B3MDH3.1
#=GS A0A024UKU5_9STRA/9-173    AC A0A024UKU5.1
#=GS F2TEA8_AJEDA/20-214       AC F2TEA8.1
#=GS A0A017SNM0_9EURO/20-202   AC A0A017SNM0.1
#=GS W4GR42_9STRA/57-221       AC W4GR42.1
#=GS Q4WUN3_ASPFU/33-222       AC Q4WUN3.1
#=GS Q4N1F1_THEPA/128-239      AC Q4N1F1.1
#=GS C1LIZ4_SCHJA/10-175       AC C1LIZ4.1
#=GS PR38A_BOVIN/10-175        AC Q0P5I6.1
#=GS L0B1D3_BABEQ/121-233      AC L0B1D3.1
#=GS C1C1J0_9MAXI/10-175       AC C1C1J0.1
#=GS S4PMT8_9NEOP/22-206       AC S4PMT8.1
#=GS K9II45_DESRO/10-175       AC K9II45.1
#=GS D8TKN7_VOLCA/1-167        AC D8TKN7.1
#=GS B6TSE1_MAIZE/3-166        AC B6TSE1.1
#=GS I1LB75_SOYBN/10-175       AC I1LB75.1
#=GS A5DTV1_LODEL/38-215       AC A5DTV1.1
#=GS A8IJK3_CHLRE/10-175       AC A8IJK3.1
#=GS U6L8R2_EIMTE/10-174       AC U6L8R2.1
#=GS L2GTU9_VAVCU/4-152        AC L2GTU9.1
#=GS I1NJ40_SOYBN/10-175       AC I1NJ40.1
#=GS A0A023ZMV0_YEASX/15-219   AC A0A023ZMV0.1
#=GS W1NQE5_AMBTC/3-166        AC W1NQE5.1
#=GS E9BHN7_LEIDB/271-441      AC E9BHN7.1
#=GS M7U0A7_BOTF1/21-188       AC M7U0A7.1
#=GS F0WHG9_9STRA/10-174       AC F0WHG9.1
#=GS B4ME55_DROVI/10-175       AC B4ME55.1
#=GS Q0CIC3_ASPTN/20-209       AC Q0CIC3.1
#=GS D8T1B4_SELML/10-168       AC D8T1B4.1
#=GS A5DGC7_PICGU/7-183        AC A5DGC7.1
#=GS W0VPU5_ZYGBA/14-209       AC W0VPU5.1
#=GS U6KXF4_EIMTE/120-282      AC U6KXF4.1
#=GS E0VES7_PEDHC/10-175       AC E0VES7.1
#=GS J9NZD6_CANFA/48-232       AC J9NZD6.1
#=GS I1RQR3_GIBZE/25-192       AC I1RQR3.1
#=GS V9ES07_PHYPR/9-173        AC V9ES07.1
#=GS A7RN21_NEMVE/18-202       AC A7RN21.1
#=GS Q4SZ28_TETNG/10-175       AC Q4SZ28.1
#=GS W7KEH1_PLAFO/11-168       AC W7KEH1.1
#=GS Q5KIE6_CRYNJ/9-170        AC Q5KIE6.1
#=GS A8X281_CAEBR/57-204       AC A8X281.2
#=GS H3DCW8_TETNG/25-209       AC H3DCW8.1
#=GS G1S8M8_NOMLE/1-148        AC G1S8M8.1
#=GS A9TDL8_PHYPA/6-170        AC A9TDL8.1
#=GS Q59WJ8_CANAL/17-194       AC Q59WJ8.1
#=GS G5DX07_SILLA/4-168        AC G5DX07.1
#=GS L7JCZ4_MAGOP/23-190       AC L7JCZ4.1
#=GS E5A0N9_LEPMJ/24-234       AC E5A0N9.1
#=GS S7MJI8_MYOBR/1-34         AC S7MJI8.1
#=GS C0PU75_SALSA/1-45         AC C0PU75.1
#=GS F6HI04_VITVI/3-166        AC F6HI04.1
#=GS A0A059LRU5_9CHLO/10-175   AC A0A059LRU5.1
#=GS A0A059J1T7_9EURO/20-222   AC A0A059J1T7.1
#=GS U5CUR3_AMBTC/1-70         AC U5CUR3.1
#=GS G3BAA6_CANTC/7-180        AC G3BAA6.1
#=GS D5GP15_TUBMM/20-183       AC D5GP15.1
#=GS J7RRK2_KAZNA/15-210       AC J7RRK2.1
#=GS M1KAQ1_ENCCN/2-164        AC M1KAQ1.1
#=GS S8ESL2_FOMPI/10-173       AC S8ESL2.1
#=GS A9UQL8_MONBE/10-172       AC A9UQL8.1
#=GS A0A024VK41_PLAFA/10-82    AC A0A024VK41.1
#=GS J4DQ33_THEOR/128-289      AC J4DQ33.1
#=GS I3LP32_PIG/10-97          AC I3LP32.1
#=GS A0A059LNV7_9CHLO/42-209   AC A0A059LNV7.1
#=GS M2SAU0_ENTHI/7-169        AC M2SAU0.1
#=GS M0X6G8_HORVD/3-153        AC M0X6G8.1
#=GS S7PSV6_MYOBR/10-175       AC S7PSV6.1
#=GS W5P5R7_SHEEP/10-175       AC W5P5R7.1
#=GS Q69K06_ORYSJ/10-175       AC Q69K06.1
#=GS Q8IM21_PLAF7/173-335      AC Q8IM21.1
#=GS D7FPC2_ECTSI/52-172       AC D7FPC2.1
#=GS C4JLP1_UNCRE/20-208       AC C4JLP1.1
#=GS B4IGQ6_DROSE/1-166        AC B4IGQ6.1
#=GS F0WLM7_9STRA/1-110        AC F0WLM7.1
#=GS A8BAJ9_GIAIC/1-144        AC A8BAJ9.1
#=GS G3AGB8_SPAPN/17-194       AC G3AGB8.1
#=GS I1GG42_AMPQE/33-217       AC I1GG42.1
#=GS I1EKT3_AMPQE/1-78         AC I1EKT3.1
#=GS A0DJV2_PARTE/10-175       AC A0DJV2.1
#=GS G1N3A5_MELGA/1-182        AC G1N3A5.2
#=GS H2TYE2_TAKRU/22-164       AC H2TYE2.1
#=GS R1EUR9_EMIHU/44-217       AC R1EUR9.1
#=GS B4KQL3_DROMO/10-175       AC B4KQL3.1
#=GS C4M949_ENTHI/7-169        AC C4M949.1
#=GS Q4RV73_TETNG/22-206       AC Q4RV73.1
#=GS I1JHT5_SOYBN/4-166        AC I1JHT5.1
#=GS D3TRD8_GLOMM/10-175       AC D3TRD8.1
#=GS J4C3Z9_THEOR/10-175       AC J4C3Z9.1
#=GS L5K6N9_PTEAL/10-175       AC L5K6N9.1
#=GS D0NNV1_PHYIT/37-201       AC D0NNV1.1
#=GS A7ARD6_BABBO/10-175       AC A7ARD6.1
#=GS G0QNS3_ICHMG/118-285      AC G0QNS3.1
#=GS G4VNB2_SCHMA/10-175       AC G4VNB2.1
#=GS H6BS57_EXODN/19-185       AC H6BS57.1
#=GS W7X5L5_TETTS/175-341      AC W7X5L5.1
A0A023G8Y0_9ACAR/10-175              .................................................h-SVRGTNPQYLVEKIIRSRIYDS.RYWKEECFALT.......................................A........-ELLVDKAME-..LRFIGG..............-VYG.GNV...........................................KP.APFLCLLLKM.LQIQ.PEKD..........IVVE.FIR...............................................QDEFKYVRA............L....GANY...M.....RLVGS........................SLDC....YKYL.E.....PLYNDYR.KLRRQNRDG...................-----....AYVVVHMDEFIDE.LL.......REERVAD..I..ILPRIQKRQVLEEN-g...................................................................
B0WBK2_CULQU/28-212                  .................................................l-PLWGNESTMNLNPLILANIQGS.SYFKVSLFKLK.......................................T........YHEVVDEIYYQ..VKHLEP..............WERG.SRKtsgqtgmcg.........................gvrgvgaggIV.STAFCLLYKL.YTLR.LTRK..........QVNG.LLT...............................................HTDSPYIRA............L....GFMY...L.....RYTQP........................PADL....YDWY.E.....EYLLDEE.---------...................EIDVKa..gGGQSITIGLMCRQ.FL.......TKLDWFS..T..LFPRIPVPIQKQIQ-q...................................................................
B9H3J6_POPTR/3-167                   ................................................vq--TNGKPIDSLFEKVLCMNILSS.DYFK-ELYRLK.......................................T........YHEVIDEIYNQ..VDNVEP..............WMTG.NCR...........................................GP.STSFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HKDSPYIRA............V....GFLY...L.....RYAGD........................PKTL....WNWF.E.....PYIKDDE.---------...................EFSPG...sSGRKTTIGIYVRD.LL.......LGQYYFD..T..LFPRIPVPVLR----qita................................................................
I0Z2X4_9CHLO/2-166                   ...............................................eqy----GNTATFNVESVLQKNIVNS.EYYRDTCMKLG.......................................T........WEEVVDEIYYS..VQDVEP..............WMSG.NAR...........................................GA.SSAFCLLYRL.FTLV.PSKP..........QIKN.LLD...............................................HTDSPYIRA............V....GFLY...L.....RYAAN........................PRTL....WEWI.Q.....PYVRDSE.---------...................EIDPSp.egHGKTVTMGEFVRD.VF.......LEQYYFE..T..IFPRIPKPV------hddf................................................................
A0A024S8J4_HYPJE/26-193              ...............................................lap---NGLNPATIMEKAVKDRIVDS.YFYKEQCFALN.......................................E........-ADIVDRVVEH..VTFIGG..............-THG.ASQ...........................................KP.SPFLCLAFKL.LELA.PSDA..........ILQE.YLSy.............................................gGEHFKYLRA............L....ACFY...V.....RLTRQ........................AKDV....YLTL.E.....PFLEDRR.KLRRKARTG...................-----....-TTLTFVDEFVDD.LL.......TKDRVCA..T..SLWKMPKRETLEDL-e...................................................................
Q8CI29_MOUSE/122-171                 .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VR----..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....----...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------il..................................................................
C5FIK5_ARTOC/25-209                  ............................................vnpatl-----------------------.--FEKACFGLN.......................................A........-ATLCDRAVE-..LTYIGG..............-TYG.VGQ...........................................KP.TPFLCLAFKL.LQLA.PERD..........VILE.YLNfhdpeadkeensgdggnnp........gadddpddaqdkadaailkaTGDFKYLRA............L....AAFY...V.....RLTFE........................PVEI....YKTL.E.....PLLMDYR.KLKRRTKEG...................-----....-FLLTHMDQFVDD.LL.......TKDRVCG..T..SLWKIPARTMLEDL-d...................................................................
C5K6I2_PERM5/108-276                 ...............................................vvv----NQGPLYGLYPTLVQNIQSS.DYFNKGLRGMS.......................................T........VEEVVEEVERA..VEHAEP..............YNVG.ALN...........................................IP.STMFCCLYKL.CSKG.QARP..........SWSL.SLG...............................................TASRRYVVC............L....GLLY...L.....RCVAQ........................PSSL....WTWF.Y.....PVLFDTT.VFHPEEVTG...................--EAQ....AAESMMLGRYAEL.LL.......LTHKYFT..V..NLNRLPETI------lqky................................................................
PRP38_ARATH/10-175                   ..................................................KNIRGTNPQNLVEKIVRTKIYQH.TFWKEQCFGLT.......................................A........-ETLVDKAME-..LDHLGG..............-TFG.GSR...........................................KP.TPFLCLILKM.LQIQ.PEKE..........IVVE.FIK...............................................NDDYKYVRI............L....GAFY...L.....RLTGT........................DVDV....YRYL.E.....PLYNDYR.KVRQKLSDG...................-----....KFSLTHVDEVIEE.LL.......TKDYSCD..I..AMPRLKKRWTLEQN-g...................................................................
D3BAL0_POLPA/154-210                 ..................................................-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....----...-.....-----........................----....-KYL.E.....PLYNDYR.TIRLQLDIG...................-----....-YRKLSMDEFVEE.LL.......TTNYSLD..I..ALPHLPPRSSLEAN-a...................................................................
W7J9T8_PLAFA/11-175                  ...............................................knf----GSNPQYLISNIIRSKIYDS.PYWKEKCFALT.......................................S........-ESIIDQAIN-..LKYVGG..............-TYG.GNR...........................................KP.TRFLCLILKL.LQIQ.PDKD..........IIYE.YIK...............................................NEDFVYLRA............L....GIFY...L.....RLIGK........................SLEV....YNHL.E.....PILFDYR.KIRMRLQNG...................-----....TFEKIYMDVFVDN.CL.......ILNNFLD..V..DFPTLTKRQVLEEN-n...................................................................
J9I2Y7_9SPIT/195-356                 .............................................cdykn---------GNLPEMIRNTILSC.QYFK-DLYNLK.......................................T........FKEVIEEIKTH..VSYTEP..............WIVG.ANG...........................................VP.STLFCCLYKF.MLMR.LNEK..........QVQT.LLR...............................................YKLSPYVRA............C....GALY...V.....RFLSP........................NDQL....FDRL.S.....PYMLDEQ.---------...................SFSYSi..eKSQSLTFGEYVER.LL.......SEKNYFS..I..LLPRIPVIQ------frelqk..............................................................
V7PM72_9APIC/175-337                 ...............................................lem----TNTSTYNVNNLLRNNILSS.EYFR-SLITLK.......................................T........FKEVLDEILSY..ADHAEP..............YCIG.STR...........................................AP.STLFCCLYKL.FTMH.LSKK..........QLKS.LIE...............................................NKESCYVRA............C....GFLY...L.....RYVHS........................PSNL....WMWF.E.....PYMLDDE.---------...................EFTVSa..dKRKLMTIGEYVQS.LL.......YDDKYFN..T..VLPRLPIKIK-----niy.................................................................
S4RRN6_PETMA/37-156                  .................................................l-PLWGNEKTMNMNPLILTNIQAS.PYFKVELYELK.......................................T........YHE-VDEIYYK..VSHLEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QLNG.LIT...............................................HSDSPYIRG............L....GFMY...I.....RY---........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------....................................................................
H2MEA7_ORYLA/10-179                  .................................................n-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................E........MLIIFKRFENRgxXXFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRL............L....GAMY...M.....RLTGT........................AVDC....YKYL.E.....PLYNDYR.KIKTQNRNG...................-----....EFELMHVDEFIDE.LL.......HAERVCD..I..ILPRLQRRQVLEEA-e...................................................................
C5P519_COCP7/20-209                  ................................................pl--VRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LGYIGG..............-TYG.ANQ...........................................KP.TPFLCLAFKL.LQLA.PERE..........VVLE.YLNfhdpaeddddng......................deddgdgaavlksVGDFKYLRA............L....AAFY...I.....RLTFE........................PVEV....YNVL.E.....PLLSDYR.KLKRRTKDG...................-----....-FVLTYMDQFVDD.LL.......TKDRVCG..T..SLWKLPARRILEDL-d...................................................................
G4TPS2_PIRID/10-173                  ..................................................KAIHGANPQSLVEEVIRLRIWES.AYWKEECFGLT.......................................A........-VSLIDKAIK-..LSAIGG..............-VYD.NTK...........................................-P.TQFICLLLKL.LQIQ.PEKE..........ILVE.YLL...............................................VEEYKYLRA............L....AAMY...I.....RMTFG........................AAEV....YQLL.E.....PLLNDYR.KLRLLSMNG...................-----....-FSLTYMDEFVDK.LL.......TEDRVCD..I..ILPRLPKREILEQT-e...................................................................
L2G882_COLGN/24-191                  ...............................................lap---NGENPATIMEKAVRERIIDA.YFYKEQCFAVN.......................................E........-ADIVDRVVEH..VTFIGG..............-TYG.VTQ...........................................KP.TPFLCLAFKL.LQLA.PSDE..........ILET.YLGf.............................................gGEKFKYLRA............L....AVFY...I.....RMTRK........................AKDV....YLLL.E.....PFLEDRR.KLRRKGRAG...................-----....-TSLTYMDEFVDD.LL.......TKSRVCA..T..SFRELPKRVDLVD--lg..................................................................
C4Y6R0_CLAL4/3-178                   .............................................rskvl------NKAHLIESIVRNRIQDS.LFYKQHLFLTN.......................................E........-SNILDVIVQQ..VKYLGG..............M--D.SGG...........................................RP.SPFLCCLLRL.LELE.PSDE..........IIEM.YLSq............................................ngYNEFKYLTA............L....TLLY...C.....RLVWK........................PKEF....YTLY.D.....KYIQDHR.KLRIQLKSP...................EFVNHl.pvHFKLTYMDEWIDR.LA.......EDDRVVD..I..IMPYITPRQTLAE--kg..................................................................
U9TVS5_RHIID/10-166                  .................................................i-AVHGTNPQYLIEKIMRTRIYES.LYWKEFCFGLT.......................................A........-ETLIDRAIE-..LTSFGG..............-EYG.-NQ...........................................KP.TEFLCLTLKL.LQLQ.PNKD..........IVME.FIR...............................................NEDYKYLRV............L....GAFY...L.....RLVGN........................SLEI....YQTL.E.....PLLNDYR.KLRKRTSGD...................-----....-FEIVCVDEFIEE.LL.......KEERVCD..T..ILPRMLK--------r...................................................................
U3JLV7_FICAL/10-175                  ................................................lg--IHGTNPQYLVEKIIRTRIYEC.RYWKEECFGLT.......................................A........-ELVLDKAME-..LKYVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.LIK...............................................NKDFKYVRM............L....GALY...M.....RLTGA........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRKG...................-----....EFELMHVDEFIDE.LL.......HEERVCD..I..ILPRLQKRYVVEEA-e...................................................................
F2QY71_PICP7/19-184                  .................................................e-KIHGVNPVFLIDKILREKILDS.LFWKKHCFLLD.......................................I........-LELQDLASE-..VEIIGT..............YDTN.QNS...........................................RA.TDYICLLLKM.LQLQ.PKDE..........IVIY.MLT...............................................QPYFKYVTA............L....AALY...I.....RLVFP........................SVRV....YQLL.E.....PLLNDYR.KLRIRKHGN...................-----....-ADLTYVDQLVDE.LL.......TEEKFCG..L..TLPRLVNRLRLEDD-g...................................................................
G5AIQ4_PHYSP/37-201                  .................................................l-PIYGNDSTYNLNTLLHQNILQS.AYFH-ELYKLR.......................................T........YHEVVDEIYYR..VDLAEP..............WSPG.TAR...........................................IP.SSCFCLLHKF.FLMR.LTRK..........QMQG.LLR...............................................HTDSPYIRV............V....GFLY...L.....RFTCD........................PEEL....WTWF.E.....PYLEDPE.---------...................EFNASa..nPSLKTTIGEWLIS.LL.......EENNYFG..T..ILPRIPKKIE-----dgik................................................................
G8YPM8_PICSO/12-188                  ...............................................dkr---NVLNKASLVEPIVRHRVQDS.IFYKQYLYLTN.......................................E........-STILNVIIEH..VHYIGG..............--TS.ANG...........................................KP.SPFLCCMVRL.LELE.PKQE..........IIQM.YLSq............................................mgTNTFKYLTA............M....TLMY...I.....RFVGS........................SEEI....YSIL.E.....EYYKDYR.KLRFQLKYPr................ehNGVHK....LYTLTYMDEWVDD.LL.......HKERLVD..L..ILPRLAPRRFLQD--ag..................................................................
C1LKB2_SCHJA/27-211                  .................................................l-KLWGNPQTMNLNTMIYTNIVQS.PYFKANLVELK.......................................T........YHEVIDEIYYK..VEHLEP..............WERG.SRRiggqtgmcg.........................gvrgvgaggIV.STAYCLLYKL.FTLK.LTRK..........QLKG.LLD...............................................HPDSPYIRA............L....GFMY...I.....RYCIP........................PEDF....WWWY.S.....PYWSDPE.---------...................ELDVKa..gGGCIMTIGNMLEH.WL.......TKLDWFS..T..LFPRIPVPVQKK---lee.................................................................
W5KVG4_ASTMX/10-175                  .................................................n-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LKFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRL............L....GATY...M.....RLTGT........................SVDC....YKYL.E.....PLYNDYR.KIKTQNRNG...................-----....EFEIMHVDEFIDE.LL.......HAERVCD..V..ILPRLQKRQVLEEA-e...................................................................
U1GVC6_ENDPU/19-185                  ................................................pl--IRGANPITLIETAVRDRITES.LYWKEQCFGLN.......................................A........-ATLLDRAVD-..LSYIGG..............-TYG.VGM...........................................RP.TPFLCLAFKL.LTLT.PEKE..........IVLE.YLNm.............................................gGEEWKYLRA............L....AAFY...V.....RLTFE........................PVDI....YTTL.E.....PFLTDAR.KLRRRRKEG...................-----....-YVLVHMDEFIDE.LL.......TKDRSCA..T..SLWKLPGRQQLEDL-d...................................................................
H2S675_TAKRU/10-175                  .................................................n-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LKFVGG..............-VYG.GNI...........................................KP.TPFICLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRL............L....GAMY...M.....RLTGT........................AVDC....YKYL.E.....PLYNDYR.KVKTQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERMCD..I..ILPRLQKRHVLEET-e...................................................................
W2YXI6_PHYPR/11-61                   .................................................q-SVHGVNPQTLVEKIMRNRIYAS.IYWKEQCFGLT.......................................A........-EALVDKILS-..------..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....----...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------rqqegsw.............................................................
R7W8W3_AEGTA/3-200                   ..............................................lqts----GRPIEVLMEKVLSMNIVSS.DYFK-ELYKIK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKL.FTMK.LTVN..........QMHG.LLKhpdspyiravskdylsf............papafltfiyltalydsfMEYSYFLQQ............I....GFLY...L.....RYAAD........................PKTL....WTWY.E.....PYIQDDE.---------...................EFSPG...sNGKMTTMGVYVRD.VI.......LGQYYFD..S..LLPRVPL--------lilrqv..............................................................
W5FCD2_WHEAT/10-175                  .................................................r-SIHGTNPQNLVEKIVRAKIYQS.NYWKEQCFGLT.......................................A........-ETLVDKAME-..LDHTGG..............-THG.GNR...........................................RP.TPFLCLALKM.LQIQ.PDKE..........IVVE.FIK...............................................NEDYKYVRV............L....GAFY...L.....RLTGT........................VADV....YQYL.E.....PLYNDYR.KIRQKLSDG...................-----....KFTLTHVDEFIDE.LL.......TKDYSCD..T..ALPRIQKRWILEA--sg..................................................................
H0Z2D2_TAEGU/48-232                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKAID-q...................................................................
F2DPG5_HORVD/10-175                  .................................................r-SIHGTNPQNLVEKIVRAKIYQS.NYWKEQCFGLT.......................................A........-ETLVDKAME-..LDHTGG..............-THG.GNR...........................................RP.TPFLCLALKM.LQIQ.PDKE..........IVVE.FIK...............................................NEDYKYVRV............L....GAFY...L.....RLTGT........................VADV....YQYL.E.....PLYNDYR.KIRQKLSDG...................-----....KFTLTHVDEFIDE.LL.......TKDYSCD..T..ALPRIQKRWVLEA--sg..................................................................
G3N4L7_GASAC/1-34                    ..................................................-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....----...-.....-----........................----....----.-.....-------.---------...................-----....----MHVDEFMDE.LL.......HAERMCD..I..ILPRLQKRHVLEEA-e...................................................................
W7HV93_9PEZI/23-186                  ................................................pt--IHSMNPVRLIEKIIRERIIDS.MYWKEQAWGLN.......................................A........-ATLMDRAVD-..LTYVGG..............-QY-.ANQ...........................................KP.TAFICLVLKL.LQLN.PERD..........IILE.YLN...............................................DDEFKYLRA............L....AAFY...I.....RLTWP........................AAEV....YKTL.E.....PLMRDYR.KLRLRTIAG...................-----....-FRLTFVDEFIDE.LL.......TKERVCD..I..ALPRIPTRMQLEDT-d...................................................................
T1H306_MEGSC/10-175                  ..................................................KNVHGTNPQYLIEKIIRSRIYDS.KYWKEKCFALT.......................................A........-ELLVDKAME-..IRFIGG..............-VYG.GNI...........................................KP.TEFLCLTLKM.LQIQ.PEKD..........IVVE.FIK...............................................NDEFKYVRA............L....GAFY...L.....RLTGT........................SVDC....YKYL.E.....PLYNDNR.KLRRQNRSG...................-----....QFELVYMDDFIDE.LL.......RSDRVCD..I..ILPRIQKRDVLEEN-n...................................................................
W5MGQ8_LEPOC/10-175                  .................................................n-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LKYVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRL............L....GALY...M.....RLTGS........................SVDC....YKYL.E.....PLYNDYR.KIKNQNRNG...................-----....EFELMHVDEYIDE.LL.......HSERVCD..I..ILPRLQKRQVLEEA-e...................................................................
W5L4F4_ASTMX/24-208                  .................................................l-PLWGNEKTMNLNPMILTNVLSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHAEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PADL....IEWY.E.....PFLDDEE.---------...................ELDVKa..gGGCVMTVGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKMID-q...................................................................
W7R241_YEASX/15-219                  ..................................................KQLNNQSVSLVIPRLTRDKIHNS.MYYKVNLSNES.......................................Lrg....ntMVELLKVMIGA..FGTIKGqng.......hlhmMVLG.GIE...........................................--.--FKCILMKL.IEIR.PNFQ..........QLNF.LLNvk..........................................nenGFDSKYIIA............L....LLVY...A.....RLQYYylngn.............nkndddENDL....IKLF.Kvq.lyKYSQHYF.KLKSFPLQVdc...............faHSYNE....ELCIIHIDELVDW.LA.......TQDHIWG..I..PLGKCQWNKI-----ynsde...............................................................
A0A034WTY6_BACDO/1-136               .............................mepwergsrktsgqtgmcggv-----------------------.-----------.......................................-........-----------..------..............----.--Rgvg.....................................aggIV.STAYCLLYKL.YTLR.LTRK..........QVNG.LLN...............................................HTDSPYIRA............L....GFMY...L.....RYTQP........................PADL....YDWY.E.....DYFQDEE.---------...................EIDVKa..gGGQTITIGQVVYQ.FL.......TKLDWFS..T..LFPRIPVPIQKQIE-k...................................................................
J5QUK8_TRIAS/111-203                 ............................................asthsf-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.----------.----.----..........--ER.VIQ...............................................ADIIRYLRA............L....AAMY...I.....RLTFR........................SIEV....YEIL.E.....PLMKDYR.KLRYRQVGG...................-----....-YYLTTFDEFIDD.LL.......TQDRVCD..I..ILPRLTQRSVLEE--ve..................................................................
W2XZF6_PHYPR/9-173                   .................................................q-SVHGVNPQTLVEKIMRNRIYAS.IYWKEQCFGLT.......................................A........-ETLVDKAVE-..LQEFGG..............-TFG.GNQ...........................................QP.THFLCLLLKM.LQLQ.PELE..........VVKQ.FIE...............................................NEDYKYVTV............L....GAVY...L.....RLVGK........................PLEV....YTLL.E.....PLLSDYR.KIRKRNVIG...................-----....-WEITHVDEIADA.LL.......HEEYYID..L..ALPRLADRELLEKN-e...................................................................
W7EZG4_PLAF8/11-175                  ...............................................knf----GSNPQYLISNIIRSKIYDS.PYWKEKCFALT.......................................S........-ESIIDQAIN-..LKYVGG..............-TYG.GNR...........................................KP.TRFLCLILKL.LQIQ.PDKD..........IIYE.YIK...............................................NEDFVYLRA............L....GIFY...L.....RLIGK........................SLEV....YNHL.E.....PILFDYR.KIRMRLQNG...................-----....TFEKIYMDVFVDN.CL.......ILNNFLD..V..DFPTLTKRQVLEEN-n...................................................................
S7QHR4_GLOTA/10-173                  .................................................q-AIHGQNPQYLVETVIRNRIYES.PYWKEQCFALT.......................................A........-ETLIDKAID-..LKCIGG..............-VYG.-NQ...........................................KP.TAFLCLLLKL.LQIQ.PEKE..........ILIE.YLQ...............................................ADEFKYLRA............L....AAMY...I.....RMTFR........................SVEV....YEIL.E.....PLLKDYR.KLRYRTNTG...................-----....-YTLTYMDEFVDN.LL.......REERVCD..I..ILPRLAKRSVLEE--tg..................................................................
I3MZU9_SPETR/10-159                  .................................................h-SIYGTNPQYLVEKIIRTRIYES.KYWKEECVGLT.......................................A........-ELVVDKAME-..------..............-LYG.GNI...........................................KP.TPFLCLTLKM.FQIQ.PEKD..........IIVE.F-K...............................................NEDFKYVCM............L....G-LY...M.....RLTGT........................VIDC....YKYL.E.....PLYNDCR.KIKSQNRNG...................-----....EFELMHVDEFIDE.--.......------H..I..ILPRLQKCYVLE---eae.................................................................
F6UQW2_HORSE/10-175                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
S8BH21_PENO1/20-204                  ................................................pl--VRGVNPVTLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LSCVGG..............-TYG.VSE...........................................KP.TPFICLAFKL.LQLN.PSRD..........IVLE.YLNfsdpgsddeg...........................enpdsgvvqtRGDFKYLRV............L....AAFY...V.....RLTFD........................AVDV....YKTL.E.....PLLLDYR.KIKRRVRDS...................-----....-FTLTYVDQFIDD.LL.......TKDRVCG..T..SLWKLPPRQQLEDL-d...................................................................
D7FPC2_ECTSI/168-227                 ................................................vh-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....----...-.....-----........................-EEL....WGWL.E.....PYMDDEK.KFKPSPTEG...................-----....---SMTMGKWVRK.II.......SDMQYYG..T..MLPRIPVLIER----kmk.................................................................
G2WEF9_YEASK/15-219                  ..................................................KQLNNQSVSLVIPRLTRDKIHNS.MYYKVNLSNES.......................................Lrg....ntMVELLKVMIGA..FGTIKGqng.......hlhmMVLG.GIE...........................................--.--FKCILMKL.IEIR.PNFQ..........QLNF.LLNvk..........................................nenGFDSKYIIA............L....LLVY...A.....RLQYYylngn.............nkndddENDL....IKLF.Kvq.lyKYSQHYF.KLKSFPLQVdc...............faHSYNE....ELCIIHIDELVDW.LA.......TQDHIWG..I..PLGKCQWNKI-----ynsde...............................................................
V3ZLZ8_LOTGI/10-175                  .................................................h-SIKGTNPQYLIEKIIRTRIYEC.RYWKEECFALT.......................................A........-ALLVDKAME-..LKYIGG..............-VFG.GNV...........................................KP.TDFLCLILKM.LQIQ.PEKD..........IVVE.FIK...............................................NEDFKYVRA............L....GAIY...M.....RLTGT........................SLDC....YKYL.E.....PLYLDYR.KMKRMNRNG...................-----....EFEILHMDEFIDE.LL.......REERVVD..I..ILPRLQKRQVLEES-n...................................................................
R7QB68_CHOCR/10-172                  ...............................................lhs---RGTDPQNLLEPSLRHSVYLS.RFWNESCFGVT.......................................L........-ADVVPLAAR-..LDRISA..............-V--.-TA...........................................PP.TPFLCLLLKL.LQLS.PEEP..........EIAV.FLT...............................................QNDFKYARL............L....GAFY...V.....RLALP........................PPRV....YALL.E.....PLLADLR.KIVVREGAS...................----A....EHAIVHVDELIDR.LL.......REHLVVG..I..TLPRLPPRHVVEE--s...................................................................
F7A5D9_CALJA/47-231                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
M4A2I4_XIPMA/25-209                  .................................................l-PLWGNEKTMNLNPMILTNVLSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHIEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....LDWY.N.....DFLDDEE.--KTVQKAS...................-----....GETKKKEGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKAID-q...................................................................
M3K4S3_CANMX/17-194                  ...............................................dkr---YTQNKGNLIEPIIRHRIQDS.IFYKQHLYLTN.......................................E........-ATLLPVITNH..VHYISG..............--TD.SSN...........................................RP.SPFISCLFRM.LELE.PSKE..........IIDT.YLTq............................................lnFNEFKYLTA............L....TLIY...I.....RLVYK........................SEDI....YRLF.D.....PYFKDFR.KLRVRLKNPmf...............dsMQIPK....HYKISYIDEWVDE.LL.......TNDRVID..L..ILPRLVPRISLVE--kg..................................................................
B2RTE3_MOUSE/10-175                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LKFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFVLMHVDEFIYE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
M0SG80_MUSAM/10-174                  ..................................................KSIHGTNPQNLVEKILRSKIYQN.TYWKEQCFGLT.......................................A........-ETLVDKAME-..LDHLGG..............-TYG.GSR...........................................KP.TPFMCLILKM.LQIQ.PDKE..........IVVE.FIK...............................................NDEYKYVRV............L....GAFY...M.....RLTGS........................VTDV....YRYL.E.....PLYNDYR.KLRLKLSEG...................-----....KFCLTHVDEVIDE.LL.......TKDYSCD..I..ALPRVQKRWTLE---ac..................................................................
Q4YH72_PLABA/10-175                  ..............................................iksf----GSNPQFLISNIIRNKIYDS.PYWKEKCFALT.......................................S........-ESIIDQAVN-..LKYAGG..............-TYG.GNR...........................................KP.TRFLCLVLKL.LQLQ.PDKD..........IIYE.FIK...............................................NEEFIYLRA............L....GIFY...L.....RLIGK........................GIEI....YKNI.E.....PILFDYR.KIRIRLQDG...................-----....SFQKMYMDVFADN.CL.......VFNNFLD..V..DFPPLTKRIVLEEN-n...................................................................
L8FWG2_PSED2/22-189                  ...............................................lap---NGLNPATIFEKPVRERIIDC.YFWKDQCFALN.......................................E........-ADIVSRVVEH..VHFVAG..............-TYG.DSQ...........................................RP.SPFLCLAFKL.LQLG.PGDD..........ILKE.YLGy.............................................gGERFKYLRA............L....ACFY...V.....RLTRP........................AKEV....YETL.E.....PYLEDGR.KLRRRGRQG...................-----....-TSLTFVDQFVDE.LL.......TKERICA..T..SLWKMPKREVLEDL-e...................................................................
D8LWY4_BLAHO/35-198                  .................................................v-PINGNAESFNLGDIMVSNIMES.RYFF-KVLDLT.......................................D........IEEVINEIKRE..VHDLEP..............LVIG.SSR...........................................HP.SSAFCILYKL.SRMR.ITYQ..........ELSE.LIH...............................................CLDNSYVRG............I....GYLY...I.....RFAIA........................PREL....WKFY.A.....PYFDDNT.SLVP-----...................----F...sDKTPTTIGRFVTG.LI.......TNKRYQT..V..MLPTIPIVVK-----rdwe................................................................
W2SQD8_NECAM/544-708                 .................................................h-TVRGTNPQFLIEKIIRQRIYDS.KYWKEYCFALS.......................................A........-DLVVDRALE-..LRYIGG..............-IYA.GNV...........................................KP.TPFLCLSLKM.LQIQ.PEKD..........IIIE.FIQ...............................................QEQSKYARA............L....GAMY...L.....RLTFT........................SVEI....YKYL.E.....PLFNDYR.KLRYMNKQG...................-----....RFELVYMDEFIDN.LL.......REERYCD..I..QLPRLQV--------caywhtd.............................................................
E2A1P6_CAMFO/10-175                  ..................................................KSIRGTNPQYLVEKIIRSRIYDS.KYWKEECFALT.......................................A........-ELLVDKAME-..LRFLGG..............-VYG.GNV...........................................KP.TPFLCLILKM.LQIQ.PEKD..........IIVE.FIK...............................................NEEFKYVRA............L....GALY...M.....RLTGS........................SLDC....YKYL.E.....PLFNDNR.KLRIQNKQG...................-----....VFELIHMDEFIDH.LL.......REERCCD..V..ILPRIQKRYVLEEN-n...................................................................
Q2H4I5_CHAGB/105-167                 ............................................yprlwr-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....----...-.....-----........................----....-REV.Q.....PFLEDRR.KLRRKGRDG...................-----....-TTLTYMDVFVDD.LL.......TKDRVCA..T..SLWKMRKRDILEDL-e...................................................................
D6X552_TRICA/24-208                  .................................................l-PLWGNERTMNLNPLILTNIQSS.HYFKVNLYELK.......................................T........YHEVVDEIYYK..VNHLEP..............WEKG.SRRtsgqtgmcg.........................gvrgvgaggIV.STAYCLLYKL.FTLK.LTRK..........QLNG.LIN...............................................HCDSPYIRA............L....GFMY...I.....RYTLP........................PKDL....LEWY.E.....DYLEDEE.---------...................ELDVKa..gGGQMMTIGTMLRQ.WL.......VKLEWFS..T..LFPRIPVPIQQKIQ-k...................................................................
C5JEY9_AJEDS/20-214                  ................................................pl--IRGANPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTYIGG..............-TYG.LAQ...........................................KP.TPFLCLAFKL.LQLA.PEKD..........IVLE.YLNfhdpenerveggegn.................gleeeqdandgvvkaVGDFKYLRA............L....AAFY...I.....RLTFD........................AADI....YRTL.E.....PLLVDYR.KLKRRTKDG...................-----....-FMLTYIDQFVDD.LL.......TKDRVCG..T..SLWKLPSRTQLEDL-d...................................................................
A0A022V6K5_TRIRU/20-222              ................................................pl--IRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTYIGG..............-TYG.VGQ...........................................KP.TPFLCLAFKL.LQLA.PEKE..........VILE.YLNfhdpeadeedlkvrgdstd.........adggagdaqdradaailkaTGDFKYLRA............L....AAFY...I.....RLTFE........................PVEI....YKTL.E.....PLLTDYR.KLKRRTKEG...................-----....-FLLTYMDQFVDD.LL.......TKDRVCG..T..SLWKIPTRTILEDL-d...................................................................
L5LMJ2_MYODS/10-175                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKGECFGLT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FKK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSPNRNG...................-----....EFELMHVDEFIDD.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
Q4E0F0_TRYCC/9-176                   ................................................wn--LKGRSAVAALDPSTRHRIMQS.HAMASSFHKPL.......................................L........-ATLEVLITP-..-QYVGG..............-LTG.PLQ...........................................KP.EPFICHVTRL.LQIT.PDPS..........IVLA.MLH...............................................QDVHKYLRV............A....ALFI...I.....RLIGN........................EAMM....REAM.R.....VGWEDYR.KIRVYGYVE...................-----....-------------.--.......-------..-..---------------dlagtidskennapdeeegfvrapaygimcvdeitdrlfnv...........................
W4FTM1_9STRA/9-142                   .................................................f-SVHGVNPQHLVEKILRNRIYDS.MYWKEQCFGLT.......................................A........-ETLVDKAIE-..LTHIGG..............-HFG.GNQ...........................................QP.TPFLCLLLKM.LQIQ.PDME..........IVVE.FIK...............................................NGDYKYVTM............L....GAFY...L.....RLVGK........................PTDV....YPIL.E.....ELLADYR.KIRKRNTLG...................-----....-------------.--.......-------..-..---------------pslvhl..............................................................
Q4N1F2_THEPA/1-29                    ..................................................-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....----...-.....-----........................----....----.-.....-------.---------...................-----....------MGEYVES.LL.......MEDKYYH..T..ILPRLPVRVK-----nl..................................................................
T1K3B4_TETUR/10-175                  ..................................................KSIHQTNPQYLVEKIIRGRIYES.RFWKEDCFGIN.......................................E........-ESLVDKATE-..LKYIGG..............-IYG.GNI...........................................KP.TPFMCLILKM.LQIQ.PHKD..........ITIE.FIK...............................................QPHFKYARA............L....GAYY...L.....RLTAV........................SLDV....YKYL.E.....PLYADYR.KLRYIDRMG...................-----....KFSIIHMDEFIDM.LL.......REDRVFD..V..ILPRIKARRIHEEN-d...................................................................
H2WNF1_CAEJA/10-112                  .................................................k-TVKGTNPQFLVEKIIRQRIYDS.MYWKEHCFALT.......................................A........-ELVVDKGMD-..LRYIGG..............-IYA.GNI...........................................KP.TPFLCLALKM.LQIQ.PDKD..........IVXX.---...............................................---------............-....----...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------xxxxxpyrvsashddrrdrrdkk.............................................
C0NU08_AJECG/20-213                  ................................................pl--IRGVNPATLFEKAVRDRITES.YYWKEQCFGLN.......................................A........-ATLCDRAAE-..LSYIGG..............-TYG.LAQ...........................................KP.TPFLCLAFKL.LQLA.PEKE..........IVLE.YLNfhdpenghvegsem..................ngleeeqggasvvkaVGDFKYLRA............L....AAFY...I.....RLTFD........................AADI....YKSL.E.....PLLTDYR.KLKRRMKDG...................-----....-FVLTYIDQFVDD.LL.......TKDRVCG..T..SLWKLPSRHQLEDL-d...................................................................
W4GRF9_9STRA/57-221                  .................................................l-PIHGNQTTYNFNTLLYDNVMNS.DYFR-KLYELA.......................................T........YHEVVDEIYYR..VDHAEP..............WAAG.TSR...........................................IP.STCFCLLMKF.CTMR.LTVN..........QMQG.LLK...............................................HVDSPFIRC............V....GFLY...L.....RYTCD........................PELL....WEWY.E.....PFLDDEE.---------...................EFNASs..nDAILTTMGAWIRS.LL.......EDLNYFN..T..ILPRIPKKIQ-----dgik................................................................
F2D6U3_HORVD/3-165                   ..............................................lqts----GRPIEVLMEKVLSMNIVSS.DYFK-ELYKIK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKL.FTMK.LTVN..........QMHG.LLK...............................................HPDSPYIRA............I....GFLY...L.....RYAAD........................PKTL....WTWY.E.....PYIQDDE.---------...................EFSPG...sNGKMTTMGVYVRD.VI.......LGQYYFD..S..LLPRVPL--------lilrqv..............................................................
U6Q036_HAECO/10-175                  .................................................h-TVKGTNPQFLVEKIIRQRIYDS.KYWKESCFALS.......................................A........-DLIVDRALD-..LRYIGG..............-IYA.GNV...........................................KP.TPFLCLALKM.LQIQ.PEKD..........IIIE.FIQ...............................................QEQSKYARA............L....GAMY...L.....RLTFS........................SVEI....YKYL.E.....PLFNDYR.KLRYMNKLG...................-----....RFELVYMDEFIDN.LL.......REERYCD..I..QLPRLQKRQALEDA-g...................................................................
S7NNI0_MYOBR/1-75                    .................................................m-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.----------.----.----..........----.---...............................................---------............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....LLYNDYR.KIKNQNQNG...................-----....EFELMHVVEFIDE.LL.......HSERVCD..I..ILPWLQKCYMLEEA-e...................................................................
T5BSA3_AJEDE/20-214                  ................................................pl--IRGANPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTYIGG..............-TYG.LAQ...........................................KP.TPFLCLAFKL.LQLA.PEKD..........IVLE.YLNfhdpenerveggegn.................gleeeqdandgvvkaVGDFKYLRA............L....AAFY...I.....RLTFD........................AADI....YRTL.E.....PLLVDYR.KLKRRTKDG...................-----....-FMLTYIDQFVDD.LL.......TKDRVCG..T..SLWKLPSRTQLEDL-d...................................................................
B8MD54_TALSN/20-183                  ................................................pl--VRGVNPVTLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAIE-..LTSIGG..............TIVL.EYL...........................................NF.TDPGS----G.DEEN.PEDT..........EING.EVVk.............................................gRGDFKYLRS............L....AAFY...I.....RLTFE........................AAEI....YKYL.E.....PLLLDYR.KLKRRMREN...................-----....-YVLTTMDQFIDD.LL.......TKDRVCA..T..SLWKLPSRQMLEDL-d...................................................................
C1E4N5_MICSR/10-173                  ...............................................tgr----DNGKSYNMERVLRSNILNS.DYFV-QLSKIE.......................................D........FMDLVDEIYNE..VDHVEP..............WMSG.NAR...........................................GP.STAFCLLYRL.FTME.LDDR..........NVNH.LIR...............................................HRDSPYIRA............I....GFLY...V.....RYVRD........................PKEF....GRWF.D.....PFFKDDE.---------...................EFAPM...pGGKNVTIGAFVRD.LV.......LDQYYFE..T..IFPRCPEVT------rralvd..............................................................
M7YZV4_TRIUA/3-177                   ..............................................lqts----GRPIEVLMEKVLSMNIVSS.DYFK-ELYKIK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKL.FTMK.LTVN..........QMHG.LLK...............................................HPDSPYIRAvtlmeysyflqqI....GFLY...L.....RYAAD........................PKTL....WTWY.E.....PYIQDDE.---------...................EFSPG...sNGKMTTMGVYVRD.VI.......LGQYYFD..S..LLPRVPL--------lilrqv..............................................................
F7GLK3_MONDO/52-236                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
F2EBP1_HORVD/3-150                   ..............................................lqts----GRPIEVLMEKVLSMNIVSS.DYFK-ELYKIK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKL.FTMK.LTVN..........QMHG.LLK...............................................HPDSPYIRA............I....GFLY...L.....RYAAD........................PKTL....WTWY.E.....PYIQDDE.---------...................EFSPG...sNGKMTTMGVYVRD.VI.......L------..-..---------------gqvyl...............................................................
G8F4J3_MACFA/47-231                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
B9W9B9_CANDC/17-194                  ..............................................dkry----TINKSNLIEPIIRHRIQDS.LFYKQYLYLSN.......................................E........-ATLLPIIIEH..VHYIGG..............--TD.SSN...........................................RP.STFISCLFRM.LELE.PSKE..........IIKT.YLTq............................................ldFNEFKYLTA............L....TLIY...I.....RLTYP........................SQEV....YSIF.D.....QYFQDFR.KLRIKLKTPi.................fD--SQklpiHYKLTFLDEWVDA.LL.......VNERVID..L..ILPRLIPRTILV---erg.................................................................
B8AYN3_ORYSI/3-166                   ...............................................iqt---SGKPIDLLMEKVLCMNIMSS.DYFK-ELYRLK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HPDSPYIRA............I....GFLY...L.....RYVAD........................PKIL....WTWY.E.....PYLKDDE.---------...................EFSPG...sNGRMTTMGVYVRD.LI.......LGQYYFD..S..LLPRVPLPV------irqvt...............................................................
E9BER6_LEIDB/4-144                   ........................................nlkgraaias-----------LDPPTRYRVLHS.HTMT-RCASKP.......................................L........-LWVLEELIT-..LRYLGG..............-LSG.PLH...........................................TA.NYFICLVVRL.LQIC.PSVA..........IVRV.MLE...............................................QDVHKYLRA............A....ALLI...I.....RLIGN........................VELQ....REAM.R.....VGWSDYR.KLCLYGSDP...................-----....-------------.--.......-------..-..---------------aqelaestsntaaga.....................................................
E2QU96_CANFA/10-175                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
W8CCF0_CERCA/1-69                    ..................................................-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....--MY...L.....RYTQP........................PADL....YDWY.E.....DYLQDEE.---------...................EIDVKa..gGGQVITVGQMVYQ.FL.......TKLDWFS..T..LFPRIPVPIQKQIE-k...................................................................
A0A022WWU5_TRIRU/20-222              ................................................pl--IRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTYIGG..............-TYG.VGQ...........................................KP.TPFLCLAFKL.LQLA.PEKE..........VILE.YLNfhdpeadeedlkvrgdstd.........adggagdaqdradaailkaTGDFKYLRA............L....AAFY...I.....RLTFE........................PVEI....YKTL.E.....PLLTDYR.KLKRRTKEG...................-----....-FLLTYMDQFVDD.LL.......TKDRVCG..T..SLWKIPTRTILEDL-d...................................................................
B3LIF1_YEAS1/15-219                  ..................................................KQLNNQSVSLVIPRLTRDKIHNS.MYYKVNLSNES.......................................Lrg....ntMVELLKVMIGA..FGTIKGqng.......hlhmMVLG.GIE...........................................--.--FKCILMKL.IEIR.PNFQ..........QLNF.LLNvk..........................................nenGFDSKYIIA............L....LLVY...A.....RLQYYylngn.............nkndddENDL....IKLF.Kvq.lyKYSQHYF.KLKSFPLQVdc...............faHSYNE....ELCIIHIDELVDW.LA.......TQDHIWG..I..PLGKCQWNKI-----ynsde...............................................................
F7ISR6_CALJA/47-92                   .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIY--..------..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....----...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------fk..................................................................
C5LME5_PERM5/21-137                  ...............................................lql----TNTTTYNYPQMLHQQLAKS.AYYH-SIQPLD.......................................T........PEAIIDEIKTR..CKDAEP..............YAPG.SHT...........................................AP.STMFCCLYRL.FVMR.INSK..........VLGQ.LIN...............................................YHGAPYVRC............A....GFLY...V.....RFGLS........................PRDY....WSFL.Q.....PHL----.---------...................-----....-------------.--.......-------..-..---------------l...................................................................
K8EY77_9CHLO/10-176                  ..................................................KSVRGTNPQNMMEKITRDKVYAM.TFWKEKCFAVS.......................................A........-ETLVDLAVTD..LTQIGG..............-IYG.GNN...........................................RA.TEFLCLALKM.LQIA.PERE..........IVIE.FIK...............................................NEDHKYARL............L....GAFY...L.....RLVGN........................SAEV....YRYL.E.....PLLNDYR.KVRRRVKSG...................-----....GCELTTVDAFIDE.LL.......TKDFCCD..I..ALPRLAKRFALEA--tg..................................................................
G3NPB2_GASAC/10-174                  .................................................n-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LKYVGG..............-VFG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKNVRL............L....GAMY...M.....RLTGT........................AVDC....YKYL.E.....PLYNDYR.KEKNQNRNG...................-----....EFELMHVDEFIDE.LL.......HAERMCD..I..ILPRLQR-HVLEE--ae..................................................................
W5QC53_SHEEP/39-223                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
J4G8D4_FIBRA/10-193                  .................................................q-AIHGQNPQFLVETVIRNRIYES.PYWKEHCFALTgmhilmyarn...................trdglmnefpA........-ETLIDKALE-..LNSIGG..............-VYG.-NQ...........................................KP.TEFLCLLLKL.LQIQ.PEKE..........ILLE.YLR...............................................ADEFKYMRA............L....AAIY...I.....RMTFT........................SIDV....YEIL.E.....PLLKDYR.KLRYRGMNG...................-----....-YSLTHMDEFVDN.LL.......IDERVCD..I..ILPRLTKRDVLEDNQ....................................................................
F7VQJ3_SORMK/24-191                  ...............................................lap---NGLNPATIMEKAVRERIIDS.YFYKEQCFGVN.......................................E........-ADIVDRVVEH..VDYIGG..............-VAG.TVQ...........................................KP.TPFLCLAFKL.LQLA.PSDD..........ILNE.YLQf.............................................gGEKFKYLRA............L....ALFY...I.....RLTRK........................DHDV....YKTL.E.....PFLEDRR.KLRRKGRNG...................-----....-TSLTYMDVFVDD.LL.......TKDRVCA..T..SLWKMRKRDILEDL-d...................................................................
H2N6K2_PONAB/47-231                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
L1LC98_BABEQ/10-175                  ................................................nm--VHGTNPQYLFSKIMRDKVYNS.IYWKESCFGLT.......................................S........-ESIIDKAIE-..IEYIGG..............-TFG.GNR...........................................QP.SPFICLVLKL.LQIQ.PELD..........IVEE.YIK...............................................NEDYKYLRA............L....GVYY...L.....RLVGD........................PVRV....YKTL.E.....PLLSDYR.RLRFRGPDG...................-----....SYTIKHMDEFVDD.CL.......RSSTYLD..V..DLPPLAKRINLENS-n...................................................................
K7VH92_MAIZE/1-55                    .................................................m-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....----...-.....-----........................----....--WY.E.....PYLRDDE.---------...................EFSPG...sNGRKTTMGVYVRD.LI.......LGQYYFD..S..LLPRIPLPVTRQ---ita.................................................................
F4P219_BATDJ/9-173                   ..................................................KNIHGTNPQFLIEKILRERIYES.AYWKEKLFGVS.......................................A........-ETLLDRAVE-..LQAIGG..............-QFG.S-Q...........................................KP.TEFICLALKI.LQLQ.PDDE..........IITL.FLT...............................................NSDFKYLTA............L....AAFY...I.....RLTES........................HSQV....YRRL.E.....PLLQDRR.KLRRRTNVG...................-----....GYELTFMDQFISD.LL.......LEDRMCD..T..ILPRLTKRYILEDQ-g...................................................................
G2PZZ7_THIHA/24-191                  ...............................................lap---NGLNPATIMEKAVRERIVES.YFFKEQCFGVN.......................................E........-ADIVDRVVEH..VDHVGG..............-VTG.TSQ...........................................RP.TPFLCLAFKL.LQLA.PGDD..........ILDE.YLHf.............................................gGDKFKYLRA............L....AAFY...I.....RLTRP........................DRDV....YIRL.E.....PFLEDRR.KLRKKGRNG...................-----....-TTLTYMDEFIDD.LL.......TKDRVCS..T..SLWKMRRRDILEDL-d...................................................................
G3MKB7_9ACAR/10-175                  .................................................h-SVRGTNPQYLVEKIIRSRIYDS.RYWKEECFALT.......................................A........-ELLVDKAME-..LRFIGG..............-VYG.GNV...........................................KP.APFLCLLLKM.LQIQ.PEKD..........IVVE.FIR...............................................QDEFKYVRA............L....GANY...M.....RLVGS........................SLDC....YKYL.E.....PLYNDYR.KLRRQNRDG...................-----....AYVVVHMDEFIDE.LL.......REERVAD..I..ILPRIQKRQVLEEN-g...................................................................
E2LWB8_MONPE/10-120                  ...kaihgqnpqklsfetvstnrtigrniasllqasltilsarpeshgkr-----------------------.-----------.......................................T........AESLIDKAIE-..LKCIGG..............-VYG.N-Q...........................................RP.TEFLCLLLKL.LQIQ.PEKE..........ILIE.YLQ...............................................ADEFK----............-....----...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------cdyivlssfv..........................................................
A0A044QM65_ONCVO/10-175              ................................................vt--VKGTNPQYLVEKIIRTRIYDS.KYWKEECFALT.......................................A........-ELLVDKGME-..LRYIGG..............-IYA.GNV...........................................KP.TPFLCLCLKM.LQIQ.PEKD..........IAVE.FIR...............................................QEEYKYIRA............L....GAMY...I.....RLTFT........................SIEV....YKYL.E.....PLYNDYR.KLRMMNNEG...................-----....RFEIVHMDEFIDN.LL.......REERYCD..I..HLPRIQKRITLEE--vg..................................................................
E9EAI6_METAQ/24-191                  ...............................................lap---NGLNPATIMEKAVKDRIVES.YFYKEQCFALN.......................................E........-ADIVDRVVEH..VSFVGG..............-THG.DAQ...........................................KP.SPFLCLAFKL.LELG.PSED..........VVRE.YLSy.............................................gGEHFKYLRA............L....ACFY...Y.....RLTRK........................AADV....YRTL.E.....PFLDDRR.KLRRKGRRG...................-----....-TSLTYVDDFVDD.LL.......TRERVCA..T..SLWKMPPREILEDL-d...................................................................
W9QWY7_9ROSA/10-174                  ..................................................KSIRGTNPQNLVEKIVRSKIYQN.TYWKEQCFGLT.......................................A........-ETLVDKAME-..LDHVGG..............-TFG.GNR...........................................KP.TPFMCLVMKM.LQIQ.PEKE..........IVIE.FIK...............................................NDDYKYVRV............L....GAFY...L.....RLTGS........................DTDV....YQYL.E.....PLYNDYR.KIRRKLADG...................-----....NFSLTHVDEVIDE.LL.......TKDYSCD..I..ALPRIKKRWTLE---si..................................................................
G1LCH7_AILME/47-231                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
K3VWG0_FUSPC/25-192                  ...............................................vap---NGLNPATIMEKAVRDRIVDS.IYYKMQCFACN.......................................E........-ADIVDRVVED..VKFIGG..............-TYG.TTQ...........................................VP.SPFLCLAFKL.LELS.PSDA..........VLLE.YLKf.............................................gGEAFKYLRA............L....ACFY...F.....RLTRQ........................AKNV....YEML.E.....PFLEDRR.KLRRRGREG...................-----....-VKLSYMDEFVDD.LL.......TKERVCG..T..SLWKMPKREVLEDL-e...................................................................
C4YCT7_CANAW/17-194                  ..............................................dkry----TINKSNLIEPIIRHRIQDS.LFYKQHLYLSN.......................................E........-ATILPIIIEH..VHYIGG..............--TD.SSN...........................................RP.STFISCLFRL.LELE.PSKE..........IIKT.YLTq............................................ldFNEFKYLTA............L....TLIY...I.....RLTYP........................SQEV....YSIF.D.....QYFQDFR.KLRIKLKTP...................VFDSQklpiHYKITFIDEWVDT.LL.......VDERVID..L..MLPRLIPRTTLVE--rg..................................................................
K7IUN1_NASVI/10-175                  ..................................................KSIRGTNPQYLVEKIIRSRIYDS.KYWKEECFALT.......................................A........-ELLVDKAME-..LRFIGG..............-VFG.GNI...........................................KP.TPFLCLILKM.LQIQ.PEKD..........IIVE.FIK...............................................NEEFKYVRA............L....GAFY...M.....RLTGT........................SLDC....YRYL.E.....PLLNDYR.KLRKQNRQG...................-----....QFEIIHVDEFIDD.LL.......RAERCCD..I..ILPRIQKRHVLEEN-n...................................................................
V2XVC5_MONRO/10-173                  ..................................................KAIHGQNPQFLVETVIRNRIYES.SYWKEHCFALT.......................................A........-ESLIDKAIE-..LKCIGG..............-VYG.N-Q...........................................RP.TEFLCLLLKL.LQIQ.PEKE..........ILIE.YLQ...............................................ADEFKYLRA............L....AAMY...I.....RMTFG........................AAEV....YQIL.E.....PLLKDYR.KLRLRNMTG...................-----....-YILTFMDEFVDS.LL.......TEERVCD..I..ILPRLIKRQVLEEN-g...................................................................
C3ZRP3_BRAFL/7-191                   .................................................l-PLWGNDKTMNLNSLILTNIQSS.PYFKNDLFQLK.......................................T........YHEVIDEIYYK..VQHLEP..............WEKG.SRNtggqtgmcg.........................gvrgvgaggIV.STAYCLLYKL.FTLK.LTRK..........QVNG.LLQ...............................................HGDSPYIRG............L....GFMY...I.....RYTQP........................PADL....WEWY.E.....PYIDDDE.---------...................ELDVKa..gTGCMMTVGEMLRS.FL.......GKIEWFS..T..LFPRIPVPIQKD---leg.................................................................
B0EVD9_ENTDS/7-169                   .................................................l-PTQGNTRTMNIDSILFTNIIHS.DYMFKTLGSIH.......................................S........ISDLIDIIIND..VHYISP..............YIQK.SSS...........................................SP.STAFCVLLRL.FQLN.PTPD..........DIRM.MST...............................................H-SNKYVRC............I....AALI...I.....RYSIQ........................FNLL....LSYL.K.....PFVDDRA.-VVNISLHG...................-----....-EKTKQIKCLVKD.LI.......LEPKFEG..C..ILPRIPQ--------vyykp...............................................................
D0NHN2_PHYIT/9-173                   .................................................q-SVHGVNPQTLVEKIMRNRIYAS.IYWKEQCFGLT.......................................A........-ETLVDKAVE-..LQEFGG..............-TFG.GNQ...........................................QP.THLLCLLLKM.LQLQ.PELE..........VVKQ.FIE...............................................NEDYKYVTV............L....GAVY...L.....RLVGK........................PLEV....YTLL.E.....PLLSDYR.KIRKRNVIG...................-----....-WEITHVDEIADA.LL.......NEEYYID..L..ALPRLVERELLEKS-d...................................................................
S4PIQ1_9NEOP/10-175                  ..................................................KSIRGTNPQYLVEKIIRSRIYDS.KYWKEECFALT.......................................A........-ELLVDKAME-..IRYVGG..............-VHG.GFI...........................................YP.TPFLCLVLKM.LQIQ.PEKD..........IVVE.FIK...............................................NEEFKYVRA............L....GAFY...M.....RLTGS........................SLDC....YKYL.E.....PLYNDNR.KLRRQNREG...................-----....QFEIIHMDEYIDE.LL.......REERLCD..V..ILPRIQKRHILEEN-n...................................................................
L7IN74_MAGOY/23-190                  ...............................................lap---NGLNRARIMEKAVVDRITES.YFWKEQCFGVN.......................................E........-ADIVDRVVDH..VTYIGG..............-VVG.QSQ...........................................KP.TPFLCLAFKL.LQLG.PDDS..........ILAE.YLKf.............................................gGEKFKYLRA............L....AIFY...V.....RLTRT........................SADV....FRTL.E.....PFLEDRR.KLRRKGRAG...................-----....-TSLTYMDEFADD.LL.......TKDRVCA..T..SLFKLTRRDVLEDL-d...................................................................
M7WFG7_ENTHI/7-169                   .................................................l-PTQGNTRTMNIDSILFTNITHS.DYMFKTLGSIH.......................................S........ISDLIDIIIND..VHYISP..............YIQK.SSS...........................................SP.STAFCVLLRL.FQLN.PTPD..........DIRM.MST...............................................H-SNKYVRC............I....AALI...I.....RYSIQ........................FNLL....LSYL.K.....PFVDDRA.-VVNISLHG...................-----....-EKTKQIKCLVKD.LI.......LEPKFEG..C..ILPRIPQ--------vyykp...............................................................
A8PRE0_MALGO/10-174                  .................................................q-AIHGTNPQFLVERVIRSRIYDS.TYWKQDCFALN.......................................A........-ATLIDKAVD-..LTYVGG..............-TYG.AQR...........................................-P.SPFLCLILKL.LQIQ.PERA..........IVLE.YLA...............................................AEDFKYLRA............V....AALY...V.....RLTFP........................AIEV....YELL.E.....PMLNDYR.KLRWRDMAG...................-----....NYSLTHMDEFIDQ.LL.......TEERVCE..L..ILPRLTKRSVLESN-d...................................................................
PRP38_SCHPO/14-177                   ...............................................eaa---HEMLPTFLIGKILRERIVDS.IYWKEQCFGLN.......................................A........-CSLVDRAVR-..LEYIGG..............-QYG.N-Q...........................................RP.TEFICLLYKL.LQIA.PEKE..........IIQQ.YLS...............................................IPEFKYLRA............L....AAFY...V.....RLTWD........................DVEV....HQTL.E.....PLLRDYR.KLRIRTNSE...................-----....-IRLTYLDEVVDD.LL.......NAEVVCD..I..SLPPLRSRLQLEDL-d...................................................................
W7AJL3_PLAVN/162-324                 ...............................................iem----TNTSTYNVNNLLRNNILSS.EYFR-SLISLK.......................................T........FKEVLDEILSY..ADHVEP..............YCIG.STR...........................................AP.STLFCCLYKF.FTMQ.LTKK..........QLKS.LID...............................................NKESCYVRA............C....GFLY...L.....RYVHC........................PSNL....WMWF.E.....PYMLDDD.---------...................EFTVSa..dKRKLMTIGEYVQS.LL.......YDDKYFN..T..VLPRLPIKIK-----niy.................................................................
G4V8E6_SCHMA/26-210                  .................................................l-KLWGNPQTMNLNTMIYTNIVQS.PYFKANLVELK.......................................T........YHEVIDEIYYK..VEHLEP..............WERG.SRRigvqtgmcg.........................gvrgvgaggIV.STAYCLLYKL.FTLK.LTRK..........QLKG.LLD...............................................HPDSPYIRA............L....GFMY...I.....RYCIP........................PEDF....WWWY.S.....PYWSDSE.---------...................ELDVKa..gGGCIMTIGNMLEH.WL.......TKLDWFS..T..LFPRIPVPVQKK---lee.................................................................
Q5CUQ1_CRYPI/3-168                   ..............................................neqn----SHHKLFSVSSILRDRVFSS.IYWKGECFALD.......................................S........-ETILDKAVL-..LDYIGT..............-TYG.GDR...........................................KA.TPFLCLLVKL.LQIR.PSTE..........IVLE.YIN...............................................NPRFKYLTA............L....GIVY...L.....RLTES........................SIVI....HKSI.E.....HLYQDYR.RIRIRNLDG...................-----....SFDIIHLDELVEI.CL.......CEKKFLD..L..DFPYIHKRAVLVK--qg..................................................................
I2H5J2_TETBL/16-213                  ..................................................KQLNHQSVSLVIPRLTRDKIHSA.LYYKVNLQDPS.......................................Mrg....ntLLGLNNVIIRD..LGTLNNesi........nkkNVLG.GVE...........................................--.--FKCILMKL.VELR.PTIE..........QLDI.ILEisd.........................................atgEFNNKYIIA............L....ILVY...L.....RIQYYyane................tsdeAKRF....KALF.Q.....QYINDYR.KMKAISLNIdc...............wsQSQII....TVELIHMDELVHW.LS.......AKDNIWG..I..PLGKCSWCNILED--fs..................................................................
W2LCN0_PHYPR/37-201                  .................................................l-PIYGNDTTYNLNTLLHQNILQS.AYFH-ELYKFR.......................................T........YHEVVDEIYYR..VDHAEP..............WSPG.TAR...........................................IP.SSCFCLLHKF.LLMR.LTRK..........QMQG.LLR...............................................HTDSPYIRA............V....GFLY...L.....RFTCD........................PEEL....WTWF.E.....PFLEDPE.---------...................EFNASa..nPSVKTTIGEWLIS.LL.......EENNYFG..T..ILPRIPKKIE-----dgik................................................................
C7YSE8_NECH7/25-192                  ...............................................map---NGLNPATIMEKAVKDRIVDS.YFYKEQCFALN.......................................E........-ADIVDRVVEH..VSFIGG..............-TYG.VTQ...........................................KP.SPFLCLAFKL.LELA.PSDA..........VMHE.YLHy.............................................gGDEFKYLRA............L....ACFY...F.....RLTRQ........................AKDV....YEML.E.....PFLEDRR.KLRRRGRDG...................-----....-VALTYMDEFVDD.LL.......VKDRVCG..T..SLWKMPKRETLEDL-e...................................................................
I7APR0_ENCRO/2-164                   ..............................................qykg-----------INRMTREKILSS.EEFK-NMRSFT.......................................E........-PDVVGSICS-..LNSIGG..............LIKG.---...........................................IP.HKFLCLIQKM.GAIS.MKEE..........VVAT.SLEdlrpsepg...............................pldssmkvFRGNVYFIA............A....SLMY...L.....RLSKR........................FHEY....KPLV.R.....SFLMDFR.KIPIIDGQN...................-----....NKEFIYLDVFADD.LL.......NKNRIFN..V..HLNR-----------tc..................................................................
S7MIS8_MYOBR/56-199                  ...............................................gsq-----------------------.-----------.......................................-........--------VE-..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
W4ZDU0_STRPU/160-344                 .................................................l-PLWGNQVSMNLNPLILTNIQSS.PYFKNDLFKLK.......................................T........YHEVIDEIYYK..VAHLEP..............WERG.SRQtsgqigmcg.........................gvrgvgaggIV.SSAYCLLYKL.YTLK.LTRK..........QLNG.LLT...............................................HSDSSYIRA............L....GFLY...I.....RYSQP........................PQDL....WDWY.E.....EYLNDEE.---------...................EVDTKa..gGGNCIPIGQMLMH.FL.......VKLEWHS..S..LFPRIPVPVMKDI--er..................................................................
S3DD72_GLAL2/21-188                  ...............................................lap---NGLNPATIMEKPVRERIIDS.YFWKDQCFAVN.......................................E........-ADIVDRVVTH..VKFIGG..............-TYG.DAQ...........................................RP.SPFLCLAFKL.LQLG.PGDD..........ILRE.YLEy.............................................gGEKFKYLRA............L....ACFY...I.....RLTRQ........................AKDV....YLFL.E.....PYLEDRR.KLKQKKRMG...................-----....-TALTYMDQFVDD.LL.......EKDRICA..T..TLWKMPKREVLEDL-e...................................................................
A9P852_POPTR/3-167                   ................................................vq--TNGKPIDSLFEKVLCMNILSS.DYFK-ELYRLK.......................................T........YHEVIDEIYNQ..VDNVEP..............WMTG.NCR...........................................GP.STSFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HKDSPYIRA............V....GFLY...L.....RYAGD........................PKTL....WNWF.E.....PYIKDDE.---------...................EFSPG...sSGRKTTIGIYVRD.LL.......LGQYYFD..T..LFPRIPVPVLR----qita................................................................
A0A022U9J0_9EURO/20-222              ................................................pl--IRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTYIGG..............-TYG.VGQ...........................................KP.TPFLCLAFKL.LQLA.PEKE..........VILE.YLNfhdpeadeedsntrgdsad.........adggaddaqdradaailkaTGDFKYLRA............L....AAFY...I.....RLTFE........................PVEI....YKTL.E.....PLLTDYR.KLKRRTKEG...................-----....-FLLTYMDQFVDD.LL.......TKDRVCG..T..SLWKIPTRTMLEDL-d...................................................................
A0C3P9_PARTE/86-247                  .................................................i-PIRGENAISNMNSLVRQNILTC.PYYK-ELLQIR.......................................D........INDIVTETDKI..VTSVGT..............WA--.GPG...........................................VP.SSFFCILHKL.MSMN.LNVK..........QLQI.LCD...............................................WKLNPYVRC............L....GLLY...L.....RYSLD........................PNFL....WGWM.K.....RYILDEQ.---------...................EFKPS....KDEDITIGDFCER.LL.......TDLNYYN..T..RLPRIPQQIDT----iiqa................................................................
A0A024TF87_9STRA/1-98                ..................................................-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.-------MKF.CTMR.LTIN..........QMQG.LLK...............................................HVDSPYIRC............V....GFLY...L.....RYTCD........................PELL....WEWY.E.....PYLGDDE.---------...................EFNASs..nDAIRTTMGAWIRS.LL.......EDINYFN..T..ILPRIPKKIQ-----dgik................................................................
W7FGB7_PLAFA/173-328                 ...............................................lem----TNTTTYNVNTLLRNNILSS.EYFK-SLIPIK.......................................T........FKEVVDEIHSY..ADHVEP..............YCIG.SNR...........................................AP.STLFCCLYKF.FTMQ.LSEK..........QLKS.LIE...............................................NKDSCYIRA............C....GFLY...L.....RYVHS........................PANL....WMWF.E.....PYLLEED.---------...................EFSISc..dKRRKVTIGEYVQS.LL.......SDDKYFN..T..---------------gtyicv..............................................................
G0S1D3_CHATD/24-191                  ...............................................lap---NGLNPATIMEKAVRERIVES.YFWKEQCFGVN.......................................E........-ADIVDRVVEH..VRFVGG..............-VTG.VTQ...........................................KP.SPFLCLAFKL.LQLA.PGDD..........ILKE.YLYf.............................................gGEKFKYLRA............L....AAFY...I.....RLTRP........................DKEV....YTLL.E.....PFLEDRR.KLRRKGKNG...................-----....-TSLTYMDEFIDD.LL.......TKDRVCS..T..SLWKMRRRDILEDL-d...................................................................
H9JEJ8_BOMMO/23-207                  .................................................l-PIWGNEQTMNLNPLILANIQGS.SYFKVHLFKLK.......................................T........YHEVVDEIYYQ..VKHLEP..............WERG.SRKtsgqtgmcg.........................gvrgvgaggIV.STAFCLLYKL.YTLR.LTRK..........QVNG.LLQ...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PADL....FDWY.V.....DYFEDEE.---------...................EVDPRa..gGGASTTIGALVRQ.ML.......VKLDWFS..T..LFPRIPVPIQKQIE-q...................................................................
E3QPI7_COLGM/24-191                  ...............................................lap---NGENPATIMEKAVRERIIDS.YFYKEQCFAVN.......................................E........-ADIVDRVVEH..VSFIGG..............-TYG.VTQ...........................................KP.TPFLCLAFKL.LQLA.PSDA..........VLET.YLGf.............................................gGDKFKYLRA............L....ACFY...I.....RMTRK........................PRDV....YLLL.E.....PFLEDRR.KLRRKGRQG...................-----....-ASLTYMDDFVDD.LL.......TKTRVCA..T..SFRELPKRSDLVDL-d...................................................................
Q4GZ20_TRYB2/36-208                  ................................................wn--LKGRSAVAAFDPVTRHRILQS.QTMA-ACFHRP.......................................L........MATMEDLI-S-..VSYVGG..............-LSG.PLR...........................................KP.EPFICLIARV.LQIT.PNTA..........IVMA.MLR...............................................QDVHKYLRV............A....ALFI...I.....RLIGN........................GTAM....REAL.R.....IGWNDYR.KIRVYGSKD...................-----....-------------.--.......-------..-..---------------dctcetksqdgekadtnevegealvaapihaimcvdeitdrlfntg......................
K7GHE6_PELSI/10-175                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRYVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
W6UMV2_ECHGR/10-175                  .................................................h-TLHGTNPQYLVEKIIRSRIYEC.QFWKEHCFALT.......................................S........-ELLVDKAVE-..LKYIGG..............-TYG.GLT...........................................KP.TPFICLVLKM.LQIQ.PDKD..........IVIE.FIK...............................................QEDYKYARA............L....GAFY...L.....RLVGE........................SVEI....YKYL.E.....ALYNDFR.KLKQQDTTG...................-----....KFSIVRMDEFIDQ.LL.......NEERVCD..V..ILPRLQKRSVLEDN-n...................................................................
Q0DKA8_ORYSJ/3-101                   ...............................................iqt---SGKPIDLLMEKVLCMNIMSS.DYFK-ELYRLK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HPDSPYIRA............V....S---...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------slp.................................................................
J9EVG5_WUCBA/10-175                  ................................................vt--VKGTNPQYLVEKIIRTRIYDS.KYWKEECFALT.......................................A........-ELLVDKGME-..LRYIGG..............-IYA.GNV...........................................KP.TPFLCLCLKM.LQIQ.PEKD..........IAVE.FIR...............................................QEEYKYIRA............L....GAMY...I.....RLTFT........................SIEV....YKYL.E.....PLYNDYR.KLRIMNNEG...................-----....RFEIVHMDEFIDN.LL.......RDERYCD..I..HLPRIQKRITLEE--vg..................................................................
A0A044STF6_ONCVO/47-231              .................................................l-PLWGNTQTMNLNALVLENIIQC.TYYKNYLSETT.......................................G........FQQLTEEIYYS..VKHLEP..............WERG.TRKtqgmtgmcg.........................gvrgvgaggVV.STAFCLLYKL.FTIR.LSRK..........QLVS.MIN...............................................NSNSPYIRG............I....GFMY...I.....RFCQP........................PQDL....WAWM.E.....PYLDDEE.---------...................QIDPRs..gGGDVMAMAQVVKM.ML.......TKLDWYG..T..LFPRIPVPIQKEI--el..................................................................
C6TC14_SOYBN/4-165                   ..........................................qtcgrpid---------SLLEKVLCMNILSS.DYFK-ELYRLK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HLDSPYIRA............V....GFLY...L.....RYCAD........................PKTL....WNWF.E.....PYVKDDE.---------...................EFSPG...sNGRMTTMGVYVRD.LL.......LGQYYFD..T..LFPRIPVPV------lrql................................................................
L7ML70_9ACAR/10-175                  .................................................h-SVRGTNPQYLVEKIIRSRIYDS.RYWKEECFALT.......................................A........-ELLVDKAME-..LRYIGG..............-VYG.GNV...........................................KP.APFLCLLLKM.LQIQ.PEKD..........IVVE.FIR...............................................QDEFKYVRA............L....GANY...M.....RLVGS........................SLDC....YKYL.E.....PLYNDYR.KLRRQNRDG...................-----....VYVIVHMDEFIDE.LL.......REERVVD..I..ILPRIQKRQVLEES-g...................................................................
M0W6M8_HORVD/1-69                    ..................................................-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....----...L.....RLTGT........................VADV....YQYL.E.....PLYNDYR.KIRQKLSDG...................-----....KFTLTHVDEFIDE.LL.......TKDYSCD..T..ALPRIQKRWVLEA--sg..................................................................
PR38A_PONAB/10-175                   .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
G0NBD0_CAEBE/55-239                  .................................................l-PIWGNQVTMNLNTLVLENIRES.YYYKNNLVEID.......................................S........FQTLVEQIFYQ..VKHLEP..............WEKG.TRRlqgmtgmcg.........................gvrgvgaggVV.SSAYCLLFRL.FNLR.ISRK..........QLIS.MLN...............................................SRQSVYIRG............I....GFMY...I.....RYTQP........................PADL....WYWL.E.....PYLDDDS.---------...................EIDPRs..gGGDLMSFGQMVRT.MI.......NKLDWYG..T..LFPRIPVPIQKEID-e...................................................................
Q6C616_YARLI/15-178                  .................................................l-SIHGINPALLIEKIIRERIFET.LYWKELCFNLN.......................................A........-ATLCDRAAT-..LTAIGG..............-QY-.ANQ...........................................KP.TPFLCLVFKL.LQIQ.PSHD..........IIME.YLN...............................................QKEFKYLRA............V....AAFY...I.....RLAYP........................PVKI....YTLL.E.....PLLGDYR.KLRFRNMGG...................-----....-VTLTYMDQFIDD.LL.......HEERVCD..I..ALPRLPKRLTLEDA-e...................................................................
I1CST4_RHIO9/2-153                   ..............................................nsdk-----------------------.----------K.......................................T........FHEIVDEIYNE..APFIKG..............----.-N-...........................................QP.STAFCLLFKL.WTLK.LTIR..........QLEN.LVEhgdsplvkk............................ksvlqlasklTCSVSYIRA............I....GFLY...L.....RYVCA........................PAQL....WDWY.Q.....YYLEDDE.EVAI-----...................----Ss.glHPTKVTVGQLIRM.LI.......IEPKFQG..T..MLPRIPIPIAR----dlek................................................................
M4C7M0_BRARP/10-175                  ..................................................KNIRGTNPQNLVEKIVRTKIYNH.TFWKEQCFGLT.......................................A........-ETLVDKAME-..LDHVGG..............-TFG.GNR...........................................KP.TPFLCLILKM.LQIQ.PEKE..........IVVE.FIK...............................................NDDYKYVRI............L....GAFY...L.....RLTGS........................DVDV....YRYL.E.....PLYNDYR.KVRQKLSDG...................-----....RFSLTHVDEVIEE.LL.......TKDYSCD..I..AMPRLKKRWTLEQN-g...................................................................
A0A024J8U9_GEOCN/21-190              ................................................ar--HHNINPALLIEKITRERIQDA.LYWKSHCFGLT.......................................A........-ATLLDRVVYD..VRYIDSn............aSLAG.GAG...........................................RV.SPFLCLLYKL.VLLQ.PEPE..........IVQF.YLT...............................................QPTFKYLTA............L....AAVY...V.....RLFYA........................PVQV....YTLL.E.....PLLEDYR.KLRVKHAGT...................-----....TVELSYMDVFVDD.LL.......TKERVCG..L..ALPRLTSRQLLEDQD....................................................................
M9N2Z2_ASHG1/14-224                  ..................................................KQLSNQSTSLVIPKIARLRIHNS.MYYKINLYPTG.......................................Lrg....ntLKQLVRVLVRD..LGACKHrsg........pmlHICG.NTE...........................................--.--FQCLLMKV.IEIR.PTWS..........QIYT.LLQlgde.......................................rktgKFNNKYIAV............L....ILVY...L.....RIQYYfladekaes.....fppeadgdvtAAKV....KALF.A.....HFLADYR.KVKCLDLEVdc...............wsGATQK....SVSVQHVDEIVDW.LC.......TKDSIWG..I..PLGRCRWLAD-----vlead...............................................................
E1GES1_LOALO/47-231                  .................................................l-PLWGNTQTMNLNALVLENIIQC.TYYKNYLSETT.......................................G........FQQLTEEIYYS..VKHLEP..............WERG.TRKtqgmtgmcg.........................gvrgvgaggVV.STAFCLLYKL.FTIR.LSRK..........QLVS.MIN...............................................NSDSPYIRG............I....GFMY...I.....RFCQP........................PQDL....WAWM.E.....PYLDDEE.---------...................QIDPRs..gGGDVMAMAQVVKM.ML.......TKLDWYG..T..LFPRIPVPIQKEI--el..................................................................
R1EST0_EMIHU/1-175                   ..................................................---------MNLNSMLIENIRSH.DYFK-GLGELS.......................................T........FEEVVDQIYYD..CTYITP..............WRPG.THKaqraagmcs.........................glrgvsnagVP.STAYMLLFKL.YTLQ.LTRN..........QILR.LVT...............................................HKDSPYIRA............I....GLLY...L.....RYVCE........................PKEL....WGWY.E.....PYVSDPE.-MWSQLGE-...................-----....GGERSTLGSFVRR.LC.......TELEWYD..T..MLPRLPVPVARDI--ek..................................................................
G5C765_HETGA/86-176                  ...........................................qapraek-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.----------.----.----..........----.--K...............................................NEDFKYVCM............L....GALY...M.....RLTGT........................AIDC....YKCL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LR.......HSERVCD..I..MLPRLQKRYVLEE--ve..................................................................
F6SY19_ORNAN/10-72                   .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................G........-----------..------..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....----...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------erldapgmklrpagllvsarvyctsavc........................................
Q86DZ4_SCHJA/31-121                  .................................................l-KLWGNPQTMNLNTMIYTNIVQS.PYFKANLVELK.......................................T........YHEVIDEIYYK..VEHLEP..............WERG.SRRiggqtgmcg.........................gvrgvgaggIV.STAYCLCINF.----.----..........----.---...............................................---------............-....----...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------lp..................................................................
H2S676_TAKRU/10-175                  .................................................n-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LKFVGG..............-VYG.GNI...........................................KP.TPFICLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRL............L....GAMY...M.....RLTGT........................AVDC....YKYL.E.....PLYNDYR.KVKTQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERMCD..I..ILPRLQKRHVLEET-e...................................................................
A0A059B3E7_EUCGR/58-223              ..................................................KSIRGTNPQNLIEKIVRSKIYQN.TYWKEQCFGLT.......................................A........-ETLVDKAME-..LDHIGG..............-TFG.GNR...........................................KP.TPFLCLVLKM.LQIQ.PEKD..........IVVE.FIK...............................................NEDYKYVRV............L....GAFY...L.....RLTGI........................DMDV....YRYL.E.....PLYNDYR.KVRQKLTGG...................-----....NFALTHVDEIIDE.LL.......TKDYSCD..I..AMPRIKKRWTLES--ag..................................................................
C7GXQ4_YEAS2/15-219                  ..................................................KQLNNQSVSLVIPRLTRDKIHNS.MYYKVNLSNES.......................................Lrg....ntMVELLKVMIGA..FGTIKGqng.......hlhmMVLG.GIE...........................................--.--FKCILMKL.IEIR.PNFQ..........QLNF.LLNvk..........................................nenGFDSKYIIA............L....LLVY...A.....RLQYYylngn.............nkndddENDL....IKLF.Kvq.lyKYSQHYF.KLKSFPLQVdc...............faHSYNE....ELCIIHIDELVDW.LA.......TQDHIWG..I..PLGKCQWNKI-----ynsde...............................................................
G1NFA1_MELGA/10-175                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LKYVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HEERVCD..I..ILPRLQKRYVLEEA-e...................................................................
F4WXJ8_ACREC/37-220                  .................................................l-PLWGNERTMNLNPLILTNIQSS.HYFKVNLYELK.......................................T........YHEVIDEIYYK..VSHLEP..............WEKG.SRKtagqtgmcg.........................gvrgvgaggIV.STAYCLLYKL.FTLR.LTRK..........QLNG.LIN...............................................HPDSPYIRA............L....GFMY...I.....RYTQP........................PADL....FSWY.N.....DYLEDEE.---------...................ELDVKa..gGGQVMKMGDILKQ.FL.......TKLEWFS..T..LFPRIPVPIQKD---le..................................................................
M2T688_COCH5/23-228                  ................................................al--IRGQNPALLFEKGVRERITES.YYWKEQCFGLN.......................................A........-ATLCDRAAE-..LKFIGG..............-TTG.ITG...........................................KP.TPFLCLAFKM.LQLV.PDKE..........IVLE.YLNfrdddddeedkaevkkengd......aaaddadqsankeldlnaagkLGCFKYLRC............L....AAFY...I.....RLAWE........................PVEI....YKTL.E.....PLLTDYR.KIKRRLKDT...................-----....-FTLTHVDQFIDD.LL.......TKERICA..T..SLWKLPSRAILEDL-d...................................................................
W9KGY1_FUSOX/25-192                  ...............................................vap---NGLNPATIMEKAVKDRIVDS.YFYKEQCFALN.......................................E........-ADIVDRVVEH..VNFIGG..............-TYG.VTQ...........................................KP.SPFLCLAFKL.LELS.PSDA..........VLME.YLKy.............................................gGEAFKYLRA............L....ACFY...F.....RLTRQ........................AKDV....YEML.E.....PFLEDRR.KLRRRGRAG...................-----....-VVLTFMDEFVDE.LL.......TKERVCG..T..SLWKMPKREVLEDL-e...................................................................
W0W035_ZYGBA/14-210                  ..................................................KQLNHQSVSLVIPRIARDKIHNA.MYYRVNLNTVS.......................................Lrg....dtIECLSKVIVRD..LGSLAEpvs.......fqqvHVLG.GIE...........................................--.--FQCLLMKL.VEIR.PTWD..........QLEV.MLQed...........................................ntGFNNKYIVG............L....ILAY...I.....RIQYYflqv................edplAQRF....RVLF.K.....HYYNDYR.KMKSVLFDQdc...............wtKSQTV....SVNILHMDELVEW.LL.......EREEIWG..I..PLGKCQWKELEE---sss.................................................................
G3R6P3_GORGO/47-231                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
A9UMD4_XENTR/10-175                  .................................................n-SVHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LKFVGG..............-VYG.GNV...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRL............L....GAMY...M.....RLTGT........................SVDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HAERMCD..I..ILPRLQKRQVLEEA-e...................................................................
H9EQH0_MACMU/10-175                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
G5C765_HETGA/10-77                   .................................................h-SIHGTNPQHLVEMIIRTQIYES.KYWKEECFGLM.......................................A........-ELVVDKAME-..LRFMGG..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....----...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------gchprllgprrsagpstq..................................................
X8JDK6_9HOMO/10-173                  .................................................i-HIHGQNPQFLVEKVIRTRIWES.SYWKEECFALT.......................................A........-ESVIDKAIE-..LNTIGG..............-VYG.N-Q...........................................RP.THFICLLLKL.LQIQ.PEKE..........ILIE.YLM...............................................VDEFKYLRA............L....AAMY...V.....RMTFP........................AVEV....YELL.E.....PLLKDYR.KIRLRNMAG...................-----....-YSLTFIDEFVDQ.LL.......TEERVCD..I..ILPRMSKREVFEE--te..................................................................
T1I5E1_RHOPR/4-188                   .................................................l-PLWGNERTMNLNPLILTNIQSS.HYFKVNLYELK.......................................T........YHEVIDEIYYK..VAHLEP..............WEKG.SRKtagqtgmcg.........................gvrgvgaggIV.STAYCLLYKL.FTLK.LTRK..........QLNG.LIT...............................................HPDSPYIRA............L....GFMY...I.....RYTQP........................PPDL....WDWY.D.....EYLDDNE.---------...................ELDVKa..gGGQIMTIGNILKN.FL.......CKLEWFS..T..LFPRIPVPIQQKIE-k...................................................................
W2WM02_PHYPR/11-61                   .................................................q-SVHGVNPQTLVEKIMRNRIYAS.IYWKEQCFGLT.......................................A........-EALVDKILS-..------..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....----...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------rqqegsw.............................................................
A0A022W1X8_TRIRU/20-222              ................................................pl--IRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTYIGG..............-TYG.VGQ...........................................KP.TPFLCLAFKL.LQLA.PEKE..........VILE.YLNfhdpeadeedlkvrgdstd.........adggagdaqdradaailkaTGDFKYLRA............L....AAFY...I.....RLTFE........................PVEI....YKTL.E.....PLLTDYR.KLKRRTKEG...................-----....-FLLTYMDQFVDD.LL.......TKDRVCG..T..SLWKIPTRTILEDL-d...................................................................
G3UEL4_LOXAF/10-175                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
W9RQ05_9ROSA/3-101                   ..........................................iqtcgkpi--------DSLLEKVLCMNILSS.DYFK-ELYRLK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HTDSPYIRA............S....LF--...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------lg..................................................................
F4K753_ARATH/1-113                   ................................................mg-----------------------.-----------.......................................-........-----------..------..............---G.NCR...........................................GP.STAYCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HTDSPYIRA............V....GFLY...L.....RYVAD........................AKTL....WTWY.E.....PYIKDDE.---------...................EFSPG...sNGRMTTMGVYVRD.LL.......LGLYYFD..T..LFPRIPVPVMRQ---ivs.................................................................
A5K4Y5_PLAVS/10-175                  .................................................i-KIFGSNPQYLISNIIRSKIYES.PYWKEKCFALT.......................................S........-ESIIDQAVN-..LKYVGG..............-TYG.GNR...........................................KP.TRFLCLVLKL.LQIQ.PDKD..........IIYE.YIK...............................................NEEFIYLRA............L....GIFY...L.....RLIGK........................SLEI....YQHL.E.....PILFDYR.KMRIRLQNG...................-----....TFEKMYMDVFVDN.CL.......VMNNFLD..V..DFPSLTKRQVLEDND....................................................................
W2ZJH7_PHYPR/37-201                  .................................................l-PIYGNDTTYNLNTLLHQNILQS.AYFH-ELYKFR.......................................T........YHEVVDEIYYR..VDHAEP..............WSPG.TAR...........................................IP.SSCFCLLHKF.FLMR.LTRK..........QMQG.LLR...............................................HTDSPYIRA............V....GFLY...L.....RFTCD........................PEEL....WTWF.E.....PFLEDPE.---------...................EFNASa..nPSVKTTIGEWLIS.LL.......EENNYFG..T..ILPRIPKKIE-----dgik................................................................
K1W8G5_TRIAC/58-194                  ...........................................rsrhgpa-----------------------.-----------.......................................-........AESLIDKAIA-..LHAIGG..............-VYD.-RQ...........................................TP.TPFMCLLLKL.LQIQ.PEKE..........ILFE.YLL...............................................AEEFKYLRA............L....AAMY...I.....RLTFR........................SIEV....YEIL.E.....PLMKDYR.KLRYRQVGG...................-----....-YYLTTFDEFIDD.LL.......TQDRVCD..I..ILPRLTQRSVLEE--ve..................................................................
B0EPX8_ENTDS/2-162                   .............................................sgper----------RLETILRNKIYNC.EYWKQQCFTLT.......................................S........-ETILDEIIK-..LHDFGG..............-TYG.ILK...........................................KP.TKFIVLIMKL.LMLR.PDKS..........IIYE.YIM...............................................NDEFKYVRA............I....GAFY...L.....RLVGS........................SKEC....YQFI.E.....PLYYDYR.PLKYRVDGK...................-----....HYEVVTIDQFAWN.LL.......HLDYYCD..I..TLPIITARPVIES--hg..................................................................
V5EEC2_PSEBG/10-174                  .................................................h-SIHGTNPQFLIEKPVRARIYES.PYWKEHCFALS.......................................A........-STILPLAVN-..LHHIGG..............-LVG.-LQ...........................................RP.SHFLCLLQKL.LQIQ.PEAE..........IIQA.YLE...............................................AKEFKYLRA............L....TAFY...V.....RLTYK........................STDV....YTLL.E.....PILEDGR.KLRWRGSGG...................-----....EFEIVHMDEWVDM.LL.......REERVCD..I..ILPRLTKRDVCETR-d...................................................................
F8MZ43_NEUT8/24-191                  ...............................................lap---NGLNPATIMEKAVRERIIDS.YFYKEQCFGVN.......................................E........-ADIVDRVVEH..VDFIGG..............-VYG.TVQ...........................................KP.SPFLCLAFKL.LQLA.PSDD..........ILNE.YLQf.............................................gGEKFKYLRA............L....ALFY...I.....RLTRK........................DQDV....YKTL.E.....PFLEDRR.KLRRKGRNG...................-----....-TSLTYMDVFVDD.LL.......TKDRVCA..T..SLWKMRKRDILEDL-d...................................................................
N1JK20_BLUG1/21-188                  ...............................................lap---NGLNPATIMEKPVRERIVDC.YFWKDQCFALN.......................................E........-ADIINRVVDH..VHFICG..............-TYG.DAQ...........................................RP.SPFLCLAFKL.LQLA.PSDE..........IIQE.YLGy.............................................gGEKFKYLRA............L....AVFY...V.....RLTRQ........................AKDI....YTIL.E.....PYLADYR.KLKKRGRTA...................-----....-TSLTYMDVFVDD.LL.......VKDRICG..T..TLWKIPKRTILEDL-d...................................................................
E7KNP5_YEASL/15-219                  ..................................................KQLNNQSVSLVIPRLTRDKIHNS.MYYKVNLSNES.......................................Lrg....ntMVELLKVMIGA..FGTIKGqng.......hlhmMVLG.GIE...........................................--.--FKCILMKL.IEIR.PNFQ..........QLNF.LLNvk..........................................nenGFDSKYIIA............L....LLVY...A.....RLQYYylngn.............nkndddENDL....IKLF.Kvq.lyKYSQHYF.KLKSFPLQVdc...............faHSYNE....ELCIIHIDELVDW.LA.......TQDHIWG..I..PLGKCQWNKI-----ynsde...............................................................
W7A7D1_9APIC/10-175                  .................................................i-KIFGSNPQYLISNIIRSKIYES.PYWKEKCFALT.......................................S........-ESIIDQAVN-..LKYVGG..............-TYG.GNR...........................................KP.TRFLCLVLKL.LQIQ.PDKD..........IIFE.YIK...............................................NEEFIYLRA............L....GIFY...L.....RLIGK........................SLEI....YRHL.E.....PILYDYR.KMRIRLQNG...................-----....TFEKIYMDQFVDN.CL.......IMNNFLD..V..DFPSLTKRQVLEDN-n...................................................................
W4IBB9_PLAFA/173-335                 ...............................................lem----TNTTTYNVNTLLRNNILSS.EYFK-SLIPIK.......................................T........FKEVVDEIHSY..ADHVEP..............YCIG.SNR...........................................AP.STLFCCLYKF.FTMQ.LSEK..........QLKS.LIE...............................................NKDSCYIRA............C....GFLY...L.....RYVHS........................PANL....WMWF.E.....PYLLEED.---------...................EFSISc..dKRRKVTIGEYVQS.LL.......SDDKYFN..T..VLPRLPIKIK-----nvy.................................................................
G0N8A9_CAEBE/10-175                  .................................................k-TVKGTNPQFLVEKIIRQRIYDS.MYWKEHCFALT.......................................A........-ELVVDKGMD-..LRYIGG..............-IYA.GNI...........................................KP.TPFLCLALKM.LQIQ.PDKD..........IVLE.FIQ...............................................QEEFKYIRA............L....GAMY...L.....RLTFD........................STEI....YKYL.E.....PLYNDFR.KLRYMNKMG...................-----....RFEAIYMDEFIDN.LL.......REDRYCD..I..QLPRLQKRWALEE--vd..................................................................
F7CZ30_MACMU/10-176                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................V........FINVIDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
A6QTF5_AJECN/40-234                  ................................................pl--IRGVNPATLFEKAVRDRITES.YYWKEQCFGLN.......................................A........-ATLCDRAAE-..LSYIGG..............-TYG.LAQ...........................................KP.TPFLCLAFKL.LQLA.PEKD..........IVLE.YLNfhdpenghvegsemn.................gsegeqggasgvvkaVGDFKYLRA............L....AAFY...I.....RLTFD........................AADI....YKSL.E.....PLLTDYR.KLKRRMKDG...................-----....-FVLTYIDQFVDD.LL.......TKDRVCG..T..SLWKLPSRHQLEDL-d...................................................................
A0A024X1V7_PLAFC/173-335             ...............................................lem----TNTTTYNVNTLLRNNILSS.EYFK-SLIPIK.......................................T........FKEVVDEIHSY..ADHVEP..............YCIG.SNR...........................................AP.STLFCCLYKF.FTMQ.LSEK..........QLKS.LIE...............................................NKDSCYIRA............C....GFLY...L.....RYVHS........................PANL....WMWF.E.....PYLLEED.---------...................EFSISc..dKRRKVTIGEYVQS.LL.......SDDKYFN..T..VLPRLPIKIK-----nvy.................................................................
C0HBS4_SALSA/30-182                  .................................................l-PLWGNEKTMNLNPMVLTNVLSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.MTRK..........QVMG.LIT...............................................HNDSPYIRA............L....GFMY...I.....RYTQP........................PADL....VDWY.D.....GFLDDEE.---------...................-----....-------------.--.......-------..-..---------------mplvqqvnwimyl.......................................................
X0GIC7_FUSOX/25-192                  ...............................................vap---NGLNPATIMEKAVKDRIVDS.YFYKEQCFALN.......................................E........-ADIVDRVVEH..VNFIGG..............-TYG.VTQ...........................................KP.SPFLCLAFKL.LELS.PSDA..........VLME.YLKy.............................................gGEAFKYLRA............L....ACFY...F.....RLTRQ........................AKDV....YEML.E.....PFLEDRR.KLRRRGRAG...................-----....-VVLTFMDEFVDE.LL.......TKERVCG..T..SLWKMPKREVLEDL-e...................................................................
B0D223_LACBS/10-173                  .................................................q-AIHGQNPQFLVETVIRNRIYES.TYWKEHCFALT.......................................A........-ESLIDKALQ-..VRFIGG..............-VYG.N-Q...........................................RP.TEFLCLLLKL.LQIQ.PEKE..........ILVE.YLR...............................................ADEFKYLRA............L....AALY...I.....RMTFR........................AVEV....YDLL.E.....PQLKDYR.KLRQRNMGG...................-----....-YALTFMDEFVYA.LL.......VEERVCD..I..ILPRLIKRQVLEEN-g...................................................................
S0DNK7_GIBF5/25-192                  ...............................................vap---NGLNPATIMEKAVKDRIVDS.YFYKEQCFALN.......................................E........-ADIVDRVVEH..VNFIGG..............-TYG.VTQ...........................................KP.SPFLCLAFKL.LELS.PSDA..........VLME.YLKy.............................................gGEAFKYLRA............L....ACFY...F.....RLTRQ........................AKDV....YEML.E.....PFLEDRR.KLRRRGRAG...................-----....-VVLTFMDEFVDE.LL.......TKERVCG..T..SLWKMPKREVLEDL-e...................................................................
W1QC60_OGAPD/14-179                  .................................................k-RVHGVHPVFLIEKILRERILDS.QYWKRECQHAD.......................................L........-LVLLDRGVE-..LKQIGT..............YANA.GHT...........................................LP.SPFICLLLRL.LQLQ.PAAD..........IIDY.LLV...............................................QTDFVYLTA............L....AALY...V.....RITCD........................SVIV....YQKL.E.....PLLADHR.RINMIENQT...................-----....-VKSINLDEYIDK.LL.......QGNKFLD..M..VLPRLIDRLVLEDQ-e...................................................................
A0A022QWG5_MIMGU/4-166               ..............................................ikss----GRSIDQLLEKVLCMNILSS.EYFR-DLLRLK.......................................T........YHEVIDEIYVT..VTHVEP..............WMTG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HPDSPYIRA............I....GFLY...L.....RYVAD........................PKTL....WSWY.E.....PYLKDDE.---------...................EFSPG...sNGRTATMGAYVID.LL.......LGQYYFD..T..LFPRIPVPVM-----rtv.................................................................
W2GFA6_PHYPR/9-173                   ................................................qi--VHGVNPQTLVEKIMRNRIYAS.IYWKEQCFGLT.......................................A........-ETLVDKAVE-..LQEFGG..............-TFG.GNQ...........................................QP.THFLCLLLKM.LQLQ.PELE..........VVKQ.FIE...............................................NEDYKYVTV............L....GAVY...L.....RLVGK........................PLEV....YTLL.E.....PLLSDYR.KIRKRNVIG...................-----....-WEITHVDEIADA.LL.......HEEYYID..L..ALPRLADRELLEKN-e...................................................................
M9LTE5_PSEA3/10-174                  .................................................v-SIHGTNPQFLIEKPVRARIYES.PFWKEHCFALS.......................................A........-ATLLPLAVD-..LHHVGG..............-LT-.GLQ...........................................RP.SHFLCLLQKL.LQIQ.PEPA..........IVDA.YLA...............................................AKEFKYLRV............L....AAFY...V.....RLTFA........................SSEI....YARL.E.....PMLEDYS.KLRWRDAGG...................-----....AYSVVHVDEVVDM.LL.......REERVCD..I..ILPRLTRRDVCETR-d...................................................................
Q69YH0_HUMAN/47-92                   .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIY--..------..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....----...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------fk..................................................................
U6JTB6_EIMAC/135-297                 ...............................................vqm----TDSTTYNVNQLLRANILSS.EYFK-SLHQLK.......................................S........FHEVVAEVAAY..ADHAEP..............YCSG.STR...........................................AP.STLFCCLYKL.FTLK.LTDK..........QMHM.LLN...............................................HRESPYVRC............T....GFLY...L.....RYVHP........................ADQL....WKWF.E.....PFFLDDE.---------...................QFTPGa..dPNRVVSIGEYAQS.LL.......TEDKYFS..T..VLPRLPVLV------knvy................................................................
F2RND2_TRIT1/20-222                  ................................................pl--IRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTYIGG..............-TYG.VGQ...........................................KP.TPFLCLAFKL.LQLA.PEKE..........VILE.YLNfhdpeadeedsntrgdsad.........adggaddaqdradaailraTGDFKYLRA............L....AAFY...I.....RLTFE........................PVEI....YKTL.E.....PLLTDYR.KLKRRTKEG...................-----....-FLLTYMDQFVDD.LL.......TKDRVCG..T..SLWKIPTRTMLEDL-d...................................................................
C3ZFR3_BRAFL/10-175                  .................................................h-SVKGTNPQYLVEKIIRSRIYES.KYWKEECFGLT.......................................A........-ELLVDKAME-..LKYIGG..............-VYG.GNI...........................................KP.TPFLCLVLKM.LQIQ.PEKD..........IIVE.FIK...............................................NDEFKYVRC............L....GAMY...M.....RLTGS........................SLDV....FKYL.E.....PLLNDYR.KVKWMDSMG...................-----....KLNLSHVDEFVDN.LL.......REERSCD..T..ILPRIQGRHVLEES-n...................................................................
K3YT29_SETIT/10-175                  ..................................................KSIHGTNPQNLVEKIVRSKIYQS.TYWKEQCFGLT.......................................A........-ETLVDKAME-..LDHTGG..............-TYG.GNR...........................................KP.TPFLCLALKM.LQIQ.PDKD..........IVVE.FIK...............................................NEDYKYVRV............L....GAFY...L.....RLTGT........................VADV....YQYL.E.....PLYNDYR.KLRHKLSDG...................-----....QFALTHVDEFIDE.LL.......TKDYSCD..T..ALPRIQKRWVLEA--sg..................................................................
D8QUJ9_SELML/10-175                  ..................................................KSVHGTNPQNLVEKILREKIHQS.SFWKEQCFALT.......................................A........-ETLVDKAME-..LDHIGG..............-TYG.GNR...........................................KA.TPFMCLTLKM.LQIQ.PEKE..........IVVE.FIK...............................................NQDYKYVRV............L....GAFY...L.....RLVGK........................ATDV....YQYL.E.....PLYNDYR.KIRQRSADG...................-----....SFFLSHVDEFIDQ.LL.......TTDYCCD..I..TLPRVPKRSVLEQN-n...................................................................
M4BZA9_HYAAE/9-147                   .................................................q-SVHGVNPQTLIEKIMRNRIYAS.IYWKEQCFGLT.......................................A........-ETLVDKAVE-..LSEFGG..............-TFG.GNQ...........................................QP.THFLCLLLKM.LQLQ.PEIE..........VVQQ.FIE...............................................NEDYKYVTI............L....GAVY...L.....RLVGK........................PMEV....YQLL.E.....PLLSDYR.KIRKRNTAN...................-----....-------------.--.......-------..-..---------------ldvglralvqp.........................................................
H3ATS7_LATCH/10-175                  .................................................h-SIHGTNPQYLVEKIIRTRVYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LKYVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRL............L....GALY...M.....RLTGT........................SIDC....FKYL.E.....PLYNDYR.KIKTQNRNG...................-----....EFELMHVDEFIDQ.LL.......HDERVCD..I..ILPRLQKRHVLEEA-e...................................................................
W6KZR3_9TRYP/4-141                   ................................................hl---KGRQAVASLDPATRYRITRS.QVMA-QCANKP.......................................L........-LWVLEELTR-..VFVVGG..............-LSG.PLH...........................................KV.EHFLCLITRL.LQIC.PSPD..........IVLV.MLR...............................................QELHKYVKV............A....ALFV...I.....RLIGN........................DIIV....QEAV.K.....LGLNDYR.KIRVYGSDE...................-----....-------------.--.......-------..-..---------------tpamsfvttgtk........................................................
C6HES4_AJECH/20-214                  ................................................pl--IRGVNPATLFEKAVRDRITES.YYWKEQCFGLN.......................................A........-ATLCDRAAE-..LSYIGG..............-TYG.LAQ...........................................KP.TPFLCLAFKL.LQLA.PEKE..........IVLE.YLNfhdpenghvegsemn.................gleeeqggasgvvkaVGDFKYLRA............L....AAFY...I.....RLTFD........................AADI....YKSL.E.....PLLTDYR.KLKRRMKDG...................-----....-FVLTYIDQFVDD.LL.......TKDRVCG..T..SLWKLPSRHQLEDL-d...................................................................
W6Z5M9_COCMI/23-230                  ................................................al--IRGQNPALLFEKGVRERITES.YYWKEQCFGLN.......................................T........-ATLCDRAAE-..LKFIGG..............-TTG.ITG...........................................KP.TPFLCLAFKM.LQLV.PEKE..........IILE.YLNfrddeddqddkaeeekengda....adnddddddsakkeldlnaagkLGCFKYLRC............L....AAFY...I.....RLAWE........................PVEI....YKTL.E.....PLLTDYR.KIKRRLKDT...................-----....-FTLTHVDQFIDD.LL.......TKDRICA..T..SLWKLPSRAILEDL-d...................................................................
D3PHD0_LEPSM/10-175                  .................................................t-TIKGTNPQYLIEKVIRTRIYDS.KYWKEQCFALT.......................................A........-ELLVDKAME-..LRYIGG..............-TFA.GNI...........................................KP.TPFLCLVLKM.LQIQ.PEKD..........IVVE.FIK...............................................NEDFKYVRA............L....GAFY...L.....RLVGS........................SLDC....YKYL.E.....PLLNDYR.KIRVQDKQG...................-----....KFNLSHMDEFVDT.LG.......REERLCD..T..ILPRIQIRSILEET-q...................................................................
Q4Y906_PLACH/157-319                 ...............................................iem----TNTSTYNVNNLLRNNILSS.EYFR-SLINLK.......................................T........FKEVLDEILSY..ADHVEP..............YCIG.STR...........................................AP.STLFCCLYKF.FTMQ.LTKK..........QLKS.LID...............................................NKESCYVRA............C....GFLY...L.....RYVHC........................PSNL....WMWF.E.....PYMLDDD.---------...................EFTISa..dKRKLVTIGEYVQS.LL.......YDDKYFN..T..VLPRLPIKIK-----niy.................................................................
M5XCM3_PRUPE/1-41                    ...............................................mgv-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....----...-.....-----........................----....----.-.....-------.---------...................-----....NYALTHVDEVIDE.LL.......TKDYSCD..I..AMPRIKKRWTLEA--tg..................................................................
R4GD49_ANOCA/32-216                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
W5JA90_ANODA/10-175                  ..................................................KNVHGTNPQYLIEKIIRSRIYDS.KYWKEQCFALT.......................................A........-ELLVDKAME-..LRFVGG..............-VFG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IVVE.FIK...............................................NEEFKYVRA............L....GAFY...L.....RLTGS........................SLDC....YKYL.E.....PLYNDNR.KLRKQNRMG...................-----....AYELIHVDEFIDE.LL.......REERVCD..I..ILPRIQKRHVLEEN-n...................................................................
B4GH52_DROPE/10-175                  ..................................................KNVHGTNPQYLIEKIIRSRIYDS.KYWKEQCFALT.......................................A........-ELLVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TQFLCLTLKM.LQIQ.PEKD..........IVVE.FIK...............................................NEEFKYVRA............L....GAFY...L.....RLTGV........................ALDC....YKYL.E.....PLYIDNR.KLRRQNRAG...................-----....QFEIVYMDEYIDE.LL.......RNDRVCD..I..ILPRIQKRTILEEN-n...................................................................
A4RVT9_OSTLU/18-191                  ...............................................naa---KTTGRTHGVEAVLRQNVVNS.EYYRKLCRSAT.......................................GtvdgegmdFMSLVDEIYEL..VDHVEP..............WMSG.NAR...........................................GA.STGFCILFRF.CEKE.LSDK..........EIWH.LLR...............................................HGDSPYIRA............I....GFLY...V.....RYVKN........................GREL....LRWC.E.....EFFDDAE.---------...................KFSPS...pGGKEVTMGTYVRD.LL.......LEQHYFE..T..IFPRIPEVARRE---mvq.................................................................
D3ZGL5_RAT/10-175                    .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LKFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
E3LKU1_CAERE/55-239                  .................................................l-PIWGNQVTMNLNTLVLENIRES.YYYKNNLVEID.......................................S........FQTLVEQIFYQ..VKHLEP..............WEKG.TRRlqgmtgmcg.........................gvrgvgaggVV.SSAYCLLYRL.FNLR.ISRK..........QLIS.MLN...............................................SRQSVYIRG............I....GFMY...I.....RYTQP........................PADL....WYWL.E.....PYLDDDS.---------...................EIDPRs..gGGDLMTFGQMVRT.MI.......NKLDWYG..T..LFPRIPVPIQKEID-e...................................................................
C1LKB0_SCHJA/27-211                  .................................................l-KLWGNPQTMNLNTMIYTNIVQS.PYFKANLVELK.......................................T........YHEVIDEIYYK..VEHLEP..............WERG.SRRiggqtgmcg.........................gvrgvgaggIV.STAYCLLYKL.FTLK.LTRK..........QLKG.LLD...............................................HPDSPYIRA............L....GFMY...I.....RYCIP........................PEDF....WWWY.S.....PYWSDPE.---------...................ELDVKa..gGGCIMTIGNMLEH.WL.......TKLDWFS..T..LFPRIPVPVQKK---lee.................................................................
G3PQV1_GASAC/24-208                  .................................................l-PLWGNEKTMNLNPMILTNVLSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHAEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QLMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PADL....IDWY.D.....GFLDDEE.---------...................ELDVKa..gGGCVMTVGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKLI--dq..................................................................
A8PAN6_BRUMA/37-84                   .................................................l-PLWGNTQTMNLNALVLENIIQC.IYYKNYLAETI.......................................G........FQQLTEEIYY-..------..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....----...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------set.................................................................
H2TYE1_TAKRU/22-206                  .................................................l-PLWGNEKTMNLNPMILTNVLSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QLMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PPDL....LEWY.D.....GFLDDDE.---------...................ELDVKa..gGGCVMTVGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKSID-q...................................................................
G0UIZ7_TRYCI/9-185                   ................................................wn--LKGRSAIAVLCPATRHRILQS.HAMT-ACIHRP.......................................L........MATLEDLI-S-..VTYVGG..............-LSG.PLR...........................................KP.EPFICLITRL.LQVT.PSPT..........VVMA.MLR...............................................QDVHKYLRV............A....ALFV...I.....RLIGN........................NAMM....REAL.Q.....VGWDDYR.KIRVYGSNEdccrntags.gdnaveeneP---LmaapRFAIMCVDEITDR.LF.......NTE----..-..---------------hggrgstw............................................................
K0SGM5_THAOC/41-200                  .............................................iplsc-----SDDTFNMHPMLLQNIAKS.PYFHKCVDTLT.......................................D........WNGLVDEIYYE..VKHLEP..............FTAV.SLD...........................................RVlSAATSLHF--.-EVY.READ..........ALD-.--A...............................................GAYSPYIRC............I....GFLY...L.....RYAAE........................PSTL....WTWF.E.....PYLHDDE.PVQVRQG--...................-----....-RADTTVGEFVRS.LL.......EDMDYHG..T..RLPRLPLTIE-----rqvk................................................................
F6UKW2_XENTR/35-219                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PADL....WDWY.E.....DFLDDEE.---------...................ELDVKa..gGGCIMTIGEMLRS.YL.......TKLEWFS..T..LFPRIPVPVQKHID-q...................................................................
T2M9T2_HYDVU/17-182                  ..................................................KSIRGTNPQYLIEKITRTRIYEC.KYWKEECFALT.......................................A........-ELLVDKAMD-..LKEIGG..............-TFG.GNI...........................................KP.TPFLCLILKM.LQLQ.PEKD..........IIVE.FIK...............................................NEDYKYVRA............L....GAFY...M.....RLVGT........................SQEC....YKYL.E.....PLYNDYR.KMRYKGKIA...................-----....GATIIHMDEFIDS.IL.......HEERVCD..V..MLPRIQKRHILEDL-e...................................................................
U3JJ31_FICAL/52-200                  ..........................................asikplsq-----------------------.-----------.......................................-........--------VE-..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKAID-q...................................................................
Q4N084_THEPA/10-175                  .................................................h-LIHGTNPQFLFSKILRDKVYNS.FYWKESCFGLT.......................................A........-ESLIDKAVQ-..IKYVGG..............-TFG.GNR...........................................QP.SPFICLVLKM.LQIQ.PEME..........IVHE.YIK...............................................NEDYKYLRA............L....GIYY...M.....RLVGT........................AVEV....YRTL.E.....PILGDYR.KLRFRNIDG...................-----....SYVIKYMDEFVDD.CL.......TNTTYLD..V..DLPPLSKRMNLEA--tk..................................................................
L8H6U6_ACACA/87-250                  .................................................l-ELHGDLEKMNLSALIYNNILGS.TYFK-GLYKLK.......................................T........YHEIVDEIYYS..VEHLEP..............FMP-.NSK...........................................MA.SQAWCLMYKC.FTIK.LTKK..........QVTG.MLD...............................................HADSPYIRG............I....GFLY...L.....RMCTN........................PKLL....WDWF.E.....PYLADEE.---------...................EITIR...yKGKPTTIGSLVED.LL.......TTIKFVD..A..IMPRFPALVGKEIN-d...................................................................
B8LLN1_PICSI/10-175                  ..................................................KSVHGTNPQNLVEKILRSKIYQN.SYWKEQCFGLT.......................................A........-ETLVDKAME-..LDHFGG..............-THG.GNR...........................................KA.TPFMCLMMKM.LQIQ.PEKE..........IVVE.FIK...............................................NEDYKYVRI............L....GALY...L.....RLVGK........................PTDV....YQYL.E.....PLYNDYR.KLRRKLADG...................-----....SFALSHVDEFIDE.LL.......TTDYACD..V..ALPRVPKRWTLEA--sg..................................................................
A4I1H4_LEIIN/272-441                 ....daelwgvleskltdelveqvrrsgaapnggrlftafeqheqnvkav-----------------------.-----------.......................................-........----LRYCEQN..VRYAG-..............-VFD.DNE...........................................EA.SPFLLAMGLC.WRLG.LTMD..........DVCR.HFA...............................................RHPRRVVRA............L....ALYL...A.....RYTLA........................PEDY....VYFF.I.....PSLCDEV.IIACTEDAQ...................-----....--VTFSMKDLSRQ.LL.......TKNDVVD..A..WLPILSKHWQ-----edv.................................................................
J3P436_GAGT3/24-191                  ...............................................lap---NGLNPARIMEKAVVDRIVDS.YFWKEQCFGLN.......................................E........-ADIVDRVVDH..VHFVGG..............-ITG.ASQ...........................................KP.TPFLCLALKL.LQLA.PGDD..........VLAE.YLHf.............................................gGDKFKYLRA............L....ALFY...V.....RLTRT........................PKDV....YATI.E.....PFLEDYR.KLRRKGRAG...................-----....-TSLTYVDDFADD.LL.......VKDRVCA..T..SLYKLTKRDVLEDL-d...................................................................
W5FVI4_WHEAT/10-175                  .................................................r-SIHGTNPQNLVEKIVRAKIYQS.NYWKEQCFGLT.......................................A........-ETLVDKAME-..LDHTGG..............-THG.GNR...........................................RP.TPFLCLALKM.LQIQ.PDKE..........IVVE.FIK...............................................NEDYKYVRV............L....GAFY...L.....RLTGT........................VADV....YQYL.E.....PLYNDYR.KIRQKLSDG...................-----....KFTLTHVDEFIDE.LL.......TKDYSCD..T..ALPRIQKRWILEA--sg..................................................................
A8PII6_BRUMA/10-175                  ................................................vt--VKGTNPQYLVEKIIRTRIYDS.KYWKEECFALT.......................................A........-ELLVDKGME-..LRYIGG..............-IYA.GNV...........................................KP.TPFLCLCLKM.LQIQ.PEKD..........IAVE.FIR...............................................QEEYKYIRA............L....GAMY...I.....RLTFT........................SIEV....YKYL.E.....PLYNDYR.KLRMMNNEG...................-----....RFEIVHMDEFIDS.LL.......RDERYCD..I..HLPRIQKRITLEE--vg..................................................................
H3ERC6_PRIPA/1-43                    ..................................................-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....--MY...V.....RLTMT........................SVEQ....YKLL.E.....PLYNDYR.KLRWMNKMG...................-----....-------------.--.......-------..-..---------------nrrdrrderg..........................................................
H0V3G0_CAVPO/48-232                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
S9WYR5_9TRYP/4-144                   ................................................nl---KGRSAVAALDPSTKGRILKS.HTMN-SCLNKP.......................................L........-LWVLEELID-..LEAVGG..............-VSG.PLK...........................................RV.EYFLCLLTRL.LQIT.PAPG..........IVLT.MLR...............................................QDVHKYLRV............G....ALFL...I.....RLIGN........................PAMQ....REAM.K.....IGFDDYR.KIRVYGNEE...................ERE--....-------------.--.......-------..-..---------------tsstkrpreeee........................................................
E0VHT3_PEDHC/1-176                   ..................................................---------MNLNPLILTNIQSS.YYFKVNLYELK.......................................T........YREVIDEIFYK..VNHLEP..............WEKG.SRKtagqtgmcg.........................gvrgvgaggIV.STAYCLLYKL.FTLH.LTRK..........QLNG.LIN...............................................HRDSPYIRA............L....GFMY...I.....RYTQP........................PADL....YDWF.E.....NYLEDAE.---------...................EMDVKa..gGGQIMTIGDMLRH.FL.......TKLEWFS..T..LFPRIPVPIQQKIE-r...................................................................
T0KFN0_COLGC/1-66                    .................................................m-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....----...-.....--TRK........................AKDV....YLLL.E.....PFLEDRR.KLRRKGRAG...................-----....-TSLTYMDEFVDD.LL.......TKTRVCA..T..SFRELPKRVDLVD--lg..................................................................
F6I4Q5_VITVI/10-175                  ..................................................KSIRGTNPQNLVEKILRSKIYQN.TYWKEQCFGLT.......................................A........-ETLVDKAME-..LDHLGG..............-TFG.GNR...........................................KP.TPFMCLVMKM.LQIQ.PEKD..........IVVE.FIK...............................................NEEYKYVRI............L....GAFY...L.....RLTGI........................DTDV....YQYL.E.....PLYNDYR.KLRRKLSDG...................-----....NYSLTHVDEVIDE.LL.......TKDYSCD..V..ALPRIKKRWTLES--lg..................................................................
F2TX53_SALR5/41-247                  .............................................ykcdp-------VTMDLGHVLYSNIVES.TYFQDNCAEQKkkekkkekkekkeeeeeegavgggfftfghaciwmfalkT........FEDIVDEIYTF..VDHLEP..............IILS.PQN...........................................SP.STAFCLLYRL.FCLR.LNEA..........QLDT.LVT...............................................HKDSVYIRA............I....GFLY...L.....RYTAD........................PETL....WTWF.S.....DYIDDPE.PVKVKMAAA...................-----....-APQMPLGEYLRM.LI.......TELQYLHpvC..RLPRIPVMEH-----rdmld...............................................................
B0WP85_CULQU/10-175                  .................................................r-NVHGTNPQYLIEKIIRSRIYDS.KYWKEQCFALT.......................................A........-ELLVDKAMD-..IRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IVVE.FIK...............................................NEEFKYVRA............L....GAFY...L.....RLTGS........................SQDC....YKYL.E.....PLYNDNR.KLRRQNRMG...................-----....HYELVHMDEFIDE.LL.......REERGCD..I..ILPRIQKRHVLEEN-n...................................................................
C0PCD4_MAIZE/3-167                   ..............................................iqts----GKPIDVLMEKVLSMNILSS.DYFK-ELYRLK.......................................T........YHEVIDEIYNT..VKHVEP..............WMTG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HPDSPHIRA............I....GFLY...L.....RYVAD........................PKVL....WMWY.E.....PYLRDDE.---------...................EFSPG...sNGRKTTMGVYVRD.LI.......LGQYYFD..S..LLPRIPLPVTRQ---ita.................................................................
W9C3G0_9HELO/21-188                  ...............................................lap---NGLNPATILEKPVRERIVDC.YFWKDQCFALN.......................................E........-ADIVSRVVSH..VTFIAG..............-TYG.DSQ...........................................RP.SPFLCLAFKL.LQLG.PSDE..........ILQE.YMGy.............................................gGEKFKYLRA............L....ALFY...W.....RMTRQ........................AKDV....FMVL.E.....GYLEDRR.KLRRKTRTG...................-----....-TTLTFIDQFVDE.LL.......TKDRVCG..T..TLWKMPKREILEDL-e...................................................................
Q4U8Q2_THEAN/128-301                 ...............................................ipm----TNSVTYNMNDLLRSNILSS.EYYK-SL-SVK.......................................N........FYQVFDELVQF..ASHCEP..............YCST.ATR...........................................AP.STIFCCLYRF.LVLK.LTEKqvifslievvQMNF.LLE...............................................NNKSPYARC............C....GFLY...L.....RYVLP........................PDKVtkikFICF.S.....SGIDDEF.--FT-----...................-VSAD....GNKQITMGEYAES.LL.......MDDKYYH..T..ILPRLPVRVK-----nl..................................................................
R7Z359_CONA1/20-205                  ................................................al--IRGQNPALLFEKAVRDRITES.YYWKEQCFGLN.......................................A........-ATLCNRAVE-..LTFIGG..............-TYG.GMG...........................................KP.TPFLCLAFKL.LQLV.PERD..........IILE.YLNwsdeegeqge..........................eeenegitlgrPGEFKYLRA............L....AAFY...I.....RLAWE........................PVEI....YRTL.E.....PLLADYR.KLKRRTREG...................-----....-FTLTFMDQFIDD.LL.......TKDRVCA..T..SLWKLPPRTHLEDL-e...................................................................
W7PU90_YEASX/15-219                  ..................................................KQLNNQSVSLVIPRLTRDKIHNS.MYYKVNLSNES.......................................Lrg....ntMVELLKVMIGA..FGTIKGqng.......hlhmMVLG.GIE...........................................--.--FKCILMKL.IEIR.PNFQ..........QLNF.LLNvk..........................................nenGFDSKYIIA............L....LLVY...A.....RLQYYylngn.............nkndddENDL....IKLF.Kvq.lyKYSQHYF.KLKSFPLQVdc...............faHSYNE....ELCIIHIDELVDW.LA.......TQDHIWG..I..PLGKCQWNKI-----ynsde...............................................................
E9EM03_METAR/88-255                  ...............................................lap---NGLNPATIMEKAVKDRIVES.YFYKEQCFALN.......................................E........-ADIVDRVVEH..VRFVGG..............-THG.DAQ...........................................KP.SPFLCLAFKL.LELG.PSEA..........VVRE.YLSy.............................................gGEHFKYLRA............L....ACFY...Y.....RLTRR........................AADV....HRAL.E.....PFLGDRR.KLRTRGRRG...................-----....-AALTYVDEFVDG.LL.......TRERVCA..T..SLWKMPPREVLEDL-d...................................................................
M8A466_TRIUA/3-167                   ...............................................iqt---SGKPIDMLMEKVLCMNILSS.DYFK-ELYRMK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HPDSPYIRA............I....GFLY...L.....RYVAD........................PKIL....WTWY.E.....PYLKDDE.---------...................EFSPG...sNGRMTTMGVYVRD.LI.......LGQYYFD..S..ILPRVPVPVVR----qvtt................................................................
W9S3F4_9ROSA/21-93                   ................................................id-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.----------.----.----..........----.---...............................................---------............I....GFLY...L.....RYAAD........................PKTL....WTWF.E.....PYVRDEE.---------...................EFSPG...sSGRMSTMGAYVRD.LL.......LGQYYFD..T..LFPRIPVPVMRQ---iva.................................................................
V4TZ97_9ROSI/4-144                   ..........................................iqtcgkpi--------DSLLEKVLCMNILSS.DYFK-ELYRLK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HPDSPYIRA............I....GFLY...L.....RYAAD........................PKTL....WNWF.E.....QYLKDEE.---------...................-----....-------------.--.......-------..-..---------------lnpyrfgnsnvgsyfqllli................................................
A0A022RAJ0_MIMGU/10-174              ..................................................KSIRGTNPQNLVEKILRTKIYQN.TYWKEQCFGLT.......................................A........-ETLVDKAME-..LDHLGG..............-TNG.GNR...........................................RP.TPFMCLVMKM.LQIQ.PDKE..........IVVE.FIK...............................................NPDYKYVRV............L....GAFY...L.....RLTGT........................DVDV....YRYL.E.....PLYNDYR.KLRLQLNDG...................-----....KFTLTHVDEYIDE.LL.......TKDYSCD..I..ALPRIKKRWTLE---ai..................................................................
G0RPR5_HYPJQ/26-193                  ...............................................lap---NGLNPATIMEKAVKDRIVDS.YFYKEQCFALN.......................................E........-ADIVDRVVEH..VTFIGG..............-THG.ASQ...........................................KP.SPFLCLAFKL.LELA.PSDA..........ILQE.YLSy.............................................gGEHFKYLRA............L....ACFY...V.....RLTRQ........................AKDV....YLTL.E.....PFLEDRR.KLRRKARTG...................-----....-TTLTFVDEFVDD.LL.......TKDRVCA..T..SLWKMPKRETLEDL-e...................................................................
T0RRR2_9STRA/9-173                   .................................................t-HVHGVNPQHLVEKILRNRIYDC.MYWKEHCFGLT.......................................E........-ETLVEKAID-..LSYIAG..............-HFG.GNQ...........................................QP.SPFLCLLLKM.LQMQ.PDMD..........VVMT.FIE...............................................NGDYKYVTA............L....GAMY...L.....RLTGK........................PVEI....YPVL.E.....NLLSDYR.KVRFRKTMG...................-----....-WDVLHMDEVADL.LL.......REEYFCN..I..ALPRLVDRFQLES--mn..................................................................
J5QUK8_TRIAS/12-58                   ..................................................KAVHGMDPQNLVEKVIRARIYDS.LYWKERCFALN.......................................G........-----------..------..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....----...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------dcaarhwrrvrp........................................................
M2Z5Y8_MYCFI/16-183                  ................................................vl--IRGDNPLKLFEKPVRDRIVDS.YYWKEQCFGLN.......................................A........-ATLLDRAVE-..LTFIGG..............-TYG.VAQ...........................................KP.TPFLCLAFKL.LQLT.PERE..........IIMF.YLEk.............................................gGEEYKYLRA............L....AAFY...I.....RIAWE.......................kDEEV....YTTL.E.....PYLADSR.KLKRRTREG...................-----....-WALTHVDEFIDD.LL.......TKSRVCA..T..TLPKINPRLWLEDE-d...................................................................
B3L5D4_PLAKH/10-175                  .................................................i-KIFGSNPQYLISNIIRSKIYES.PYWKEKCFALT.......................................S........-ESIIDQAVN-..LKYVGG..............-TYG.GNR...........................................KP.TRFLCLVLKL.LQIQ.PDKD..........IIYE.YIK...............................................NEEFIYLRA............L....GIFY...L.....RLIGK........................SLEI....YRYL.E.....PILFDYR.KMRIRLQNG...................-----....TFEKIYMDVFVDN.CL.......VMNNFLD..V..DFPSLTKRQVLEDN-n...................................................................
F0YB92_AURAN/58-222                  ................................................fd--LHGNPDTFNLHPMLHEKIDES.EYYK-CLFVFK.......................................T........FDKVVDVIYEK..VTYVEP..............WAAG.STR...........................................SP.SSAYCLLLKL.FHLR.LTEI..........QVKA.LLD...............................................HGDSPYIRA............L....GALY...V.....RYGCA........................PERT....WHWL.G.....HYADDLE.---------...................EFAPGl..nPNQTTTFGAYCVK.LM.......TDLQYFS..T..MLPRIPVAIE-----rrlk................................................................
I4Y8C3_WALSC/10-173                  .................................................s-SVHGRNPQHLIENVIRQRIYES.AYWKEQCFALT.......................................A........-ETIIDKAVE-..MQSIGG..............-VYG.NLR...........................................-P.LPFICLLLKL.LQLQ.PEPE..........IILE.YLQ...............................................AVEFKYLRA............L....AAMY...T.....RLCFN........................SYQV....FDIL.E.....PLLQDYR.KLRLRNNSG...................-----....-YHITHMDEFVDE.LL.......TEERVCD..I..ILPRLTKRDVLEQ--vh..................................................................
M3D6M0_SPHMS/19-186                  ................................................tl--IRGDNPLKLFEKAVRDRIIDS.YYWKEQCFGLN.......................................A........-ATLLDRAVE-..LSFIGG..............-TYG.AAQ...........................................KP.TPFLCLAFKL.LQLT.PERE..........IITF.YLEk.............................................aGDEFKYLRA............L....AAFY...I.....RLAWE.......................kDEEV....YTTL.E.....PFLADGR.KLKRRVREG...................-----....-WALTHMDEFIDD.LL.......TKTRVCA..T..TLPKINTRLHLEDA-d...................................................................
X6N3G1_RETFI/102-235                 .............................................lpveh------DTHYNMQQLLAENILSS.DYFK-SLYRYK.......................................T........YHEVIEEVKNH..CKNLEP..............RMSG.FSR...........................................KP.STAFCILYKF.FTMN.LTVR..........QVKG.LLD...............................................DYENPFVRG............I....GFLY...L.....RYLLN........................AKDL....WKWF.E.....PYFDDNQ.---------...................-----....-------------.--.......-------..-..---------------lfqpfdngdsivph......................................................
M8BB00_AEGTA/3-167                   ...............................................iqt---SGKPIDMLMEKVLCMNILSS.DYFK-ELYQMK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HPDSPYIRA............I....GFLY...L.....RYVAD........................PKIL....WTWY.E.....PYLKDDE.---------...................EFSPG...sNGRMTTMGVYVRD.LI.......LGQYYFD..S..ILPRVPVPVVR----qvtt................................................................
U6J7B2_ECHGR/27-211                  .................................................l-KLWGNQVTMNINPMIHTNIIQS.PYFKTNLIELK.......................................T........YHEVIDEIYYK..VTHLEP..............WERN.SRRmggqtgmcg.........................gvrgvgaggIV.STAYCLLFKL.FTLK.LTRK..........QLKG.LLE...............................................HPDSPYIRA............L....GFMY...I.....RYCLP........................PEDL....WMWF.A.....PYLDDEE.E--------...................-IDVRa..gGGCSMTIGAMLGQ.WL.......TKLDWFS..T..LFPRIPVPVQKKID-e...................................................................
M7BW90_CHEMY/1-176                   ..................................................---------MNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
L8GYB7_ACACA/10-175                  ..................................................KTVHGTNPQFLLEKILRNRIYNN.PYWKGDCFGLT.......................................A........-EGLAEKAME-..LKNFGG..............-TYG.GNR...........................................KP.THFMCLVLKM.LQIQ.PERE..........IVHE.FIK...............................................NEEHRYVRM............L....GAFY...L.....RLVGK........................PQEI....YNLL.E.....PLYVDWR.KVRKKVESG...................-----....GSQITHVDEFIDE.LL.......HANYSCD..V..VLPFLPKRYTLEQQ-e...................................................................
F4X868_ACREC/10-175                  ..................................................KSIRGTNPQYLIEKIIRSRIYDS.KYWKEECFALT.......................................A........-ELLVDKAME-..LRFLGG..............-VYG.GNV...........................................KP.TPFLCLILKM.LQIQ.PEKD..........IIVE.FIK...............................................NEEFKYVRA............L....GALY...M.....RLTGS........................SLDC....YKYL.E.....PLFNDNR.KLRIQNKQG...................-----....VFELVHMDEFIDN.LL.......RDERCCD..V..ILPRIQKRHVLEEN-n...................................................................
W2INL0_PHYPR/21-185                  ................................................qi--VHGVNPQTLVEKIMRNRIYAS.IYWKEQCFGLT.......................................A........-ETLVDKAVE-..LQEFGG..............-TFG.GNQ...........................................QP.THFLCLLLKM.LQLQ.PELE..........VVKQ.FIE...............................................NEDYKYVTV............L....GAVY...L.....RLVGK........................PLEV....YTLL.E.....PLLSDYR.KIRKRNVIG...................-----....-WEITHVDEIADA.LL.......HEEYYID..L..ALPRLADRELLEKN-e...................................................................
A9RTY4_PHYPA/10-175                  .................................................r-SVHGTNPQNLVEKILRSKIYQN.TYWKEQCFGLT.......................................A........-ETLVDKAME-..LDHFGG..............-TYG.GNR...........................................KA.TPFMCLTLKM.LQIQ.PEKE..........IVVE.FIK...............................................NEDYKYVRI............L....GAFY...L.....RLVGK........................PTDV....YQYL.E.....PLYNDYR.KLRRRTSEG...................-----....GYILARVDEFIDE.LL.......TTEYSCD..I..ALPRVPKRWTLET--tg..................................................................
M5W7Z5_PRUPE/18-176                  ...........................................qnlveni-----------------------.----EQCFGLT.......................................A........-ETLVDKAME-..LDHIGG..............-TFG.GNR...........................................KP.TPFMCHVMKM.LQIQ.PAKE..........IVIE.FIKnddyni..................................fpkvniyYVHFKYVWI............L....GAFY...L.....RLTGT........................ETDV....YQYL.E.....PLYNDYR.KLRRNLADG...................-----....NYALTHVDEVIDE.LL.......TKDYSCD..I..AMPRIKKRWTLEA--tg..................................................................
C8VB07_EMENI/20-212                  ................................................pl--VRGLNPAMLFEKAVRDRITES.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTFIGG..............-TYG.VSE...........................................KA.SPFLCLAFKL.LQIN.PDRD..........IIME.YLNfsdpenetdgaded...................ttaedraqrsvvkhRGDFKYLRA............L....AAFY...V.....RLTWE........................PVEI....YKTL.E.....PLLLDYR.KLKRRVRDS...................-----....-FVLTYMDQFVDD.LL.......TKDRMCG..T..SLWKLPSRQQLEDL-d...................................................................
E7Q418_YEASB/15-219                  ..................................................KQLNNQSVSLVIPRLTRDKIHNS.MYYKVNLSNES.......................................Lrg....ntMVELLKVMIGA..FGTIKGqng.......hlhmMVLG.GIE...........................................--.--FKCILMKL.IEIR.PNFQ..........QLNF.LLNvk..........................................nenGFDSKYIIA............L....LLVY...A.....RLQYYylngn.............nkndddENDL....IKLF.Kvq.lyKYSQHYF.KLKSFPLQVdc...............faHSYNE....ELCIIHIDELVDW.LA.......TQDHIWG..I..PLGKCQWNKI-----ynsde...............................................................
N1PRZ9_MYCP1/19-186                  .................................................k-LIRGDNPLKLFEKPVRDRIVDS.YYWKEQCFGLN.......................................A........-ATLLDRAME-..LSFIGG..............-TYG.IAQ...........................................RP.TAFLCLAFKL.LQLT.PEKD..........IILF.YLQq.............................................aGEEFKYLRA............L....AAFY...I.....RLAWE.......................kDEEV....YTTL.E.....LYMSDGR.KLKRRTRES...................-----....-FGLIHIDEFIDD.LL.......LKTRVCA..T..TLPKINPRTFLEDED....................................................................
B6HM45_PENCW/20-204                  ................................................pl--VRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTSIGG..............-TYG.VSE...........................................KP.TPFLCLAFKL.LQLG.PDRD..........VILE.LLNytdpgsgdea...........................edpdsalvkdRGDFKYLRA............L....AAFY...V.....RLTFD........................PVDV....YKTL.E.....PLLLDYR.KLKRRVRDT...................-----....-FTLTYMDQFVDD.LL.......TKDRVCG..T..SLWKLPPRTQLEDL-d...................................................................
A0A023F3W8_TRIIF/10-175              ..................................................KSVRGTNPQFLIEKIIRSRIYEC.KYWKEECFALS.......................................A........-ELIVDKAME-..LRYLGG..............-VYG.GNV...........................................KP.SPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEEFKYVRA............L....GALY...M.....RLVGT........................SIEC....YKYL.E.....PLLNDGR.KLRNQTRDG...................-----....QFVMIHMDEYIDG.LL.......HEERMFD..I..ILPRIQKRHVLEEA-n...................................................................
D8LWJ8_BLAHO/10-174                  .................................................d-KVRGQNPQNVIEKITRMKIYDC.DYWKERCFGLS.......................................A........-VTILDRMIE-..LDHIGG..............-AYS.GVF...........................................RP.TPFICLVLKL.LQIG.PDKE..........IVYS.FID...............................................NDDYKYITA............V....GLFY...L.....RLVGT........................SLEI....YKHL.E.....PYYNDYR.KLRLLTPTG...................-----....-WSIIHMDEFVEM.LL.......EDEIALD..I..SLPHLDKRHVLEA--rg..................................................................
C5MCZ6_CANTT/17-194                  ...............................................dkr---YTQNKGNLIEPIIRHRIQDS.IFYKQHLYLTN.......................................E........-STILPVIIDH..VKYISG..............--TD.SSN...........................................RP.SNFICCLFRL.LELE.PTKE..........IINV.YLTq............................................lnFNEFKYLTA............L....TLIY...I.....RLVFK........................NEDI....YTIF.D.....SYFKDFR.KIRMKLKNPif...............dsNQIPK....NYKISYIDEWVDD.LL.......TKDRVID..L..ILPRLVPRLTLV---qrg.................................................................
W2NI78_PHYPR/37-201                  .................................................l-PIYGNDTTYNLNTLLHQNILQS.AYFH-ELYKFR.......................................T........YHEVVDEIYYR..VDHAEP..............WSPG.TAR...........................................IP.SSCFCLLHKF.LLMR.LTRK..........QMQG.LLR...............................................HTDSPYIRV............V....GFLY...L.....RFTCD........................PEEL....WTWF.E.....PFLEDPE.---------...................EFNASa..nPSVKTTIGEWLIS.LL.......EENNYFG..T..ILPRIPKKIE-----dgik................................................................
F4K754_ARATH/4-106                   ................................................iq--SNGRAYESLLEKVLSMNILSS.DYFK-ELYGLK.......................................T........YHEVIDEIYNQ..VNHVEP..............WMGG.NCR...........................................GP.STAYCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HTDSPYIRA............I....F---...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------tttikvg.............................................................
W7TQL1_9STRA/10-174                  .................................................t-TVHGTNPQFLIEKILRQKIYNS.LYWKEHCFGLT.......................................A........-ETLVDKAVG-..LKAYGG..............-QYG.GMQ...........................................KP.TKFMCLVLKM.LQLQ.PEKE..........IVVE.FIK...............................................NEDYKYLRV............L....GAFY...L.....RLVGK........................PLDI....YQYL.E.....PLYNDYR.KLRFRGVAG...................-----....-WALKHMDEFIEE.LL.......TSDYCCD..V..ALPHLPKRHLLEDQ-k...................................................................
A0A024G6E6_9STRA/44-209              .................................................l-PIYGNTTTYNLNTLLYQNILHS.DYFR-QLFNLK.......................................T........YHEIVDEIYYR..VDNAEP..............LCPG.TAR...........................................IP.STCFCLLLKC.FTMR.LTMR..........QMQG.LLK...............................................HTDSPYIRV............V....GFLY...I.....RYACD........................PEKL....WSWF.E.....PFLDDQE.---AFNASA...................----N....VNVQTTIGAWLKS.IL.......EENNYFG..T..ILPRIPKKIQD----sikv................................................................
I6ND91_ERECY/14-229                  ..................................................KQLNHQSTSLVIPKITRLRIHNS.MYYKVNLHPAS.......................................Lrg....etMKHVSKVMIRE..LGTCKNr............sTVSG.TAC...........................................GT.VEFQCLLMKM.VEIR.PTWS..........QLHL.MLQlddc......................................sekagPFNNKYIVV............L....ILVY...L.....RIQYYylvnkgteeik.plsnldttgdidAGKI....KTLF.A.....HFLRDCR.KIKSINLHDdp...............wsTSIQK....RVDIYHIDEIVDW.LC.......TNDSIWG..V..PLGKCPWLIEI----leae................................................................
W4XFI6_STRPU/10-175                  .................................................r-SIKGKNPQYLVEKITRSRIYES.RYWKEECFALS.......................................A........-ELLVDKAME-..LRFIGG..............-TYG.GNI...........................................KP.SPFLCLLLKM.LQIQ.PEKD..........IVIE.FIK...............................................NEDFKYVRC............L....GALY...I.....RLVGE........................GLDV....YKYL.E.....PLYNDYR.KIRRQDKIG...................-----....GYFLSHVDEFIDE.LL.......NEERVCD..I..ILPRVQKRHILEET-e...................................................................
R1CRP3_EMIHU/49-231                  .............................................dpvhg------APAFNINPMLLEGIRMGdRFWE--LAKLT.......................................T........FGEVVDAIFYE..VKYVTP..............WVPG.THGkrssgmqs..........................avrgvsnagTP.GIAYTMLLKL.FLLR.LTRD..........QVRS.LLR...............................................HPDSPYIRA............I....GFLY...L.....RLGLY.......................dFKEL....WAWF.Q.....PYLGDDD.-------QF...................FIDGT....PATATTIGEFVRR.LM.......TDQDFFG..D..RLPRLPVLVSRQI--ed..................................................................
E0S9J6_ENCIT/2-163                   ..............................................qykg-----------INRMTREKILAS.EEFK-KMRSLT.......................................Q........-SDVIRSIQS-..LDSIGG..............LVR-.--D...........................................TP.HRFLCLVQKM.GAIS.LDED..........VIAA.NLGdfrpeepl..............................lsnssmemfRGNVCFIAA............-....SLLY...L.....RLSKR........................FHKY....ESLV.R.....SFLMDFR.KVPMVDGEN...................-----....NKTFIYLDVLADD.LL.......NRTRVFN..V..HLKK-----------t...................................................................
J9J8A1_9SPIT/306-471                 .................................................h-QVHGTNPQFLIDKIIRLKIHND.PYYKEKCFALT.......................................A........-ETLVDRAIE-..LKYVGG..............-TYG.GVR...........................................RP.SKFLCLILKM.LQIQ.PDTD..........IILE.FIK...............................................NEDYKYIRA............L....GAFY...W.....RLTAQ........................GKDV....YKVL.E.....PLYKDYR.RIAFRKEEG...................-----....RFEVMHIDEYIDH.LI.......RDEIFCE..V..QLPRINKRYVFEE--dg..................................................................
R0F627_9BRAS/1-113                   ................................................mg-----------------------.-----------.......................................-........-----------..------..............---G.NCR...........................................GP.SSAYCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HTDSPYIRA............V....GFLY...L.....RYVAD........................SKTL....WTWY.E.....PYINDDE.---------...................EFSPG...sNGRMTTMGVYIRD.LL.......LGLYYFD..T..LFPRIPVPVMRQ---ivs.................................................................
V9KXU6_CALMI/10-175                  .................................................h-SIHGTNPQYLIEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFIGG..............-VYG.GNI...........................................KP.SPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRL............L....GALY...M.....RLTGS........................ATDC....YKYL.E.....PLYNDYR.KVKRQSRDG...................-----....EFELIHVDEFMDE.LL.......HEERVCD..I..ILPRLQKRYVLEEA-e...................................................................
A8NG64_COPC7/10-173                  ..................................................KAIHGQNPQFLVETVIRNRIYDS.SYWKEHCFALT.......................................A........-ESIIDKAIE-..VKYIGG..............-VYG.N-Q...........................................RP.TEFVCLLLKL.LQIQ.PEKE..........ILIE.YLR...............................................ADEFKYLRA............L....AALY...I.....RMTFR........................PVEV....YELL.E.....PLLKDYR.KLRQRTMTG...................-----....-YTLTFIDEFVYA.LL.......TEERVID..L..ILPRLPKREILEEN-g...................................................................
G6CYI7_DANPL/22-206                  .................................................l-PIWGNEQTMNLNPLILANIQGS.SYFKVHLFKLK.......................................T........YHEVVDEIYYQ..VKHLEP..............WERG.SRKtagqtgmcg.........................gvrgvgaggIV.STAFCLLYKL.YTLR.LTRK..........QVNG.LLQ...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PADL....FDWY.V.....DYLDDEE.---------...................EVDPRa..gGGGSTTIGALVRQ.ML.......IKLDWFS..T..LFPRIPVPIQKQIE-q...................................................................
A4F2M0_MARPO/1-85                    .................................................q-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.----------.----.----..........---G.LLN...............................................HGDSPYIRA............V....GFLY...L.....RYVGD........................PRSL....WGWF.E.....QYVTDEE.---------...................EFAPG...cNGKKTTMGVFVCD.LL.......LDQYYFD..T..LFPRIPVPVLR----qita................................................................
Q01B71_OSTTA/20-189                  ..............................................aats------GKSHGVEEVLRQNIAHS.EYFR-KLRRAD.......................................Dlgr.paydFMALVDEIYEL..VDHCEP..............WMCG.NAR...........................................GA.STGFCILFQF.CEME.LSDG..........NVWH.LLR...............................................HGDSPFIRA............L....GFLY...V.....RYVKN........................GREL....LKWC.E.....EFFGDEE.---------...................KFKPS...pDGKEVTMGAFVRD.LL.......LEQRYFE..T..ILPRIPEVARRE---iik.................................................................
A8NFA1_BRUMA/47-231                  .................................................l-PLWGNTQTMNLNALVLENIIQC.TYYKNYLAETT.......................................G........FQQLTEEIYYS..VKHLEP..............WERG.TRKtqgmtgmcg.........................gvrgvgaggVV.STAFCLLYKL.FTIR.LSRK..........QLVS.MIN...............................................NSDSPYIRG............I....GFMY...I.....RFCQP........................PQDL....WAWM.E.....PYLDDEE.---------...................QIDPRs..gGGDVMVMAQVVKM.ML.......TKLDWYG..T..LFPRIPVPIQKEI--el..................................................................
W4FS00_9STRA/9-173                   ................................................fs--VHGVNPQHLVEKILRNRIYDS.MYWKEQCFGLT.......................................A........-ETLVDKAIE-..LTHIGG..............-HFG.GNQ...........................................QP.TPFLCLLLKM.LQIQ.PDME..........IVVE.FIK...............................................NGDYKYVTM............L....GAFY...L.....RLVGK........................PTDV....YPIL.E.....ELLADYR.KIRKRNTLG...................-----....-WEMLHVDEVADI.LL.......KEEYFCD..I..ALPHLVDRYQLEA--sn..................................................................
S2JJG8_MUCC1/10-170                  .................................................l-ETWGNETTMNLNAIIYQNILSS.PYFR-SLYNKK.......................................T........FHEIVDEIYNE..APFVKG..............----.-T-...........................................QP.STAYCCLFKM.WTLR.LTIK..........QIEN.MID...............................................HVDSPYIRA............I....GFLY...L.....RYVCA........................PAQL....WDWF.Q.....YYLEDEE.EITISSGV-...................-----....NPTKITIGKLCRM.LI.......TEQKFQN..T..MLPRIPVPIAR----dlek................................................................
G9NT24_HYPAI/26-193                  ...............................................lap---NGLNPATIMEKAVKDRIVDS.YFYKEQCFALN.......................................E........-ADIIDRVVEH..VSFIGG..............-THG.ASQ...........................................KP.SPFLCLAFKL.LQLA.PSDA..........IIQE.YLSy.............................................gGEHFKYLRA............L....ACFY...V.....RMTRQ........................AKDV....YTTL.E.....PFLEDRR.KLRRKARAG...................-----....-TSLTFVDEFVDD.LL.......NKDRVCA..T..SLWKMPKREVLEDL-e...................................................................
M2S990_COCSN/23-231                  ................................................al--IRGQNPALLFEKGVRERITES.YYWKEQCFGLN.......................................A........-ATLCDRAAE-..LKFIGG..............-TTG.ITG...........................................KP.TPFLCLAFKM.LQLV.PDKE..........IVLE.YLNfrddeddeddkddkaevkreng...dtaadddddsakkeldlnaagkLGCFKYLRC............L....AAFY...I.....RLAWE........................PVEI....YKTL.E.....PLLTDYR.KIKRRLKDT...................-----....-FTLTHVDQFIDD.LL.......TKDRICA..T..SLWKLPSRAILEDL-d...................................................................
M5XBU6_PRUPE/4-166                   ...........................................qtcgkpi--------DSLLEKVLCMNILSS.DYFK-ELYRLK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HEDSPYIRA............V....GFLY...L.....RYAAD........................PKTL....WNWV.E.....PYIKDEE.---------...................EFSPG...sNGRTTTMGVYVRD.LL.......LGQYYFD..T..LFPRIPVPVL-----rqiv................................................................
G2WYK7_VERDV/26-193                  ...............................................lap---NGENPAKIMEKAVIGRIVDA.QYFQYQCFALN.......................................E........-AGIVDRVVND..VKFIGG..............-TYG.SAQ...........................................KP.TPFLCLAFKL.LQLA.PSDD..........VLET.YLSf.............................................gGDKFKYLRA............L....ACFY...I.....RMTRR........................ARDV....YAIL.E.....RYLVDRR.KLRRKGRQG...................-----....-TSLTFVDEFVDD.LL.......TKTRVCA..T..SFRELPRRTDLVD--lg..................................................................
J9HJD8_AEDAE/67-225                  .................................................n-----------------------.----VSLFKLK.......................................T........YHEVVDEIYYQ..VKHLEP..............WERG.SRKtsgqtgmcg.........................gvrgvgaggIV.STAFCLLYKL.YTLR.LTRK..........QVNG.LLT...............................................HGDSPYIRA............L....GFMY...L.....RFTQP........................PADL....YDWY.E.....PYLLDEE.---------...................EIDVKa..gGGQTMTIGQMIRQ.WL.......TKLDWFS..T..LFPRIPVPIQKQNE-s...................................................................
F8Q691_SERL3/10-173                  .................................................q-AIHGQNPQFLVETVIRNRIYEA.TYWKEHCFALT.......................................A........-ETLIDKAIE-..VRFIGG..............-VYG.N-Q...........................................RP.TEFLCLLLKL.LQIQ.PEKE..........ILVE.YLQ...............................................ADEFKYMRA............L....AAMY...I.....RMTFA........................AVDV....YEML.E.....PLLKDYR.KLRYRDMAG...................-----....-YSLTFMDEFIYS.LL.......TEERVCD..I..ILPRIARRQTLEEN-g...................................................................
E9C863_CAPO3/29-194                  .................................................v-SVHGTNPQYLIEKILRERIVED.AYWKEHCFALT.......................................A........-ESVIDKAVE-..LAYVGG..............-TFG.QHV...........................................KP.SPFLCLTLKL.LQLQ.PSHD..........IIMT.YIE...............................................NTDFKYLRA............L....GAFY...L.....RLTAQ........................SLEI....YEVL.E.....PLYTDFR.KLRTRNKEG...................-----....EYGLTHMDEFIDR.ML.......RDDRVCD..V..ALPRLMQRHVLE---vsg.................................................................
C5Z170_SORBI/3-167                   ..............................................iqts----GKPIDVLMEKVLRMNILSS.DYFK-ELYRLK.......................................T........YHEVIDEIYNT..VEHVEP..............WMTG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HLDSPYIRA............I....GFLY...L.....RYVAD........................PKIL....WTWY.E.....PYLRDDE.---------...................EFSPG...sNGRKTTMGVYVRD.LI.......LGQYYFD..S..LLPRIPLPVTRQ---ita.................................................................
C1BSW5_LEPSM/10-175                  .................................................t-TIKGTNPQYLIEKVIRTRIYDS.KYWKEQCFALT.......................................A........-ELLVDKAME-..LRYIGG..............-TFA.GNI...........................................KP.TPFLCLVLKM.LQIQ.PEKD..........IVVE.FIK...............................................NEDFKYVRA............L....GAFY...L.....RLVGS........................SLDC....YKYL.E.....PLLNDYR.KIRVQDKQG...................-----....KFNLSHMDEFVDT.LL.......REERLCD..T..ILPRIQIRSILEET-q...................................................................
G3GW00_CRIGR/10-175                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
W7FG85_PLAFA/11-175                  ...............................................knf----GSNPQYLISNIIRSKIYDS.PYWKEKCFALT.......................................S........-ESIIDQAIN-..LKYVGG..............-TYG.GNR...........................................KP.TRFLCLILKL.LQIQ.PDKD..........IIYE.YIK...............................................NEDFVYLRA............L....GIFY...L.....RLIGK........................SLEV....YNHL.E.....PILFDYR.KIRMRLQNG...................-----....TFEKIYMDVFVDN.CL.......ILNNFLD..V..DFPTLTKRQVLEEN-n...................................................................
X0JRB7_FUSOX/25-192                  ...............................................vap---NGLNPATIMEKAVKDRIVDS.YFYKEQCFALN.......................................E........-ADIVDRVVEH..VNFIGG..............-TYG.VTQ...........................................KP.SPFLCLAFKL.LELS.PSDA..........VLME.YLKy.............................................gGEAFKYLRA............L....ACFY...F.....RLTRQ........................AKDV....YEML.E.....PFLEDRR.KLRRRGRAG...................-----....-VVLTFMDEFVDE.LL.......TKERVCG..T..SLWKMPKREVLEDL-e...................................................................
I1IIQ1_BRADI/10-175                  .................................................r-SIHGTNPQNLVEKIVRSKIYQS.TYWKEQCFGLT.......................................A........-ETLVDKAME-..LDHTGG..............-THG.GNR...........................................RP.TPFLCLTLKM.LQIQ.PDKD..........IVVE.FIK...............................................NEDYKYVRV............L....GAFY...L.....RLTGT........................IADV....YQYL.E.....PLYNDYR.KIRQKLNDG...................-----....KFMLTHVDEFIDE.LL.......TKDYCCD..T..ALPRIQKRWVLEA--sg..................................................................
F0VM92_NEOCL/10-175                  ..................................................QQVHGCNPQTLVSRIIRRKIYES.VYWKEQCFALT.......................................A........-ETVLEPCVA-..LTYVGG..............-TYG.GKR...........................................QP.APFLCLVLKL.LQIQ.PETE..........VVLE.FIK...............................................QEQFKYLRA............V....GAFY...L.....RLVGR........................ASEV....YTHL.E.....PLLADYR.KLRFRLPDG...................-----....KFAIVCMDEFVDD.CL.......RKTNFLD..V..DLPVLPKREVLENE-g...................................................................
E4UUK9_ARTGP/20-208                  ................................................pl--IRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LSYIGG..............-TYG.---...........................................--.---------L.LQLA.PEKE..........VILE.YLDfhdpeadeedsnakgdnsg.........aegnvedaqdradaailkaTGDFKYLRA............L....AAFY...V.....RLTFE........................PVEI....YKTL.E.....PLLTDYR.KLKRRTKEG...................-----....-FLLTYMDQFVDD.LL.......TKDRVCG..T..SLWKIPARTMLEDL-d...................................................................
F0XXJ0_AURAN/10-174                  .................................................q-EVHGTNPQRIVEKILRMKVYAT.QYWKEYCFGLT.......................................A........-ETLVDRAIE-..IDHVGG..............-TYG.GIR...........................................KP.TKFMCLLLKM.LQIQ.PDLE..........IIVE.FIK...............................................NEEYKYVRA............L....GALY...L.....RCVGR........................PPEV....YKYL.E.....PLYVDYS.KLRVRTFEG...................-----....-WTITHVDEFVDE.LL.......TEDYSCD..I..ALPHLPKRWHLEQQ-n...................................................................
F0XUL2_GROCL/25-192                  ...............................................vap---NGLNPATIMEKAVRERIVDS.YFWKEQCFGVN.......................................E........-ADVVDRVVDH..VNCIGG..............-TTG.TAQ...........................................KP.TPFLCLAFKL.LQLA.PNDE..........ILAA.YLQh.............................................gGERFKYLRA............L....ALFY...V.....RLTRP........................ADAV....YRTL.E.....PFLADRR.KLRRRGRAG...................-----....-TTLTFVDDFVDD.LL.......VKPRVCA..T..SLWKLPSRDVLED--lg..................................................................
K7H0X5_CAEJA/52-236                  .................................................l-PIWGNQVTMNLNTLVLENIRES.YYYKNNLIEID.......................................S........FQALVEQIFYQ..VKHLEP..............WEKG.TRRlqgmtgmcg.........................gvrgvgaggVV.SSAFCILYRL.FNLR.MTRK..........QLIS.MLN...............................................SRQSVYIRG............I....GFMY...I.....RYTQP........................PSDL....WYWL.E.....PYLDDES.---------...................EIDPRs..gGGDCMTFGMMVRT.MI.......NKLDWYG..T..LFPRIPVPIQKEID-e...................................................................
S7UGR0_TOXGO/10-175                  ..................................................QQVHGCNPQTLVSRIIRRKIYES.AFWKEQCFALT.......................................A........-ETVLEPCVG-..LTYVGG..............-TYG.GKR...........................................QP.APFLCLVLKL.LQIQ.PEPE..........IILE.FIK...............................................QEQFKYLRA............V....GAFY...L.....RLVGR........................ACEV....YTHL.E.....PLLADYR.KLRLRLADG...................-----....KFTIVCMDEFVDD.CL.......RKTNFLD..V..DLPVLPKREVLESE-g...................................................................
W9WA46_9EURO/19-185                  ................................................pl--IRGQNPALLLETAMRDRITDS.LYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTYIGG..............-TYG.VAM...........................................KP.TPFICLAFKL.LTLV.PDRE..........IVLE.YLKn.............................................gGEEWKYLRA............L....AAFY...V.....RLTFN........................AADV....YKTL.E.....PLLEDSR.KLRQRRKEE...................-----....-YVLIHMDEFVDN.LL.......TKDRVCG..T..TLWKLPARQVLEDL-d...................................................................
X0J3G6_FUSOX/25-192                  ...............................................vap---NGLNPATIMEKAVKDRIVDS.YFYKEQCFALN.......................................E........-ADIVDRVVEH..VNFIGG..............-TYG.VTQ...........................................KP.SPFLCLAFKL.LELS.PSDA..........VLME.YLKy.............................................gGEAFKYLRA............L....ACFY...F.....RLTRQ........................AKDV....YEML.E.....PFLEDRR.KLRRRGRAG...................-----....-VVLTFMDEFVDE.LL.......TKERVCG..T..SLWKMPKREVLEDL-e...................................................................
C5DR46_ZYGRC/14-208                  ..................................................KQLNHQSVSFVIPRILRDRIHNA.MYYRVNLNTAS.......................................Lrg....dtMNCLSRILVRD..LGALKDgsv........nqvNVLG.GVE...........................................--.--FQCLLMKL.VEIK.PTFD..........QLTT.MLQd............................................deNFNNKYIVG............L....ILTY...L.....RIQYYylpv................ddpwARRC....QSFF.R.....QYYNDYR.KLKSVQLDQdc...............wsKSQTI....NVDILHTDELVDW.LL.......VKDDIWG..I..PLGKCQWTEINDD--dd..................................................................
PR38A_MOUSE/10-175                   .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LKFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFVLMHVDEFIYE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
F9F8Y6_FUSOF/25-192                  ...............................................vap---NGLNPATIMEKAVKDRIVDS.YFYKEQCFALN.......................................E........-ADIVDRVVEH..VNFIGG..............-TYG.VTQ...........................................KP.SPFLCLAFKL.LELS.PSDA..........VLME.YLKy.............................................gGEAFKYLRA............L....ACFY...F.....RLTRQ........................AKDV....YEML.E.....PFLEDRR.KLRRRGRAG...................-----....-VVLTFMDEFVDE.LL.......TKERVCG..T..SLWKMPKREVLEDL-e...................................................................
M1VHD9_CYAME/26-187                  ................................................ar---------------LREQTRHC.TFYRTYCFKAS.......................................L........-KQLEEVTEEH..VTYVGD..............--CA.A-L...........................................PP.SPFLCVLLAY.DCCS.PSRE..........EVAA.HLD...............................................CSKNVYWRA............I....VATW...I.....RWKES.......................rAEQV....YQLL.D.....PLYRDYR.PIKVRQKDN...................-----....SYHNSYLDVFIDQ.LL.......R------..-..---------------yrcalvsleepfvldvipfphlppryelear.....................................
M7TF93_EUTLA/22-189                  ...............................................lap---NGLNPATIMEKAVRERIVDS.YFYKEQCFGLN.......................................E........-ADVVDRVVEH..VSFIGG..............-TYG.STQ...........................................KP.SPFLCLAFKL.LQLA.PDDA..........VLQE.YLAf.............................................gGERFKYLRV............L....AAFY...V.....RLTRR........................AEHV....YAIL.E.....PFLEDRR.KLRRKARAG...................-----....-TSLTFVDQFVDE.LL.......TKERVCA..T..SLWQMPKREILEDL-d...................................................................
B7P4Y8_IXOSC/14-198                  .................................................l-PLWGNEKTMNLNNLILTNILSS.PYFKVNLYKLK.......................................T........YHEVVDEIYYN..VQHLEP..............WEKG.SRKtsgqtgmcg.........................gvrgvgaggIV.STAFCILYKL.FTLK.LTRK..........QLNG.LMN...............................................HCDSPYIRA............L....GFMY...I.....RFTQP........................PADL....VDWY.E.....PYLDDEE.---------...................ELDVKa..gGGQTLRMGDMLRH.FL.......TKLEWFA..T..LFPRIPVPIQKEIE-r...................................................................
C5L5B5_PERM5/95-139                  ................................................ag--AHGGNPQFLISQIVRDRVYSL.RYWKEECFGLN.......................................A........-ETILDKAAE-..------..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....----...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------l...................................................................
F0ZBH7_DICPU/5-166                   .................................................l-EIHGNEKTMNLDNILLSNIQSS.LYFK-NLYSKK.......................................T........YHEVLDEIKKN..VDCLSP..............YIS-.NTK...........................................NP.STAFCLLYKF.FLMK.LTVK..........QMEG.LLG...............................................-QDSPYARG............I....GILY...L.....RYSYP........................PSKI....WEWY.I.....DYLDDHD.---------...................TVLIS....KNSEVTIQKLMLD.LL.......KENKFSG..T..ILPRIPTKIQQD---ldk.................................................................
B6TYH0_MAIZE/10-175                  ..................................................KSIHGTNPQNLVEKIVRSKIYQS.TYWKEQCFGLT.......................................A........-ETLVDKAME-..LDHTGG..............-TYG.GNR...........................................KP.TPFLCLALKM.LQIQ.PDKD..........IVVE.FIK...............................................NEDYKYVRV............L....GAFY...L.....RLTGT........................IADV....YQYL.E.....PLYNDYR.KIRHKLSDG...................-----....QFTLTHVDEFIDE.LL.......TKDYSCD..T..AMPRIQKRWVLEA--sg..................................................................
W7F1W5_PLAF8/173-335                 ...............................................lem----TNTTTYNVNTLLRNNILSS.EYFK-SLIPIK.......................................T........FKEVVDEIHSY..ADHVEP..............YCIG.SNR...........................................AP.STLFCCLYKF.FTMQ.LSEK..........QLKS.LIE...............................................NKDSCYIRA............C....GFLY...L.....RYVHS........................PANL....WMWF.E.....PYLLEED.---------...................EFSISc..dKRRKVTIGEYVQS.LL.......SDDKYFN..T..VLPRLPIKIK-----nvy.................................................................
G5AX24_HETGA/10-161                  .................................................h-SIRGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLILKM.FQIQ.PEKD..........IIVE.FIK...............................................NEDFKYARM............L....GSLY...M.....RLTGT........................AIDC....FKYL.E.....PLYNDYW.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HKRY---..-..---------------lleea...............................................................
N1R8N2_FUSC4/25-192                  ...............................................vap---NGLNPATIMEKAVKDRIVDS.YFYKEQCFALN.......................................E........-ADIVDRVVEH..VNFIGG..............-TYG.VTQ...........................................KP.SPFLCLAFKL.LELS.PSDA..........VLME.YLKy.............................................gGEAFKYLRA............L....ACFY...F.....RLTRQ........................AKDV....YEML.E.....PFLEDRR.KLRRRGRAG...................-----....-VVLTFMDEFVDE.LL.......TKERVCG..T..SLWKMPKREVLEDL-e...................................................................
U5GDA8_POPTR/8-141                   .................................................k-NIKGTNPQNLVEKILLSKIYQH.THYS-------.......................................-........--------ME-..LDHLGG..............-TYG.GNR...........................................KP.TPFMCLITKV.LQIQ.PEKD..........IVVE.FIK...............................................YEDYKYVRV............L....GAFY...L.....RLTGT........................DIDV....YRYL.E.....PLYNDYR.KLRQKLTDG...................-----....-------------.--.......-------..-..---------------nyscdivlprikkrwtletlg...............................................
E1GF58_LOALO/10-175                  ................................................vt--VKGTNPQYLVEKIIRTRIYDS.KYWKEECFALT.......................................A........-ELLVDRGME-..LRYIGG..............-IYA.GNV...........................................KP.TPFLCLCLKM.LQIQ.PEKD..........IAVE.FIR...............................................QEEYKYIRA............L....GAMY...I.....RLTFT........................SIEV....YKYL.E.....PLYNDYR.KLRIMNNDG...................-----....RFEIVHMDEFIDS.LL.......REERYCD..I..HLPRIQKRITLEE--ig..................................................................
I7J7H2_BABMI/10-175                  ................................................hc--IHGTNPQFLVSKIIRDKIYNS.TYWKESCFGLT.......................................A........-ESLIDRAVE-..LKYVGS..............TITG.S-R...........................................QV.SPFICLVLKL.LQIQ.PEIE..........IVLE.YIR...............................................NNDYKYLRV............L....GAYY...L.....RLVGN........................SPEI....YLNL.E.....PLLADYR.KIRIQDSNA...................-----....KITITHIDEFIDR.CL.......RDNTVLD..I..DLPPLTRREVLEES-k...................................................................
H0GGJ6_SACCK/15-219                  ..................................................KQLNNQSVSLVIPRLTRDKIHNS.MYYKVNLSNES.......................................Lrg....ntMVELLKVMIGA..FGTIKGqng.......hlhmMVLG.GIE...........................................--.--FKCILMKL.IEIR.PNFQ..........QLNF.LLNvk..........................................nenGFDSKYIIA............L....LLVY...A.....RLQYYylngn.............nkndddENDL....IKLF.Kvq.lyKYSQHYF.KLKSFPLQVdc...............faHSYNE....ELCIIHIDELVDW.LA.......TQDHIWG..I..PLGKCQWNKI-----ynsde...............................................................
E9GW90_DAPPU/10-175                  .................................................i-SVKGTNPQYLVEKIIRTRIYDS.KYWKEECFALT.......................................A........-ELMVDKAME-..LRYIGG..............-IFG.GNV...........................................KP.TPFLSLTLKM.LQIQ.PEKD..........IVVE.FIK...............................................NEDFKYVRA............L....GAFY...M.....RLVGT........................SVEI....YKYL.E.....PLYNDYR.KIRFQNKEG...................-----....NFELLYMDDFIDS.LL.......REERFCD..V..ILPRLQKRQILEEA-n...................................................................
J9MZ54_FUSO4/25-192                  ...............................................vap---NGLNPATIMEKAVKDRIVDS.YFYKEQCFALN.......................................E........-ADIVDRVVEH..VNFIGG..............-TYG.VTQ...........................................KP.SPFLCLAFKL.LELS.PSDA..........VLME.YLKy.............................................gGEAFKYLRA............L....ACFY...F.....RLTRQ........................AKDV....YEML.E.....PFLEDRR.KLRRRGRAG...................-----....-VVLTFMDEFVDE.LL.......TKERVCG..T..SLWKMPKREVLEDL-e...................................................................
W9YRJ2_9EURO/19-185                  ................................................pl--VRGQNPALLFETPMRDRITDS.LYWKEQCFGLN.......................................A........-ATLCDRAIE-..LNYLGG..............-TYG.VAM...........................................KP.TPFICLAFKL.LTLV.PDKE..........IILE.YLNn.............................................gGEEWKYLRA............L....AAFY...V.....RLTFD........................PADV....YKTL.E.....PLLEDLR.KLRLRRKET...................-----....-YELIHMDEFVDN.LL.......TKERVCG..T..SLWKLPARQLLEDL-d...................................................................
M2XT21_GALSU/10-174                  ................................................ih--AHGFDPQFLIDKITREKIYQC.AYWKAECFGLT.......................................A........-ETLVDKAAE-..LTYVGG..............-LYG.PLK...........................................KP.TPFICLILKL.LQLS.PDKE..........IIHQ.YLQ...............................................QKKFKYLTA............L....AAFY...W.....RLVGN........................GTDV....YRWL.E.....PLYEDFR.KLRIRRENK...................-----....-YELIHVDECIDE.LL.......QKEDVCD..I..KLPRLPNRNVLME--dr..................................................................
A7TN57_VANPO/14-211                  ..................................................KQLNNQSVSLVIPRITRDKIHNS.IYYKANLDNSS.......................................Lrg....lnMLQLIEVIVRD..LGTLKDksv........nqvCFLG.GVE...........................................--.--FKCILMKL.IEIC.PTWE..........QLMT.IIQmqd........................................nvidNFDNKYLVA............L....VLTY...I.....RIQYYydn.................devnSKKY....RELF.S.....KCISDYR.KLKSVAMDTdc...............wsMSQSI....EIKIIHLDELVDW.LC.......SEDEIWG..I..PLGHCQWSD------lnasde..............................................................
D2H2D9_AILME/10-175                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
A7SXQ7_NEMVE/10-175                  ..................................................KNIKGTNPQYLVEKIIRTRIYES.KYWKEQCFALT.......................................A........-ELLVDKAME-..LDHIGG..............-TFG.GNI...........................................KP.TPFLCLLLKM.LQIQ.PEKE..........IIVE.FIK...............................................NDDYKYVRA............L....GAMY...M.....RLVGT........................ALDC....YNYL.E.....PLFNDYR.KLKRMSQTG...................-----....VYEVVHMDEFIDD.LL.......REDRVND..I..ILPRIQARHILEA--tn..................................................................
M4G3L5_MAGP6/24-191                  ...............................................lap---NGLNPARIMEKAVVDRIIDS.YFWKEQCFGLN.......................................E........-ADIVDRVVDH..VHFIGG..............-ITG.PSQ...........................................KP.TPFLCLALKL.LQLA.PGDD..........VLAE.YLHf.............................................gGEKFKYLRA............L....ALFY...V.....RLTRA........................PKDV....YATI.E.....PFLEDYR.KLRRKGRAG...................-----....-TSLTYIDDFADD.LL.......VKDRVCA..T..SLYKLTKRDVLEDL-d...................................................................
B7S4A9_PHATC/10-166                  ................................................ss--VSGSDPQNLLEYITRQKIYDS.RFWKEECFGLT.......................................V........-ADVLEKSTS-..LQCIGA..............----.---...........................................LP.AHFLALCLKL.LQLH.PETE..........LVTEtFVD...............................................QEDFKYTRV............L....GCLY...L.....RLTGR........................PTEI....YERL.E.....PLYRDRR.KLRVWTPPC...................-----....-WGLKHVDDFIHE.CL.......TEPRILN..L..SLPRLPSRRSL----q...................................................................
G9KIQ1_MUSPF/15-199                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
E3N791_CAERE/10-175                  .................................................k-TVKGTNPQFLVEKIIRQRIYDS.MYWKEHCFALT.......................................A........-ELVVDKGMD-..LRYIGG..............-VYA.GNI...........................................KP.TPFLCLALKM.LQIQ.PEKD..........IVLE.FIQ...............................................QEEFKYIRA............L....GAMY...L.....RLTFD........................STEI....YKYL.E.....PLYNDFR.KLRYMNKMG...................-----....RFEAIYMDDFIDN.LL.......REDRYCD..I..QLPRLQRRWALEE--ve..................................................................
J3S0W7_CROAD/10-175                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRYTGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRL............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDQ.LL.......HDERVCD..I..ILPRLQKRYVLEEA-e...................................................................
E7KCV7_YEASA/15-219                  ..................................................KQLNNQSVSLVIPRLTRDKIHNS.MYYKVNLSNES.......................................Lrg....ntMVELLKVMIGA..FGTIKGqng.......hlhmMVLG.GIE...........................................--.--FKCILMKL.IEIR.PNFQ..........QLNF.LLNvk..........................................nenGFDSKYIIA............L....LLVY...A.....RLQYYylngn.............nkndddENDL....IKLF.Kvq.lyKYSQHYF.KLKSFPLQVdc...............faHSYNE....ELCIIHIDELVDW.LA.......TQDHIWG..I..PLGKCQWNKI-----ynsde...............................................................
D8R3L1_SELML/5-169                   ..............................................vqtc----GKPIQTLVEHVVNVNILSS.EYFK-ELYRLK.......................................T........FHEVVDEIYNH..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMQG.LLN...............................................HADSPYIRA............I....GFLY...L.....RYCGE........................PRTL....WQWF.E.....PYIEDDE.---------...................EFSPG...tNGRVTKMGVYIRD.LL.......LHQHYFD..T..IFPRIPVPVARQ---ias.................................................................
W2M316_PHYPR/9-173                   .................................................q-SVHGVNPQTLVEKIMRNRIYAS.IYWKEQCFGLT.......................................A........-ETLVDKAVE-..LQEFGG..............-TFG.GNQ...........................................QP.THFLCLLLKM.LQLQ.PELE..........VVKQ.FIE...............................................NEDYKYVTV............L....GAVY...L.....RLVGK........................PLEV....YTLL.E.....PLLSDYR.KIRKRNVIG...................-----....-WEITHVDEIADA.LL.......HEEYYID..L..ALPRLADRELLEKN-e...................................................................
W5I894_WHEAT/3-165                   ..............................................lqts----GRPIEVLMEKVLSMNIVSS.DYFK-ELYKIK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKL.FTMK.LTVN..........QMHG.LLK...............................................HPDSPYIRA............I....GFLY...L.....RYAAD........................PKTL....WTWY.E.....PYIQDDE.---------...................EFSPG...sNGKMTTMGVYVRD.VI.......LGQYYFD..S..LLPRVPL--------lilrqv..............................................................
J3MB67_ORYBR/4-166                   ...........................................qssgrpi--------DVLMEKVLSVNILSS.DYFK-ELYRLK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.SSAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HPDSPYIRA............I....GFLY...L.....RYVAE........................PKTL....WSWY.E.....PYIKDDE.---------...................EFSPG...sNGKMTTMGVYVRD.LL.......LGQYYFD..S..LLPRVPLPI------lrqvt...............................................................
Q07G58_XENTR/35-219                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PADL....WDWY.E.....DFLDDEE.---------...................ELDVKa..gGGCIMTIGEMLRS.YL.......TKLEWFS..T..LFPRIPVPVQKHID-q...................................................................
S9WUU7_9TRYP/1-95                    ..................................................-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.----------.----.----..........----.MLR...............................................QDVHKYLRV............G....ALFL...I.....RLIGN........................PAMQ....REAM.K.....IGFDDYR.KIRVYGNEE...................ERET-....-------------.--.......-------..-..---------------sstkrpreeeekdakewdstyapiihphyfimrldeiterlfl.........................
U6HI82_ECHMU/1-99                    ..................................................-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.---------M.LQIQ.PDKD..........IVIE.FIK...............................................QEDYKYARA............L....GAFY...L.....RLVGE........................SVEI....YKYL.E.....ALYNDFR.KLKQQDTTG...................-----....KFSIVRMDEFIDQ.LL.......NEERVCD..V..ILPRLQKRSVLEDN-n...................................................................
E7LUN2_YEASV/15-219                  ..................................................KQLNNQSVSLVIPRLTRDKIHNS.MYYKVNLSNES.......................................Lrg....ntMVELLKVMIGA..FGTIKGqng.......hlhmMVLG.GIE...........................................--.--FKCILMKL.IEIR.PNFQ..........QLNF.LLNvk..........................................nenGFDSKYIIA............L....LLVY...A.....RLQYYylngn.............nkndddENDL....IKLF.Kvq.lyKYSQHYF.KLKSFPLQVdc...............faHSYNE....ELCIIHIDELVDW.LA.......TQDHIWG..I..PLGKCQWNKI-----ynsde...............................................................
E4YWX6_OIKDI/10-175                  .................................................n-TIKGTNPQFLIEKIIRSRIYES.RYWKEECFALT.......................................A........-ELLVDKALQ-..LKYIGG..............-TTA.AHV...........................................KP.TPFLCLLCKM.LQIQ.PEKD..........IVIE.FIK...............................................QDEFKYVRC............L....GAMY...L.....RLTGN........................SVEC....YKYL.E.....ELLADFR.RVKTMNKMG...................-----....AFETSHIDEFIDS.LL.......IEDRVCE..V..ILPRLQRRAVLEEQ-g...................................................................
A9RSQ4_PHYPA/6-170                   ............................................vqtcgk------PLDTLIERVLCTNILSS.DYFK-ELFGLQ.......................................T........YTEVVDEIYNH..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKL.FTLK.FTVK..........QMQD.ILD...............................................HPDSPYIRA............L....GFLY...L.....RYVGD........................PKTI....WDWF.E.....PYVKDPE.---------...................EFSPG...sNKKMTTMGVYVRD.II.......LNQYYFD..T..LFPRIPVPILR----qita................................................................
W4IUL8_PLAFP/173-302                 ...............................................lem----TNTTTYNVNTLLRNNILSS.EYFK-SLIPIK.......................................T........FKEVVDEIHSY..ADHVEP..............YCIG.SNR...........................................AP.STLFCCLYKF.FTMQ.LSEK..........QVTH.KL-...............................................---------............-....----...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------vsilprlpikiknvygarlmiiddhrrrlkknkeniskflkgepvla.....................
F1S580_PIG/50-234                    .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
V7BIY7_PHAVU/10-175                  ..................................................KSIRGTNPQNLVEKILRSKIYQN.TYWKEQCFGLT.......................................A........-ETLVDKAME-..IDHLGG..............-TYG.GNR...........................................KP.TPFMCLVMKM.LQIQ.PEKE..........IVIE.FIK...............................................NEDYKYVRI............L....GAFY...L.....RLTGS........................DIDV....YRYL.E.....PLYNDYR.KLRQKSSDG...................-----....QFTLTHVDEVIDE.LL.......TKDYSCD..I..ALPRVKKRWTLESL-d...................................................................
W2J6G6_PHYPR/37-201                  .................................................l-PIYGNDTTYNLNTLLHQNILQS.AYFH-ELYKFR.......................................T........YHEVVDEIYYR..VDHAEP..............WSPG.TAR...........................................IP.SSCFCLLHKF.FLMR.LTRK..........QMQG.LLR...............................................HTDSPYIRV............V....GFLY...L.....RFTCD........................PEEL....WTWF.E.....PFLEDPE.---------...................EFNASa..nPSVKTTIGEWLIS.LL.......EENNYFG..T..ILPRIPKKIE-----dgik................................................................
F6ZP02_CIOIN/10-175                  .................................................h-TVKGTNPQYLIEKIIRSRIYDS.RYWKEQCFALT.......................................A........-ELLVDKAMD-..LKYIGG..............-VYS.GNI...........................................KP.CPFLCLILKM.LQIQ.PDKD..........IIVE.FIR...............................................NEDFKYVRC............L....GAFY...M.....RITGT........................SLDC....YKYL.E.....PLLNDFR.KIKFQKREG...................-----....NFVITHMDEFIDE.LL.......REERSCD..V..ILPRIQKRQILEEL-e...................................................................
E1F9P4_GIAIA/1-141                   ..................................................-----------MEHATRRAILNS.PLYLMEFKHLG.......................................V........IGLLKDVLVT-..-RNIDL..............-EYG.--Q...........................................EP.SRLLCSLVRL.YMLH.PDRS..........IVHE.ILS...............................................ARGFAYTTA............F....AAIH...V.....RCYWS........................SLDI....HKAL.T.....PLLSNYT.KIHVSGLKA...................---LG....LQGHVPLDVFVET.LL.......RQP----..-..---------------stlskc..............................................................
K3ZVF4_SETIT/1-99                    ..................................................-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.---------M.LQIQ.PDKD..........IVVE.FIK...............................................NEDYKYVRV............L....GAFY...M.....RLTGT........................VADV....YQYL.E.....PLYNDYR.KLRHKLSDG...................-----....QFALTHVDEFIDE.LL.......TKDYSCD..T..ALPRIQKRWVLEA--sg..................................................................
W9PRI6_FUSOX/25-192                  ...............................................vap---NGLNPATIMEKAVKDRIVDS.YFYKEQCFALN.......................................E........-ADIVDRVVEH..VNFIGG..............-TYG.VTQ...........................................KP.SPFLCLAFKL.LELS.PSDA..........VLME.YLKy.............................................gGEAFKYLRA............L....ACFY...F.....RLTRQ........................AKDV....YEML.E.....PFLEDRR.KLRRRGRAG...................-----....-VVLTFMDEFVDE.LL.......TKERVCG..T..SLWKMPKREVLEDL-e...................................................................
R9XGB2_ASHAC/14-224                  ..................................................KQLNNQSTSLVIPKIARLRIHNA.MYYKINLYPTG.......................................Lrg....ntLKQLVRVLVRD..LGACKHrsg........pmlHVCG.NTE...........................................--.--FQCLLMKV.IEIR.PTWS..........QIYS.LLLlgdp.......................................rktgKFNNKYITV............L....IIVY...L.....RIQYYfladedaes.....fppeasgdvtAAKV....KALF.V.....HFLTDYR.KVKCLDLDVdc...............wsGAAQK....SVSVQHVDEIVDW.LC.......TKDSIWG..I..PLGRCRWLAD-----vlead...............................................................
G6DFN0_DANPL/10-175                  ..................................................KSIRGTNPQYLIEKIIRSRIYDS.KYWKEECFALT.......................................A........-ELLVDKAME-..LRYIGG..............-VHG.GFI...........................................YP.TPFLCLVLKM.LQIQ.PEKD..........IVVE.FIK...............................................NEEFKYVRA............L....GAFY...M.....RITGS........................SLDC....YKYL.E.....PLYNDNR.KLRRQNREG...................-----....QFEIVHVDEFIDE.LL.......REERLCD..V..ILPRIQKRHILEEN-n...................................................................
B3LAT7_PLAKH/162-322                 ...............................................lem----TNTTTYNVNTLLRNNILSS.EYFR-SLVPLK.......................................T........FKEVVEEIHLY..ADHVEP..............YCIG.STR...........................................AP.STLFCCLYKL.FTMH.LSEK..........QM--.LIE...............................................SRESCYIRA............C....GFLY...L.....RYVHS........................PANL....WMWF.E.....PYLLDED.---------...................EFITSa..dKRKKQTIGEYTQC.LL.......ADDKYFN..T..VLPRMPIKIK-----nty.................................................................
M0T4J1_MUSAM/3-167                   ..............................................iqts----GKPIDSLLEKVLSMNILSS.DYFK-ELYRLK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HPDSPYIRA............I....GFLY...L.....RYVAD........................PKTL....WTWY.E.....PYIKDDE.---------...................EFSPG...sNGRLTTMGVYVRD.LL.......LGQYYFD..T..LFPRVPVPVVRQ---iva.................................................................
A1DES8_NEOFI/20-209                  ................................................pl--VRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTSIGG..............-TYG.VAE...........................................KP.TPFLCLAFKL.LQLN.PERE..........IILE.YLNytdpgsdeetea......................taeeqarngvlgqRGDFKYLRA............L....AAFY...V.....RLTFD........................PVDV....YKTL.E.....PLLLDYR.KLKRRVRDT...................-----....-FVLTYMDQFVDD.LL.......TKDRVCG..T..SLWKLPARQQLEDL-d...................................................................
A0A034WSN4_BACDO/1-69                ..................................................-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....--MY...L.....RYTQP........................PADL....YDWY.E.....DYFQDEE.---------...................EIDVKa..gGGQTITIGQVVYQ.FL.......TKLDWFS..T..LFPRIPVPIQKQIE-k...................................................................
F2SN07_TRIRC/20-222                  ................................................pl--IRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTYIGG..............-TYG.VGQ...........................................KP.TPFLCLAFKL.LQLA.PEKE..........VILE.YLNfhdpeadeedlkvrgdstd.........adggagdaqdradaailkaTGDFKYLRA............L....AAFY...I.....RLTFE........................PVEI....YKTL.E.....PLLTDYR.KLKRRTKEG...................-----....-FLLTYMDQFVDD.LL.......TKDRVCG..T..SLWKIPTRTILEDL-d...................................................................
U3IDW8_ANAPL/1-111                   .................................................x-----------------------.-----------.......................................-........-----------..------..............----.---...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HEERVCD..I..ILPRLQKRYVLEEA-e...................................................................
C1GJF7_PARBD/20-214                  ................................................pl--IRGVNPATLFEKAVRDRITES.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTYIGG..............-TYG.LAQ...........................................KP.TPFLCLAFKM.LQLS.PEKE..........IVLE.YLNfhdpetghdgvygen.................nveedhdkdsgvvkaVGDFKYLRA............L....AAFY...I.....RLTFD........................AAEI....YTTL.E.....PLLADYR.KLKRRTKDG...................-----....-FLLTYMDQFVDD.LL.......TKDRVCA..T..SLWKLPSRTQLEDL-d...................................................................
V6T9Z4_GIAIN/1-159                   ..................................................-----------MEHATRRAILNS.PLYLMEFKHLG.......................................V........IGLLKDVLVT-..-RNIDL..............-EYG.--Q...........................................EP.SRLLCSLVRL.YMLR.PDRS..........IVHE.ILS...............................................ARGFAYATA............F....AAIH...V.....RSYWS........................SLDI....HKAL.T.....PLLNNYT.KIRVSGLKT...................---LG....LQGHVPLDVFVEA.LL.......HQPSTLS..-..---------------tcsgtftpmgclrlplltkr................................................
A0A024V1Q9_PLAFA/173-335             ...............................................lem----TNTTTYNVNTLLRNNILSS.EYFK-SLIPIK.......................................T........FKEVVDEIHSY..ADHVEP..............YCIG.SNR...........................................AP.STLFCCLYKF.FTMQ.LSEK..........QLKS.LIE...............................................NKDSCYIRA............C....GFLY...L.....RYVHS........................PANL....WMWF.E.....PYLLEED.---------...................EFSISc..dKRRKVTIGEYVQS.LL.......SDDKYFN..T..VLPRLPIKIK-----nvy.................................................................
H9JWH7_BOMMO/10-175                  ..................................................KSIRGTNPQYLIEKIIRSRIYDS.KYWKEECFALT.......................................A........-ELVVDKAME-..LRYVGG..............-VHG.GFI...........................................YP.TPFLCLVLKM.LQIQ.PEKD..........IVVE.FIK...............................................NEEFKYVRA............L....GAFY...M.....RLTGT........................SVDC....YKYL.E.....PLYNDNR.KLRRQNRDG...................-----....QYEIVHMDEFIDE.LL.......REERLCD..I..IMPRIQNRHILEQN-n...................................................................
M0Z3R6_HORVD/3-165                   ..............................................lqts----GRPIEVLMEKVLSMNIVSS.DYFK-ELYKIK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKL.FTMK.LTVN..........QMHG.LLK...............................................HPDSPYIRA............I....GFLY...L.....RYAAD........................PKTL....WTWY.E.....PYIQDDE.---------...................EFSPG...sNGKMTTMGVYVRD.VI.......LGQYYFD..S..LLPRVPL--------lilrqv..............................................................
J3JTY1_DENPD/10-175                  ..................................................KSIHGTNPQYLVEKIIRSRIYDS.KYWKEECFALT.......................................A........-ELLVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IVVE.FIK...............................................NEEFKYVRA............L....GAFY...M.....RLTGS........................SLDS....YKYL.E.....PLYNDNR.KLRRQNRQA...................-----....QFELVHVDEFIDE.LL.......REERVCD..V..ILPRLQKRHILEEN-n...................................................................
Q5B458_EMENI/20-200                  ................................................pl--VRGLNPAMLFEKAVRDRITES.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTFIGG..............-TYG.VSE...........................................KA.SPFLCLAFKL.LQIN.PDRD..........IIME.YLNfsdpenetdgaded...................ttaedraqrsvvkhRGDFKYLRA............L....AAFY...V.....RLTWE........................PVEI....YKTL.E.....PLLLDYR.KLKR-----...................-----....--------RFVDD.LL.......TKDRMCG..T..SLWKLPSRQQLEDL-d...................................................................
Q4YX53_PLABA/179-341                 ...............................................lem----TNTSTYNVNNLLRNNILSS.EYFR-SLITLK.......................................T........FKEVLDEILSY..ADHAEP..............YCIG.STR...........................................AP.STLFCCLYKL.FTMH.LSKK..........QLKS.LIE...............................................NKESCYVRA............C....GFLY...L.....RYVHS........................PSNL....WMWF.E.....PYLLDDE.---------...................EFTVSa..dKRKLMTIGEYAQS.LL.......YDDKYFN..T..VLPRFPIKIK-----niy.................................................................
E6ZP67_SPORE/10-174                  .................................................v-SIHGTNPQFLIEKPVRARIYES.PFWKEHCFALS.......................................A........-ATILPLATS-..LHHIGG..............-LVG.-LQ...........................................RP.SHFLCLLQKL.LQIQ.PEPA..........IVSA.YLG...............................................ARQFKYLRA............L....AAFY...V.....RLTYK........................STDI....YTLL.E.....PLLEDGR.KLRWRGSGG...................-----....EFSIVHMDEWIDM.LL.......AEERVCD..I..ILPRLTRRDVCETR-d...................................................................
L7M882_9ACAR/14-198                  .................................................l-PLWGNDKTMNLNNLILTNILSS.PYFKVNLYKLK.......................................T........YHEVVDEIYYN..VQHLEP..............WEKG.SRKtsgqtgmcg.........................gvrgvgaggIV.STAFCILYKL.FTLK.LTRK..........QLVG.LLN...............................................HCDSPYIRA............L....GFMY...I.....RFTQP........................PADL....IDWY.E.....PYLDDEE.---------...................ELDVKa..gGGQVLRIGDMLRH.ML.......TKLEWFA..T..LFPRIPVPIQKEIE-r...................................................................
D6WU66_TRICA/10-175                  ..................................................KSIHGTNPQYLVEKIIRSRIYDS.KYWKEECFALT.......................................A........-ELLVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IVVE.FIK...............................................NEEFKYVRA............L....GAFY...M.....RLTGS........................SLDC....YKYL.E.....PLYNDNR.KLRRQNRQA...................-----....QFEIVHMDEFIDE.LL.......REERVCD..V..ILPRIQKRIVLEES-n...................................................................
Q7RLR8_PLAYO/1-56                    .................................................m-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....----...-.....-----........................----....--WF.E.....PYMLDDE.---------...................EFTVSa..dKRKLMTIGEYVQS.LL.......YDDKYFN..T..VLPRLPIKIK-----niyga...............................................................
M3SAC5_ENTHI/2-162                   .............................................sgper----------RLETILRNKIYNC.EYWKQQCFTLT.......................................S........-ETILDEIVK-..LHDFGG..............-TYG.VLK...........................................KP.TKFIVLIMKL.LMLR.PDKS..........IIYE.YIM...............................................NEEFKYVRV............I....GAFY...L.....RLIGS........................SKEC....YQFI.E.....PLYYDYR.PLKYRIDSK...................-----....HYEIITIDQFAWN.LL.......HLDYYCD..I..TLPIITPRPVIE---shg.................................................................
X2JF51_DROME/24-141                  .................................................l-PFWGNESSMNLNALILANIQSS.SYFKVHLFKLK.......................................T........YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg.........................gvrgvgaggIV.STAYCLLYKL.YTLR.LTRK..........QING.LLN...............................................HTDSAYIRA............L....G---...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------rcw.................................................................
Q01G50_OSTTA/1-144                   .................................................m-----------------------.TYWKEKCFGVS.......................................A........-EALVDLAVD-..LRSVGG..............-IYG.GNN...........................................RA.TEFLCLTLKL.LQIQ.PEKE..........IVLE.FIK...............................................NEDHKYVRL............L....GAFY...L.....RLVGK........................PTDV....YRYL.E.....PLLNDYR.KVRYRTRDG...................-----....KYALTHVDEFVNN.LL.......TKDMFCD..V..TLPRVPHRQVLEA--ag..................................................................
Q86IV3_DICDI/48-212                  ..................................................KSIHGVNPRNLIEKITRIKIQSH.PYWKEKCIGLN.......................................E........-ESLVDRAMA-..LESYGG..............-CFG.GNK...........................................QP.THFLCLLLKM.LQIQ.PEMD..........IIKE.FIE...............................................NEDFKYVRI............L....GAIY...L.....RLVGK........................PVDI....YNQL.D.....PLYKDFR.ALRRKTDMG...................-----....-STKVFVDQFIEE.LL.......TTNYSCD..I..ALPHIPSRANLIQ--qs..................................................................
J9JZ53_ACYPI/30-214                  .................................................m-PVWGNERTMNLNTLILTNIQSS.HYFKVNLYELK.......................................T........YHEVIDEIYYK..VQHLEP..............WEKG.SRKtsgqtgmcg.........................gvrgvgaggIV.STAFCLLYKL.FTLK.LTRK..........QVTG.LIT...............................................HCDSPYIRA............L....GFMY...I.....RYTQP........................PGDL....WDWY.E.....SFLDDEE.-----EMDV...................--RAG....GGQTMTIGNILKS.FL.......FKLEWYS..T..LFPRIPVPIQQQM--ek..................................................................
U4L199_PYROM/27-190                  .................................................e-TIHGGNPLLLVEKIIRDRILDS.LYWKELCFGLN.......................................A........-ATLLDRATE-..LTYLGG..............-TY-.SNQ...........................................KP.TPFICLLLKL.LQLQ.PEKP..........ILLA.YLQ...............................................DPEFKYLRC............L....AALY...I.....RLTWK........................TVEI....FQTL.E.....PLMGDYR.KVRIRGMGG...................-----....-WRLGYVDEFIDS.LL.......VEERVCD..I..ALPRMMTRAQLED--lg..................................................................
W2R409_PHYPN/9-173                   .................................................q-SVHGVNPQTLVEKIMRNRIYAS.IYWKEQCFGLT.......................................A........-ETLVDKAVE-..LQEFGG..............-TFG.GNQ...........................................QP.THFLCLLLKM.LQLQ.PELE..........VVKQ.FIE...............................................NEDYKYVTV............L....GAVY...L.....RLVGK........................PLEV....YTLL.E.....PLLSDYR.KIRKRNVIG...................-----....-WEITHVDEIADA.LL.......HEEYYID..L..ALPRLADRELLEKN-e...................................................................
V9I991_APICE/37-156                  .................................................l-PLWGNERTMNLNPLILTNIQSS.HYFKVNLYELK.......................................T........YHEVIDEIYYK..VSHLEP..............WEKG.SRKtagqtgmcg.........................gvrgvgaggIV.STAYCLLYKL.FTLR.LTRK..........QLNG.LIN...............................................HPDSPYIRA............L....GFMY...I.....R----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------....................................................................
B9G228_ORYSJ/10-169                  ..................................................KSIHGTNPQNLVEKIVRSKIYQS.TYWKEQCFGLT.......................................A........-ETLVDKAME-..LDHTGG..............-TYG.GNR...........................................KP.TPFLCLALKM.LQIQ.PDKD..........IVVE.FIK...............................................NEDYKYVRV............L....GAFY...L.....RLTAT........................VADV....YQYL.E.....PLYNDYR.KIRHKLSDG...................-----....KFTLTHVDEFIDD.LL.......TKDYSCD..T..ALPRIQKR-------y...................................................................
W4IFC1_PLAFA/11-175                  ...............................................knf----GSNPQYLISNIIRSKIYDS.PYWKEKCFALT.......................................S........-ESIIDQAIN-..LKYVGG..............-TYG.GNR...........................................KP.TRFLCLILKL.LQIQ.PDKD..........IIYE.YIK...............................................NEDFVYLRA............L....GIFY...L.....RLIGK........................SLEV....YNHL.E.....PILFDYR.KIRMRLQNG...................-----....TFEKIYMDVFVDN.CL.......ILNNFLD..V..DFPTLTKRQVLEEN-n...................................................................
K1Q5L4_CRAGI/7-191                   ................................................lp--NWGNEKTMNMNPLILTNIQAS.PYFKVNLYELK.......................................T........YHEVIDEIYYK..VDHLEP..............WEKG.SRKtagqtgmcg.........................gvrgvgaggIV.SSAYCLLYKL.YTLK.LTRK..........QLMG.LIT...............................................HKDSPYIRG............L....GFMY...I.....RYCQD........................PKDM....WDWY.E.....PYLDDEE.---------...................EIDVKa..gGGHKMTMGEVLRQ.WM.......VKLEWYS..T..LFPRIPVPIQKD---lmq.................................................................
M1C6B4_SOLTU/5-167                   ..........................................ktsgrpid---------QLLEKVLCMNILSS.DYFR-DLLRLK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HPDSPYIRA............I....GFLY...L.....RYLGD........................FKTL....WGWY.E.....PYLKDDE.---------...................EFSPG...sSGQMTTMGVYVRD.LF.......LGQYYFD..T..LLPRIPVPVV-----rtav................................................................
X6NM44_RETFI/10-176                  .................................................r-QMHGTNPQWLVDKMIRGKVYDS.LYWKEHCFALT.......................................A........-ELLIEKVIKH..VRYVGG..............-MHG.GMK...........................................RP.CEFLCLLIKL.LQIQ.PKKE..........IIIE.FIK...............................................QKEFKYLRI............L....SAFY...F.....RLIYD........................SVEI....YTYL.E.....PLLNDYR.KIVEIDRNG...................-----....KFHLTHVDEIIDQ.FL.......QERFLFG..I..NLPHLIDRSVLEKN-g...................................................................
A0A015NFA3_9GLOM/10-174              .................................................i-AVHGTNPQYLIEKIMRTRIYES.LYWKEFCFGLT.......................................A........-ETLIDRAIE-..LTSFGG..............-EYG.-NQ...........................................KP.TEFLCLTLKL.LQLQ.PNKD..........IVME.FIR...............................................NEDYKYLRV............L....GAFY...L.....RLVGN........................SLEI....YQTL.E.....PLLNDYR.KLRKRTSEG...................-----....DFEIVCVDEFIEE.LL.......KEERVCD..T..ILPRMLKRHVLEEN-g...................................................................
B8C555_THAPS/10-167                  .................................................h-SVHGTNPQNLVEYITRQKIYDS.LYWKEECFGLS.......................................A........-SDVATKATD-..LKALGG..............-SYG.GNN...........................................KP.TRFLCLALKL.LQIQ.PEEG..........IVEE.FLE...............................................NEEFKYVRA............L....GAFY...L.....RLTGR........................PAEI....YELI.E.....PLFNDFR.KLRFRESTG...................-----....-WKVTYMDELADE.LL.......TSDRYCG..I..ALPHLPKR-------....................................................................
F6V7L2_ORNAN/39-223                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
F2UNQ1_SALR5/10-175                  .................................................r-SVHGTNPQFIVDKIIRSRIYET.LYWKEQCFALT.......................................A........-ETVIEKAVE-..LTYVGG..............-VYG.GNI...........................................RP.TPFLCLTLKL.LQLQ.PDKD..........IIIE.YIK...............................................NEDFKYLRA............L....GAFY...L.....RLVGT........................SMDC....YRYI.E.....PLLNDYR.KLKRMSRNG...................-----....VMELTHMDEFVDE.LL.......REDRVCD..I..GLPRIQKRYALEVN-d...................................................................
S6C9M3_BABBO/10-175                  ................................................vm--VHGTNPQNLFSKILRDKVYNS.MYWKESCFGLT.......................................A........-ESIIDKAID-..LQYIGG..............-TFG.GNR...........................................QP.SPFLCLVLKL.LQIQ.PEIE..........IIQE.YIR...............................................NEEFKYLRA............L....GIYY...M.....RLVGN........................AVQI....YQNL.E.....PVYADYR.KLRFRNNDG...................-----....SYDIRHMDEFVDD.CL.......RLSSYLD..V..DLPILPKRMILEET-k...................................................................
A0A023BDW0_GRENI/56-217              ...............................................lem----TNTTSYNLNPMLKENILVS.EYYK-SLYQFT.......................................T........VPELIDEVVQY..VDHVEP..............HVTG.HLK...........................................IP.STFACCLYKL.FNLR.CTED..........EMLT.ITE...............................................HPNL-FVRT............L....GFVW...L.....RFVHP........................PEKL....WQWF.E.....TVVLDDT.---------...................DFRPT....KNQTTTFGEFAES.LL.......KEDRYFN..T..PLPRLPAKIRTHT--nk..................................................................
C4WV68_ACYPI/10-175                  ..................................................KTIHGTNPQYLIEKIIRSRIYDN.KFWKEECFALS.......................................A........-ELLVDKAML-..MRFIGG..............-VFG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEEFKYVRA............L....GAFY...M.....RLTGS........................SVDC....YKYL.E.....PLLADSR.KLRRQNRDG...................-----....QFELIYIDEFIDS.LL.......RDERVCD..V..ILPRIQSRHVLEEN-n...................................................................
W4ZVL3_WHEAT/3-167                   ...............................................iqt---SGKPIDMLMEKVLCMNILSS.DYFK-ELYRMK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HPDSPYIRA............I....GFLY...L.....RYVAD........................PKIL....WTWY.E.....PYLKDDE.---------...................EFSPG...sNGRMTTMGVYVRD.LI.......LGQYYFD..S..ILPRVPVPVVR----qvtt................................................................
G4N721_MAGO7/23-190                  ...............................................lap---NGLNRARIMEKAVVDRITES.YFWKEQCFGVN.......................................E........-ADIVDRVVDH..VTYIGG..............-VVG.QSQ...........................................KP.TPFLCLAFKL.LQLG.PDDS..........ILAE.YLKf.............................................gGEKFKYLRA............L....AIFY...V.....RLTRT........................SADV....FRTL.E.....PFLEDRR.KLRRKGRAG...................-----....-TSLTYMDEFADD.LL.......TKDRVCA..T..SLFKLTRRDVLEDL-d...................................................................
G5BQU6_HETGA/49-233                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
H0XNF3_OTOGA/49-233                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
G3JII3_CORMM/24-191                  ...............................................lap---NGLNPATIMEKAVKDRITDS.YFYKEQCFALN.......................................E........-ADIVDRVVEH..VRFIGG..............-TSG.MTQ...........................................KP.SPFLCLAFKL.LELS.PSDA..........VIAE.YLAy.............................................gGEHFKYLRA............L....ACFY...L.....RLTRQ........................AKDV....YATL.E.....PFLEDRR.KLRRRGRDR...................-----....-TTLTYVDEFVDD.LL.......TKDRVCA..T..SLWKMPKREILEDL-e...................................................................
B4L223_DROMO/28-212                  .................................................l-PLWGNETSMNLNPLILANIQSS.SYFKVHLFKLK.......................................T........YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg.........................gvrgvgaggIV.STAYCLLYKL.YTLR.LTRK..........QVNG.LLN...............................................HTDSAYIRA............L....GFMY...L.....RYTQP........................PGDL....YDWY.E.....DYLQDEE.---------...................EIDVKa..gGGQVMTIGQMVYQ.FM.......TKLDWFS..T..LFPRIPVPIQKQIE-k...................................................................
I1F011_AMPQE/9-103                   ...................................nsekipihidvlmlc-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.----------.----.----..........----.---...............................................---SKYVRA............L....GSLY...L.....RIVGT........................SVEC....YKYL.E.....PLYNDYR.KIKYKNRQG...................-----....KFELSHVDEFVDS.LL.......REDRVCD..V..ILPRIQKRHILEET-e...................................................................
Q29IQ7_DROPS/30-214                  .................................................l-PFWGNETSMNLNPLILANIQSS.SYFKVHLFKLK.......................................T........YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg.........................gvrgvgaggIV.STAYCLLYKL.YTLR.LTRK..........QING.LLN...............................................HTDSAYIRA............L....GFMY...L.....RYTQP........................PGDL....YDWY.E.....DYLQDEE.---------...................EIDVKa..gGGQVMTIGQMVYQ.FM.......TKLDWFS..T..LFPRIPVPIQKQIE-r...................................................................
B5VJ21_YEAS6/15-219                  ..................................................KQLNNQSVSLVIPRLTRDKIHNS.MYYKVNLSNES.......................................Lrg....ntMVELLKVMIGA..FGTIKGqng.......hlhmMVLG.GIE...........................................--.--FKCILMKL.IEIR.PNFQ..........QLNF.LLNvk..........................................nenGFDSKYIIA............L....LLVY...A.....RLQYYylngn.............nkndddENDL....IKLF.Kvq.lyKYSQHYF.KLKSFPLQVdc...............faHSYNE....ELCIIHIDELVDW.LA.......TQDHIWG..I..PLGKCQWNKI-----ynsde...............................................................
G7E6U1_MIXOS/10-174                  .................................................v-SIHGTNPQFLIETTIRYRIWDS.NFWKEHCFALT.......................................A........-ESIIDRAVA-..LNYIGG..............-TYG.ASK...........................................-P.TDFLSLTLKM.LQIQ.PSKE..........IVLE.YLR...............................................AEEFKYLRA............L....AIFY...I.....RLTFD........................AMEV....YEIL.E.....PLLEDYR.KLRYRQLDG...................-----....SYSIMTIDAFVDS.LL.......TEERVCE..I..QLPRLTLRRVLEET-e...................................................................
B7FY05_PHATC/41-205                  .................................................l-PLWGAPDSFHFNPLLLRNTVRS.LYFQKCCEKLL.......................................D........WNAVVDEIYYE..VKYLQP..............FAL-.-DK...........................................SP.STAFCLLLRL.LTLR.VTNH..........QMEL.TLK...............................................HTDSPYIRG............I....GFLY...L.....RYAGP........................PEQI....WSFI.E.....SSLQDEE.ELVIEAGHR...................-----....-GKRSTIGQFVRS.LF.......SSRDFYG..T..SLPRLPIQTERD---iq..................................................................
C6LNE4_GIAIB/1-137                   ..................................................-----------MEHTTRRAILNS.PLYLMEFKHLG.......................................V........IGLLKDVLLT-..-RNIDL..............-KYG.--R...........................................EP.SRFLCALVRL.YMLH.PDRS..........IVNE.MLS...............................................VRNFAYANA............F....AAIH...V.....RCYWP........................SLDI....HKAL.T.....PLMSNYT.KIHVSGLES...................-F--G....LQGHIPLDVLIEA.LL.......-------..-..---------------wqsta...............................................................
F7ALV5_CALJA/25-209                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
M7YUL5_TRIUA/10-175                  .................................................r-SIHGTNPQNLVEKIVRAKIYQS.NYWKEQCFGLT.......................................A........-ETLVDKAME-..LDHTGG..............-THG.GNR...........................................RP.TPFLCLALKM.LQIQ.PDKE..........IVVE.FIK...............................................NEDYKYVRV............L....GAFY...L.....RLTGT........................VADV....YQYL.E.....PLYNDYR.KIRQKLSDG...................-----....KFTLTHVDEFIDE.LL.......TKDYSCD..T..ALPRIQKRWILEA--sg..................................................................
A0A016WJT5_9BILA/10-175              .................................................h-TVRGTNPQFLIEKIIRQRIYDS.KYWKEYCFALS.......................................A........-DLVVDRALE-..LRYIGG..............-IYA.GNV...........................................KP.TPFLCLSLKM.LQIQ.PEKD..........IIIE.FIQ...............................................QEQSKYARA............L....GAMY...L.....RLTFT........................SVEI....YKYL.E.....PLFNDYR.KLRYMNKQG...................-----....RFELVYMDEFIDN.LL.......REERYCD..I..QLPRLQKRQALEE--vg..................................................................
A8IDN7_CHLRE/1-167                   .................................................m-EIHGSNTTFNLENVLRQNILSS.DYYKGTCSELS.......................................N........CSDIVDEIYES..VDHVEP..............WMSG.NAR...........................................GP.STAFCLLHRL.FTLK.LSAK..........EVKG.MLD...............................................HKDSPYIRA............V....GFLY...L.....RYVGD........................PKTL....WSWV.A.....PYVKDQE.---------...................KFSPSg..pNEKEVAMGDYVRD.LL.......LSQYYFE..T..IFPRIPKPVQDQIN-d...................................................................
A0A016STJ3_9BILA/62-272              .................................................l-PIWGNQQTMNLNGLVLENVKES.YYYKNHLVEID.......................................S........AQQLLDEVFYK..VKHLEP..............WEKG.TRKvqgmtgmcg.........................gvrgvgaggVV.SSAFCLLYRF.FKVR.LTRK..........QLIS.MIN...............................................SRVSPYIRG............L....GFMY...I.....RYTQP........................PADL....WEWF.E.....PYLVGCL.--SSIGKGNygfplstidahpffkddeeEIDPRs..gGGDIMTFGQVVRI.ML.......TKLDWYG..T..LFPRIPVPIQKEID-e...................................................................
A0A023AF08_TRIRU/20-222              ................................................pl--IRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTYIGG..............-TYG.VGQ...........................................KP.TPFLCLAFKL.LQLA.PEKE..........VILE.YLNfhdpeadeedlkvrgdstd.........adggagdaqdradaailkaTGDFKYLRA............L....AAFY...I.....RLTFE........................PVEI....YKTL.E.....PLLTDYR.KLKRRTKEG...................-----....-FLLTYMDQFVDD.LL.......TKDRVCG..T..SLWKIPTRTILEDL-d...................................................................
M2Y140_GALSU/5-87                    .................................................l-EIYGNKKTFNFPEKVISNVLRS.PYFR-SLYELK.......................................T........FNQVVDEIYNQ..VSYLEP..............WVAGkGVG...........................................TP.SSAFCLLYKL.FTLK.LS--..........----.---...............................................---------............-....----...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------gvgvsv..............................................................
A2G7A6_TRIVA/40-205                  ................................................ky--VRGVAPQHLIDTSTRHRIYNS.VYWQQHCFGVN.......................................L........-LTLVDRAQS-..LKGVGG..............-VYG.LFR...........................................EP.CNFICLFLKL.LELE.PSKK..........VIEG.FLNt.............................................kSWQMKHLRL............L....AALY...V.....RFVFP........................AEEV....YLIL.E.....GLLGQYF.KVAVLREEG...................-----....-FKVEYFDTVIYS.FL.......HDKFWCG..I..TFPPLTPRNNL----ppr.................................................................
G3N166_BOVIN/47-231                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
W5DUT1_WHEAT/1-85                    ..................................................-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.----------.----.----..........-MHG.LLK...............................................HPDSPYIRA............I....GFLY...L.....RYAAD........................PKTL....WTWY.E.....PYIQDDE.---------...................EFSPG...sNGKMTTMGVYVRD.VI.......LGQYYFD..S..LLPRVPL--------lilrqvt.............................................................
A7APG3_BABBO/171-333                 ...............................................ldm----TNSSTYNMNTLLLNNILNS.DYYK-SLSTMT.......................................S........HHSIIDELAQY..ADHVEP..............YCKT.ATR...........................................VP.STLFCCLHKL.FTLR.LTER..........QMED.LID...............................................CTKSPYPRC............C....GFLY...L.....RFVLP........................SDQL....WAWF.E.....PYLMDEE.---------...................TFVMSv..nPTRKTTIGKFCES.LL.......VEDRYFN..T..VLPRLPSRFK-----nmy.................................................................
T1HNK6_RHOPR/10-175                  ..................................................KSVRGTNPQFLIEKIIRSRIYEC.KYWKEECFALS.......................................A........-ELIVDKAME-..LRFLGG..............-VYG.GNV...........................................KP.SPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEEFKYVRA............L....GALY...M.....RLVGT........................SIEC....YKYL.E.....PLLNDGR.KLRNQTRDG...................-----....KFVMIHMDEYIDG.LL.......HEERMFD..I..ILPRIQKRHVLEEA-n...................................................................
Q7JVL3_DROME/10-175                  ..................................................KNVHGTNPQYLIEKIIRSRIYDS.KYWKEQCFALT.......................................A........-ELLVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TQFLCLTLKM.LQIQ.PEKD..........IVVE.FIK...............................................NEEFKYVRA............L....GAFY...L.....RLTGA........................ALDC....YKYL.E.....PLYIDNR.KLRRQNRAG...................-----....QFEIVYMDEYIDE.LL.......RNDRVCD..I..ILPRIQKRSILEEN-n...................................................................
E9DBR1_COCPS/20-209                  ................................................pl--VRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LGYIGG..............-TYG.ANQ...........................................KP.TPFLCLAFKL.LQLA.PERE..........VVLE.YLNfhdpaeddddng......................deddgdgaavlksVGDFKYLRA............L....AAFY...I.....RLTFE........................PVEV....YNVL.E.....PLLSDYR.KLKRRTKDG...................-----....-FVLTYMDQFVDD.LL.......TKDRVCG..T..SLWKLPARRILEDL-d...................................................................
Q3LVY1_BIGNA/2-154                   ................................................ds---------------VDKRIKKS.YFWKIYLESID.......................................F........-EKWLLMALN-..LSSIGC..............FLK-.NGK...........................................YP.TKFICLVIKL.HEFK.PSFS..........MIKE.FIK...............................................NDSNLIIRL............L....GAFY...I.....RLYYR........................PLLI....YKLL.E.....PLYYDYR.RVPVQ----...................-IDHS....KTKMICVDIIIDS.LL.......NKTYVMG..I..KLNSLVKRLNKSI--kk..................................................................
K7ULE7_MAIZE/2-80                    ...............................................tvl-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.----------.----.----..........----.---...............................................----RYLVQ............I....GFLY...L.....RYVAD........................PKVL....WMWY.E.....PYLRDDE.---------...................EFSPG...sNGRKTTMGVYVRD.LI.......LGQYYFD..S..LLPRIPLPVTRQ---ita.................................................................
W7AWH2_PLAVN/10-175                  ...............................................ikt---FGSNPQYLISNIIRNKIYDS.PYWKEKCFALT.......................................S........-ESIIDQAVS-..LKYVGG..............-TYG.GNR...........................................KP.TRFLCLVLKL.LQLQ.PDKD..........IIYE.FIK...............................................NEEFIYLRA............L....GIFY...L.....RLVGK........................GIEI....YKNI.E.....PILFDYR.KIRLRLQDG...................-----....SFQKIYMDVFADN.CL.......VFNNFLD..V..DFPALTKRIVLEEN-n...................................................................
T1E7P8_ANOAQ/10-175                  ..................................................KNVHGTNPQYLIEKIIRSRIYDS.KYWKEQCFALT.......................................A........-ELLVDKAME-..LRFVGG..............-VFG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IVVE.FIK...............................................NEEFKYVRA............L....GAFY...L.....RLTGS........................SLDC....YKYL.E.....PLYNDNR.KLRKQNRMG...................-----....AYELIHVDEFIDE.LL.......REERVCD..I..ILPRIQKRHVLEEN-n...................................................................
L5K4Z1_PTEAL/49-233                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
T1EG64_HELRO/7-191                   .................................................l-PIHGNEKTMNLNSLVLANIQAS.PYFKVHLYELK.......................................T........YHKVIDEIYYK..VNHLEP..............WEKG.SRKlagqtgmcg.........................gvrgvgtggIV.SSAYCLLYKL.YTLK.LTRK..........QLIG.LCT...............................................HTDSSFIRA............L....GLMY...I.....RYTQP........................PNTF....WEWL.E.....PYLDDDE.---------...................EVDPKa..gGGNNMTIGEMCEQ.LL.......LKLDWYG..T..LFPRIPVPIQKDIE-n...................................................................
W2X6R7_PHYPR/37-201                  .................................................l-PIYGNDTTYNLNTLLHQNILQS.AYFH-ELYKFR.......................................T........YHEVVDEIYYR..VDHAEP..............WSPG.TAR...........................................IP.SSCFCLLHKF.FLMR.LTRK..........QMQG.LLR...............................................HTDSPYIRV............V....GFLY...L.....RFTCD........................PEEL....WTWF.E.....PFLEDPE.---------...................EFNASa..nPSVKTTIGEWLIS.LL.......EENNYFG..T..ILPRIPKKIE-----dgik................................................................
E1C6A8_CHICK/10-175                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LKYVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HEERVCD..I..ILPRLQKRYVLEEA-e...................................................................
C5K487_PERM5/81-218                  .......................................hnkhnngckkc-----------------------.----------R.......................................E........YKEWVVATLN-..VGNIRN..............---G.SLT...........................................VP.STMFCCLYRL.FVMR.INSK..........VLGQ.LIN...............................................YHGAPYVRC............A....GFLY...V.....RFGLS........................PRDY....WSFL.Q.....PHLLDDE.---------...................EFTPGc..dKGRIITMGEYVEK.LL.......TEDRYYS..L..L--------------iiarlrsieei.........................................................
K7V8Q5_MAIZE/76-246                  ..............................................iqss----GRSIEGLMDKVLSVNILSS.DYFK-ELFKYK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.SSAFCLLYKLlFTMK.LTVK..........QMHG.LLK...............................................HQDSPYIRA............D....AKCFrniV.....RSQAV........................SRNI....VNAI.RevldaPATADAR.VAKMLLAEE...................-----....-------------.--.......-------..-..---------------mknevskeyflktvrnivgdkllkqaasqyqm....................................
M1CAV6_SOLTU/10-175                  ..................................................KSIRGTNPQNLVEKILRSKIYQN.TYWKEQCFGLT.......................................A........-ETLVDKAME-..LDHLGG..............-TFG.GNR...........................................KP.SPFICLVMKM.LQIQ.PEKD..........IVVE.FIK...............................................NEDYKYVRV............L....GAFY...L.....RLTGT........................DIDI....YRYL.E.....PLYNDYR.KLRRKLADG...................-----....QYALTHVDEYIDE.LL.......TTDYSCD..I..ALPRIKKRWILEQN-k...................................................................
W8C0X7_CERCA/22-206                  .................................................l-PLWGNEATMNLNPLILANIQGS.SYFKVHLFKLK.......................................T........YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg.........................gvrgvgaggIV.STAYCLLYKL.YTLR.LTRK..........QVNG.LLN...............................................HTDSPYIRA............L....GFMY...L.....RYTQP........................PADL....YDWY.E.....DYLQDEE.---------...................EIDVKa..gGGQVITVGQMVYQ.FL.......TKLDWFS..T..LFPRIPVPIQKQIE-k...................................................................
D3BAL0_POLPA/67-159                  ..................................................KTVHGKNPTSLVEKIVRIKIQSH.PYWKEKCMGLN.......................................E........-STLVDRAMS-..LNSFGG..............-TFG.GNK...........................................QP.THFLCLMLKM.LQIQ.PSMD..........IVVE.FIT...............................................NEDFKYLE-............-....----...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------pl..................................................................
W3XIF8_9PEZI/20-186                  ................................................cp---NGMNPATLLEKAMIERIIDS.FYFKDACFGLN.......................................E........-ADIVDRVVSH..VTFVGG..............-TYG.SSQ...........................................KP.TPFLCLLFKL.LQLG.PGDD..........VLGE.YLSf.............................................gGERFKYLRA............L....AAFY...I.....RLTRR........................SEDV....YKTL.E.....PFLEDRR.KLRRKGAQG...................-----....-TTLTFVDQFVDD.LL.......TKDRVCG..T..TLWQLTKRELLEDL-e...................................................................
E2AHT2_CAMFO/35-218                  .................................................l-PLWGNERTMNLNPLILTNIQSS.HYFKVNLYELK.......................................T........YHEVIDEIYYK..VSHLEP..............WEKG.SRKtagqtgmcg.........................gvrgvgaggIV.STAYCLLYKL.FTLR.LTRK..........QLNG.LIN...............................................HPDSPYIRA............L....GFMY...I.....RYTQP........................PADL....FSWY.S.....DYLEDEE.---------...................ELDVKa..gGGQTMKMGDILKQ.FL.......TKLEWFS..T..LFPRIPVPIQKD---le..................................................................
X0MXW1_FUSOX/25-192                  ...............................................vap---NGLNPATIMEKAVKDRIVDS.YFYKEQCFALN.......................................E........-ADIVDRVVEH..VNFIGG..............-TYG.VTQ...........................................KP.SPFLCLAFKL.LELS.PSDA..........VLME.YLKy.............................................gGEAFKYLRA............L....ACFY...F.....RLTRQ........................AKDV....YEML.E.....PFLEDRR.KLRRRGRAG...................-----....-VVLTFMDEFVDE.LL.......TKERVCG..T..SLWKMPKREVLEDL-e...................................................................
I3MQ15_SPETR/10-175                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
E9AIG4_LEIBR/4-150                   ..........................................nlkgraai---------AALDPPTRHRVLHS.QTMT-RCANKP.......................................L........-LWVLEELTT-..LRSLGG..............-LTG.PLH...........................................RA.NYFICLVVRL.LQIC.PSVA..........IARV.MLE...............................................QDVHKYLRA............A....ALLL...I.....RFIGN........................MELQ....REAM.H.....VGWSDYR.KLCLYGSDP...................-----....-------------.--.......-------..-..---------------aqewkestsatvagaggmatd...............................................
H2ZFB4_CIOSA/10-175                  ................................................yt--IKGTNPQYLIEKIIRSRIYDS.RYWKEQCFALS.......................................A........-ELLVDKAME-..LKYVGG..............-VYA.GNI...........................................KP.SPFLCLILKM.LQIQ.PDKD..........IIVE.FIR...............................................NEDFKYVRC............L....GAFY...M.....RITGK........................SLEC....YKYL.E.....PLLNDFR.KIKFQKRDG...................-----....NFVVTHMDEFIDE.LL.......REERSCD..V..ILPRIQKRQILEEL-e...................................................................
J3K9F1_COCIM/20-209                  ................................................pl--VRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LGYIGG..............-TYG.ANQ...........................................KP.TPFLCLAFKL.LQLA.PERE..........VVLE.YLNfhdpaeddddng......................dedggdgaavlksVGDFKYLRA............L....AAFY...I.....RLTFE........................PVEV....YNVL.E.....PLLSDYR.KLKRRTKDG...................-----....-FVLTYMDQFVDD.LL.......NKDRVCG..T..SLWKLPARRILEDL-d...................................................................
M4BIY1_HYAAE/37-167                  .................................................l-PINGNDTTYNLNTLLHQNILQS.AYFH-ELYKLK.......................................T........YHEVVDEIYYR..VDHAEP..............WSPG.TAR...........................................IP.SSCFCLLHKF.FLMR.LTVK..........QMQG.LLR...............................................HTDSSYIRV............I....GFLY...L.....RYTCD........................PEKL....WTWF.E.....PYLEDVE.---------...................-----....-------------.--.......-------..-..---------------efnasanpsl..........................................................
U9UJB9_RHIID/7-167                   .................................................l-ETWGSETTMNLNNILYQNIQAS.PYFK-HLYELK.......................................T........YHEVIDEIFN-..---HEP..............FLKG.TTA...........................................--.STAFCLLYKL.WTLR.LTVK..........QVNG.LIE...............................................HTDSPHIRA............L....GFLY...L.....RYVCK........................PIHL....WEWF.E.....EYLDDEE.EVQIQGGP-...................-----....RPVIITIGKMCRQ.LL.......TEQKWLG..T..ILPRIPVPIAREIE-q...................................................................
W5MMD1_LEPOC/32-216                  .................................................l-PLWGNEKTMNLNPMILTNVLSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHIEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PADL....MDWF.D.....SFLDDEE.---------...................ELDVKa..gGGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKLI--dq..................................................................
G0TR81_TRYVY/9-151                   ................................................wn--LKGRSAVASIDPPTRHRILQS.NAML-SCAHRS.......................................L........-LAVLETLIS-..VEYVGG..............-LSG.PLK...........................................KP.ELFVCLIVRI.LQIA.PSPS..........VVLA.MLQ...............................................QDVHKYLRV............A....ALFI...I.....RLIGN........................AAMM....QEAL.R.....IGWMDYR.KIRVYCSDA...................-----....-------------.--.......-------..-..---------------ergdamregksaesne....................................................
K2N6A4_TRYCR/38-206                  ................................................wn--LKGRSAVAALDPPTRHRIMQS.HAMA-SCFHKP.......................................L........-LATLEVLIT-..VQYVGG..............-ITG.PLQ...........................................KP.EPFICHVTRL.LQIT.PDPS..........IVLA.MLH...............................................QDVHKYLRV............A....ALFI...I.....RLIGN........................EAMM....REAM.R.....VGWEDYR.KIRVYGYVE...................-----....-------------.--.......-------..-..---------------dlagttdgkentasdedegfvrapaygimcvdeitdrlfnvg..........................
L1ICQ1_GUITH/10-169                  .................................................a-SVHGTNPQFLVEKILRQKIYDD.NYWKEHLFGLT.......................................A........-ETIVDRAME-..LDHIGG..............-TFG.GNN...........................................KP.TVFIQLVLKL.LQLQ.PEKE..........IVLE.FIR...............................................NEEFKYVRA............L....GAFY...L.....RLTGR........................ALDI....YQYL.E.....PLLNDYR.KLRV-----...................-----....-ISVMYMDVFIDQ.LL.......RDPMVLD..V..ALPTLPKRLNLEDL-k...................................................................
U7PR73_SPOS1/25-192                  ...............................................vap---NGLNPATIMEKAVRERIVDS.YFWKEQCFGVN.......................................E........-ADIVDRVVEH..VSCIGG..............-TTG.TTQ...........................................KP.TPFLCLALKL.LQLA.PDDA..........ILQA.YLSq.............................................gGDKFKYLRA............L....ALFY...I.....RLTRP........................AADV....YTTL.E.....PYLADRR.KLRRKGRAG...................-----....-TQLTFVDEFVDD.LL.......VKTRVCA..T..SLWKLPQREDLED--lg..................................................................
I4DPU4_PAPXU/1-69                    ..................................................-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....--MY...I.....RYTQP........................PADL....FDWY.V.....DYLDDEE.---------...................EIDPXa..xGGGPTTIGALVRQ.ML.......IKLDWFS..T..LFPRIXVPIQKQIE-q...................................................................
C4LZA0_ENTHI/2-162                   .............................................sgper----------RLETILRNKIYNC.EYWKQQCFTLT.......................................S........-ETILDEIVK-..LHDFGG..............-TYG.VLK...........................................KP.TKFIVLIMKL.LMLR.PDKS..........IIYE.YIM...............................................NEEFKYVRV............I....GAFY...L.....RLIGS........................SKEC....YQFI.E.....PLYYDYR.PLKYRIDSK...................-----....HYEIITIDQFAWN.LL.......HLDYYCD..I..TLPIITPRPVIE---shg.................................................................
A2Q158_MEDTR/10-175                  ..................................................KSIRGTNPQNLVEKILRSKIYQH.TYWKEQCFGLT.......................................A........-ETLVDKAME-..LDHLGG..............-TYG.GNR...........................................KP.TPFMCLVMKM.LQIQ.PEKE..........IVIE.FIK...............................................NDDYKYVRI............L....GAFY...L.....RLTGS........................DTDV....YHYL.E.....PLYNDYR.KLRRKLPDG...................-----....QFALTHVDEVIDE.LL.......TTDYSCD..I..AMPRIKKRWTLES--lg..................................................................
Q28XW5_DROPS/10-175                  ..................................................KNVHGTNPQYLIEKIIRSRIYDS.KYWKEQCFALT.......................................A........-ELLVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TQFLCLTLKM.LQIQ.PEKD..........IVVE.FIK...............................................NEEFKYVRA............L....GAFY...L.....RLTGV........................ALDC....YKYL.E.....PLYIDNR.KLRRQNRAG...................-----....QFEIVYMDEYIDE.LL.......RNDRVCD..I..ILPRIQKRTILEEN-n...................................................................
F7G6K1_MONDO/12-177                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFMGG..............-VYG.STI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIR...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................ATDC....YKYL.E.....PLYNDYR.KIRIQNRNG...................-----....EFELMRMDEFIDE.LL.......HRERVCD..I..ILPRLQKRYVLEEA-e...................................................................
A1CAF4_ASPCL/20-209                  ................................................pl--IRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LSSIGG..............-TYG.VAE...........................................KP.TPFLCLAFKL.LQLN.PERD..........VILE.YLNytdpgsdeeaea......................taeeqarngvagqKGDFKYLRA............L....AAFY...V.....RLTFD........................AVDV....YKTL.E.....PLLLDYR.KLKRRVRDS...................-----....-FVLTYMDQFVDD.LL.......TKDRVCG..T..SLWKLPSRQQLEDL-d...................................................................
G9KIQ0_MUSPF/9-174                   .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
I1EAR9_AMPQE/1-144                   ..................................................----------------------C.QYWKEKCFALT.......................................A........-ELLVDEAMA-..LDYVGG..............-VVG.GNI...........................................KP.TPFLCLILKM.LQIQ.PNKD..........IVIE.FIK...............................................NPDYKYVRA............L....GALY...L.....RIVGT........................SVEC....YKYL.E.....PLYNDYR.KIKYKNRQG...................-----....KFELSHVDEFVDS.LL.......REDRVCD..V..ILPRIQKRHILEET-e...................................................................
A8X8F6_CAEBR/10-175                  .................................................k-TVKGTNPQFLVEKIIRQRIYDS.MYWKEHCFALT.......................................A........-ELVVDKGMD-..LRYIGG..............-IYA.GNI...........................................KP.TPFLCLALKM.LQIQ.PDKD..........IVLE.FIQ...............................................QEEFKYIRA............L....GAMY...L.....RLTFD........................STEI....YKYL.E.....PLYNDFR.KLRFMNKMG...................-----....RFEAIYMDDFIDN.LL.......REDRYCD..I..QLPRLQRRWALEE--vd..................................................................
C0S7Y8_PARBP/20-214                  ................................................pl--IRGVNPATLFEKAVRDRITES.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTYIGG..............-TYG.LAQ...........................................KP.TPFLCLAFKM.LQLS.PEKE..........IVLE.YLNfhdpetdhdgvygen.................nveedhdknsgvvkaVGDFKYLRA............L....AAFY...I.....RLTFD........................AAEI....YTTL.E.....PLLADYR.KLKRRTKDG...................-----....-FLLTYMDQFVDD.LL.......TKDRVCA..T..SLWKLPSRTQLEDL-d...................................................................
F6QPW1_MACMU/47-231                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
J3M4G7_ORYBR/3-166                   ...............................................iqt---SGKPIDLLMEKVLCMNILSS.DYFK-ELYRLK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HPDSPYIRA............I....GFLY...L.....RYVAD........................PKNL....WTWY.E.....PYLKDDE.---------...................EFSPG...sNGRMTTMGVYVRD.LI.......LGQYYFD..S..LLPRVPLPV------irqvt...............................................................
A0A022ZJB0_TRIRU/20-222              ................................................pl--IRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTYIGG..............-TYG.VGQ...........................................KP.TPFLCLAFKL.LQLA.PEKE..........VILE.YLNfhdpeadeedlkvrgdstd.........adggagdaqdradaailkaTGDFKYLRA............L....AAFY...I.....RLTFE........................PVEI....YKTL.E.....PLLTDYR.KLKRRTKEG...................-----....-FLLTYMDQFVDD.LL.......TKDRVCG..T..SLWKIPTRTILEDL-d...................................................................
U6PD84_HAECO/69-253                  .................................................l-PCWGNQQTMNLNGLVLENVKES.YYYKNHLVEID.......................................T........AQQLLDEVFYK..VKHLEP..............WEKG.TRKvqgmtgmcg.........................gvrgvgaggVV.SSAFCLLYRF.FKVR.LTRK..........QLIS.MIN...............................................SRVSPYIRG............L....GFMY...I.....RYTQP........................PADL....WEWF.E.....PYLDDEE.---------...................EIDPRs..gGGDVMTFGQVVRI.ML.......TKLDWYG..T..LFPRIPVPIQKEID-e...................................................................
M1W229_CLAP2/24-191                  ...............................................lap---NGLNPATIMEKAVRDRIVES.HFYMEQCFAVN.......................................E........-ADIIDRVVEH..VTFVGG..............-TYG.DSQ...........................................KP.SPFLCLAFKL.LELG.PSDE..........ILAE.YLSy.............................................gGEQFKYLRA............L....ASFY...F.....RMTRQ........................AKDI....YETL.E.....PFLEDRR.KLRRKGRAG...................-----....-TSLTYVDEFVDD.LL.......VKERVCA..T..SLWKMPKREILEDL-e...................................................................
L1J4V0_GUITH/160-321                 ..............................................kqvc------NDAYNLNPVLRENILAS.DYFK-ALAEFT.......................................T........FEELVDEIYNK..VTYATP..............-FIP.NTR...........................................SP.SSCFCLLYRL.FQMR.LTYK..........QLAD.LLE...............................................HPDSPMIPV............V....GILY...V.....RYVVD........................PKEM....WGFF.K.....NKINDST.---------...................EFDAS...pGGKKKTIGQFTRE.VI.......EDIHYFD..T..ILPRIPVAIQRDM--qe..................................................................
W2QD97_PHYPN/37-201                  .................................................l-PIYGNDTTYNLNTLLHQNILQS.AYFH-ELYKFR.......................................T........YHEVVDEIYYR..VDHAEP..............WSPG.TAR...........................................IP.SSCFCLLHKF.FLMR.LTRK..........QMQG.LLR...............................................HTDSPYIRA............V....GFLY...L.....RFTCD........................PEEL....WTWF.E.....PFLEDPE.---------...................EFNASa..nPSVKTTIGEWLIS.LL.......EENNYFG..T..ILPRIPKKIE-----dgik................................................................
G0UJS9_TRYCI/201-333                 .....................................resqrheqrveil-----------------------.-----------.......................................-........----LHYCEKN..VHYIGV..............--MN.EEG...........................................SA.SPFLLALGTF.FSLG.LTHR..........DALT.HFA...............................................RHHRRTIRA............L....ALFI...A.....RYTLP........................PEEW....EAFF.A.....PPLMDEV.VVSCA-EDH...................-----....-HVTCSMQQLCED.LL.......LRDEVCE..A..W--------------pptlhvfw............................................................
A0A022R4J6_MIMGU/5-166               ..........................................kssgrpid---------QLFEKVLSINIVSS.DYYR-DLLRLN.......................................T........YNEVIDEIYVT..VTHVEP..............WMTG.NCR...........................................GP.STAYCLLYKF.FTMK.LTVK..........QMHG.LLQ...............................................HPDSPYIRA............I....GFLY...L.....RYVAD........................PKTL....WSWY.E.....PYIKDDE.---------...................EFSPG...sNGRTTSMGAYLRD.LL.......LGQYYFD..T..LFPRIPVL-------virsi...............................................................
C5X6Q2_SORBI/10-175                  ..................................................KSIHGTNPQNLVEKIVRSKIYQS.TYWKEQCFGLT.......................................A........-ETLVDKAME-..LDHTGG..............-TYG.GNR...........................................KP.TPFLCLALKM.LQIQ.PDKD..........IVVE.FIK...............................................NEDYKYVRV............L....GAFY...L.....RLTGT........................IADV....YQYL.E.....PLYNDYR.KIRHKLSDG...................-----....QFTLTHVDEFIDE.LL.......TKDYSCD..T..ALPRIQKRWVLEA--sg..................................................................
R7QBZ5_CHOCR/53-171                  ...............................................lhs---RGTDPQNLLEPSLRHSVYLS.RFWNESCFGVT.......................................L........-ADVVPLAAR-..LDRISA..............-V--.-TA...........................................PP.TPFLCLLLKL.LQLS.PQEP..........EIAV.FLM...............................................QNDYRYARL............L....GAFY...V.....RLALP........................P---....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------partsrcwhhaaaltaqa..................................................
N4X126_COCH4/23-228                  ................................................al--IRGQNPALLFEKGVRERITES.YYWKEQCFGLN.......................................A........-ATLCDRAAE-..LKFIGG..............-TTG.ITG...........................................KP.TPFLCLAFKM.LQLV.PDKE..........IVLE.YLNfrdddddeedkaevkkengd......aaaddadqsankeldlnaagkLGCFKYLRC............L....AAFY...I.....RLAWE........................PVEI....YKTL.E.....PLLTDYR.KIKRRLKDT...................-----....-FTLTHVDQFIDD.LL.......TKERICA..T..SLWKLPSRAILEDL-d...................................................................
R9P9R0_PSEHS/10-175                  .................................................h-SIHGTNPQHLIEKPIRYRIYSS.PYWKQHCFALS.......................................A........-STILPLATS-..LHHIGG..............-LIG.GLQ...........................................RP.SHFLCLLQKL.LQIQ.PDPS..........IIDA.YLD...............................................ASDFKYLRA............L....TAFY...I.....RLTYD........................SKSI....YEKL.E.....PLLEDGR.KLRWCRADG...................-----....GYEVMCVDEWVDS.LL.......REERVCD..I..ILPRLVRREVCE---vrd.................................................................
E5RYR9_TRISP/10-175                  .................................................a-SLKGTNPQYLIEKVTRSRIYDS.RYWKEECFALS.......................................A........-ELLVDRGME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLLLKM.LQIQ.PEKD..........IVIE.FIR...............................................QEDSKYIRA............L....GALY...L.....RMTFS........................YVEV....YKYL.E.....PLLNDYR.KLRWINKQG...................-----....KFELIHMDEFVDK.LL.......REERFCD..V..QLPRLQKRAFLEET-n...................................................................
E1BVP9_CHICK/50-234                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKTID-q...................................................................
T1KXQ5_TETUR/61-245                  .................................................l-PFWGNERTMNLNPLLLTNIKNS.PYFKVNLYALK.......................................T........YHEVIDEIWTQ..VKHMEP..............WEKG.SRRmggqtgmcg.........................svrgvgaggIV.STPFCILYKL.FTLR.LTRK..........QVMG.LIK...............................................HKDSPYIRA............I....GLMY...I.....RYTQP........................PESL....WEWL.S.....PYLEDTE.---------...................EFDAKa..gGGQKMTIGQMCRH.LL.......VKLEWFS..T..LFPRIPVPIQKDI--et..................................................................
A0A024X5A6_PLAFC/11-175              ...............................................knf----GSNPQYLISNIIRSKIYDS.PYWKEKCFALT.......................................S........-ESIIDQAIN-..LKYVGG..............-TYG.GNR...........................................KP.TRFLCLILKL.LQIQ.PDKD..........IIYE.YIK...............................................NEDFVYLRA............L....GIFY...L.....RLIGK........................SLEV....YNHL.E.....PILFDYR.KIRMRLQNG...................-----....TFEKIYMDVFVDN.CL.......ILNNFLD..V..DFPTLTKRQVLEEN-n...................................................................
K1WAK9_MARBU/21-188                  ...............................................lap---NGLNPATIMEKPVRERIVDC.YFWKDQCFAVN.......................................E........-ADIVDRVVAH..VTFIGG..............-TYG.DAQ...........................................RP.SPFLCLAFKL.LQLG.PTDE..........ILTE.YLEy.............................................gGEKFKYLRA............L....AMFY...I.....RLTRQ........................AKDV....YRLL.E.....PFLADYR.KLKRRGRMG...................-----....-TSLTYVDVFADE.LL.......VKDRVCG..T..TLWKMPKREILEDL-d...................................................................
B6QEC1_PENMQ/20-208                  ................................................pl--VRGVNPVTLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAIE-..LTSIGG..............-TYG.LSQ...........................................KP.TPFLCLAFKM.LQLA.PEKD..........IVLE.YLNftdpgsgddenp.......................edaeingevvkgRGDFKYLRA............L....AAFY...I.....RLTFE........................AAEI....YKYL.E.....PLLLDYR.KLKRRMREN...................-----....-YVLTNMDQFIDD.LL.......TKDRVCA..T..SLWKLPSRQMLEDL-d...................................................................
T1JGX1_STRMM/10-175                  .................................................h-SVKGTNPQYLVEKIIRSRIYDS.RFWKEECFALT.......................................A........-ELLVDKAME-..MKFIGG..............-VFG.GNI...........................................KP.CAFLCLLLKM.LQIQ.PEKD..........IVVE.FIR...............................................NEDFKYVRV............L....GALY...M.....RLVGT........................SLDC....YKYL.E.....PLYNDYR.KLKRQNRSG...................-----....LFEIVHMDELIDE.LL.......RGERACD..I..ILPRIQKRYVLEE--ln..................................................................
W7X6X1_TETTS/10-175                  .................................................l-SVRGQNPQNLIEAVIRNKIYQN.RYWKEKLPGLT.......................................A........-ASIIDEALE-..LDYVGG..............-TYG.GNR...........................................KP.SKFLMLSLKL.LQIS.PEKA..........EVME.YIN...............................................QEDYKYLTA............L....GCFY...I.....RLVAS........................SEDI....YKIL.E.....PLYADYR.KLRFRDLDG...................-----....SFKIIHMDEFVES.LI.......NQEVYLD..T..LLPNIQKRRVLEEN-g...................................................................
U6IHZ2_HYMMI/10-175                  .................................................h-TLHGTNPQYLIEKIIRSRIYEC.QFWKEHCFALT.......................................S........-ELLVDKAVE-..LKYIGG..............-TYS.GLT...........................................KP.TPFICLVLKM.LQIQ.PDKD..........IVIE.FIK...............................................QEDYKYARA............L....GAFY...L.....RLVGE........................SVEI....YKYL.E.....ALYNDFR.KLKQQDTTG...................-----....KFSIIRMDEFIDQ.LL.......NEERACD..V..ILPRLQKRSVLEDS-n...................................................................
K2G720_ENTNP/7-169                   .................................................l-PTQGNTRTMNIDSILFTNITHS.DYMFKTLGSIH.......................................S........ISDLIDIIIND..VHYISP..............YIQK.SSS...........................................SP.STAFCVLLRL.FQLN.PTPD..........DIRM.MST...............................................H-SNKYVRC............I....AALI...I.....RYSIQ........................FNLL....LSYL.K.....PFVDDRA.-VVNISLHG...................-----....-EKTKQIKCLVKD.LI.......LEPKFEG..C..ILPRIPQ--------vyykp...............................................................
G1SEF5_RABIT/10-175                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
Q54J00_DICDI/3-165                   ...............................................let---FGNEKSMNLDNVLLTNIQSS.LYFK-NLYPKR.......................................S........YHEVIEEIKRN..VEILAP..............YIP-.NTK...........................................TP.STTFCLLYKF.FLMK.LTVK..........QMKG.LLG...............................................NNESPYIRA............I....GALY...L.....RYCHP........................PANL....WDWY.V.....DYLDDQE.---------...................TVFIS....KNTEVTIQRFLLD.LL.......KDNKFSG..T..VLPRIPTKIQQD---ldk.................................................................
N9TDB6_ENTHI/7-169                   .................................................l-PTQGNTRTMNIDSILFTNITHS.DYMFKTLGSIH.......................................S........ISDLIDIIIND..VHYISP..............YIQK.SSS...........................................SP.STAFCVLLRL.FQLN.PTPD..........DIRM.MST...............................................H-SNKYVRC............I....AALI...I.....RYSIQ........................FNLL....LSYL.K.....PFVDDRA.-VVNISLHG...................-----....-EKTKQIKCLVKD.LI.......LEPKFEG..C..ILPRIPQ--------vyykp...............................................................
K3ZF04_SETIT/3-166                   ...............................................iqt---SGKPIDLLMEKVLCMNILSS.EYFK-ELYRLK.......................................T........YHEVIDEIYTC..VEHVEP..............WMTG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HPDSPYIRA............I....GFLY...L.....RYVAD........................PKTL....WTWY.E.....PYLRDDE.---------...................EFSPG...sNGRMTTMGVYVRD.LI.......LGQYYFD..S..LLPRIPLPVT-----rqvt................................................................
I3JV42_ORENI/25-209                  .................................................l-PLWGNEKTMNLNPMILTNVLSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHIEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QLMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....FEWY.D.....GFLDDEE.---------...................ELDVKa..gGGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKVI--dq..................................................................
W7AKF8_9APIC/252-414                 ...............................................lem----TNTTTYNVNTLLRNNILSS.EYFR-SLISFK.......................................T........IKEVLDEIHLY..ADHVEP..............YCIG.STR...........................................AP.STLFCCLYKL.FTMH.LSEK..........QMKM.LIE...............................................SRDSCYIRA............C....GFLY...L.....RYVHS........................PANL....WMWF.E.....PYLLDED.--QFVTSAD...................-----....KRKKQTIGEYIQS.LL.......ADDKYFN..T..VLPRMPIKIK-----nty.................................................................
G1THN5_RABIT/1-139                   ..................................................-----------------------.-----------.......................................-........-----------..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
B2ATX0_PODAN/63-230                  ...............................................lap---NGLNPATILEKAVRERIVDS.YFYKEQCYAIN.......................................E........-ADIVDRVVEH..VDHIGG..............-VTG.TVQ...........................................KP.TPFLCLAFKL.LQLA.PNDD..........ILNE.YLNf.............................................gGEKFKYLRA............L....AVFY...I.....RLTRQ........................DKDV....YTRL.E.....PFLEDRR.KLRRKGRNG...................-----....-VSLTYMDEFVDD.LL.......VKDRVCA..T..SLWKMRRRDVLEDL-e...................................................................
V8PH37_OPHHA/10-175                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRYTGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRL............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKNQNRNG...................-----....EFELMHVDEFIDQ.LL.......HDERVCD..I..ILPRLQKRYVLEEA-e...................................................................
H2MLH7_ORYLA/25-209                  .................................................l-PLWGNEKTMNLNPMILTNVLSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHIEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QLMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....LDWY.D.....GFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKMID-q...................................................................
W5MME7_LEPOC/32-216                  .................................................l-PLWGNEKTMNLNPMILTNVLSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHIEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PADL....MDWF.D.....SFLDDEE.---------...................ELDVKa..gGGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKLI--dq..................................................................
B4QGS9_DROSI/10-175                  ..................................................KNVHGTNPQYLIEKIIRSRIYDS.KYWKEQCFALT.......................................A........-ELLVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TQFLCLTLKM.LQIQ.PEKD..........IVVE.FIK...............................................NEEFKYVRA............L....GAFY...L.....RLTGA........................ALDC....YKYL.E.....PLYIDNR.KLRRQNRAG...................-----....QFEIVYMDEYIDE.LL.......RNDRVCD..I..ILPRIQKRSILEEN-n...................................................................
V7BAP5_PHAVU/3-165                   ..........................................iqtcgkpi--------DSLLEKVLCMNILSS.DYFK-ELYRLK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HPDSPYIRA............V....GFLY...L.....RYCGD........................PKTL....WSWF.E.....PYIKDDE.---------...................EFSPG...sNGRMTTMGVYIRD.LL.......LGQYYFD..T..LFPRIPVPV------lrqv................................................................
Q7PMU1_ANOGA/45-223                  .................................................l-PLWGNETSMNLNPLILANIQGS.SYFKVSLFKLK.......................................T........YHEVVDEIYYQ..VKHLEP..............WERG.SRKtagqtgmcg.........................gvrgvgaggIV.STAFCLLYKL.YTLR.LTRK..........QVNG.LLS...............................................HGDSPYIRA............L....GFMY...L.....RYTQP........................PSDL....FEWY.E.....PYLLDEE.---------...................EIDVKa..gGGQIMTIGQMIRQ.WL.......TKLDWFS..T..LFPL-----------aqpdr...............................................................
U5EXJ0_9DIPT/10-175                  ..................................................KNVHGTNPQYLIEKIIRSRIYDS.KYWKEQCFALT.......................................A........-ELLVDKAMD-..IRFVGG..............-VYA.GNI...........................................KP.TPFICLTLKM.LQIQ.PEKD..........IVVE.FIK...............................................NEEFKYVRA............L....GAFY...L.....RLTGS........................SIDC....YKYL.E.....PLYNDNR.KLRRQNRLG...................-----....YYELVHMDEFIDE.LL.......REERVCD..V..ILPRIQKRHVLEEN-n...................................................................
K6UDH3_9APIC/10-45                   .................................................i-KIFGSNPQYLISNIIRSKIYES.PYWKEKCFALT.......................................L........-----------..------..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....----...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------l...................................................................
B8P4M7_POSPM/8-160                   .................................................q-AIHGQNPQFLVETVIRNRIYES.PFWKEHCFALT.......................................A........-ESLIDKAID-..LKAIGG..............-VYG.-NQ...........................................KP.TEFLCLLLKL.LQIQ.PEKE..........ILLE.YLQ...............................................ADEFKYLRA............L....AVMY...I.....RMTFS........................AADV....YEIL.E.....PLLKDYR.KIRYRGMNG...................-----....-YSLTYMDEFVDN.LL.......VDERVCD..I..ILPR-----------....................................................................
G8BDC4_CANPC/23-200                  .............................................dkrni-----LNKAYLVEPIVRHRIHDS.IFYKQHLYLTN.......................................E........-STILPVITQN..VQYIAG..............--VD.SIG...........................................RP.SPFLQCLLRL.LELE.PAKE..........IINV.YLDq............................................lsYNEFKYLTA............L....TLLY...I.....RLVYP........................SEDI....YNIF.D.....KHAQDYR.KLRFKLKTPq................fnA---VqqpiYYKLGYMDEFIDD.LL.......TQERVVD..L..ILPRLIPRLSLV---erg.................................................................
B7F7E9_ORYSJ/3-166                   ...............................................iqt---SGKPIDLLMEKVLCMNIMSS.DYFK-ELYRLK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HPDSPYIRA............I....GFLY...L.....RYVAD........................PKIL....WTWY.E.....PYLKDDE.---------...................EFSPG...sNGRMTTMGVYVRD.LI.......LGQYYFD..S..LLPRVPLPV------irqvt...............................................................
V9IAK5_APICE/37-115                  .................................................l-PLWGNERTMNLNPLILTNIQSS.HYFKVNLYELK.......................................T........YHEVIDEIYYK..VSHLEP..............WEKG.SRK...........................................TA.----------.----.----..........----.---...............................................---------............-....----...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------gqtgmcggvsmffntlli..................................................
L7JXS8_TRAHO/4-152                   ...............................................ykl-----------FSNPIKEKILKS.PYFK-EIKNYD.......................................L........-DQTISDAHK-..LSSIGS..............LVYG.S--...........................................-P.HPFICLLQKL.ESLN.VDNN..........TMLE.KYHg............................................alREENSTVIM............F....FVFY...F.....RMTAK........................MKNE....FNEI.K.....KPLENKKlLVKIVDENN...................-----....ESYSVTIKEVLNM.LQ.......SNKYVFG..I..FMK------------si..................................................................
F9X714_MYCGM/19-186                  ................................................tl--IRGDNPLKLFEKPVRDRIVDS.YYWKEQCFGLN.......................................A........-ATVLDRAVE-..LTFLGG..............-TYG.VAQ...........................................KP.TPFLCLAFKL.LQLT.PEKE..........IIMY.YLEq.............................................aGEEFKYLRA............L....AAFY...V.....RMAWE.......................kDEDV....YTTL.E.....PYLADFR.KLKRRTREG...................-----....-WALTHVDQFIDD.LL.......VKSRVCA..T..TLPKINPRTFLEDED....................................................................
N6U570_DENPD/23-207                  .................................................l-PLYGNERTMNLNALILTNIQSS.HYFKVNLYELK.......................................T........YHEVVDEIYYK..VSHLEP..............WEKG.SRRtsgqtgmcg.........................gvrgvgaggIV.STAYCLLYKL.FTLK.LTRK..........QLNG.LIT...............................................HCDSPYIRA............L....GFMY...I.....RYVFP........................PSAL....LDWY.E.....EYLEDEE.---------...................ELDVKa..gGGQNMTMGQILRQ.WL.......VKLEWFS..T..LFPRIPVPIQHRI--qk..................................................................
A0A024VKM8_PLAFA/173-302             ...............................................lem----TNTTTYNVNTLLRNNILSS.EYFK-SLIPIK.......................................T........FKEVVDEIHSY..ADHVEP..............YCIG.SNR...........................................AP.STLFCCLYKF.FTMQ.LSEK..........QVTH.KL-...............................................---------............-....----...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------vsilprlpikiknvygarlmiiddhrrrlkknkeniskflkgepvla.....................
B4M6P8_DROVI/28-212                  .................................................l-PLWGNETSMNLNPLILANIQSS.SYFKVHLFKLK.......................................T........YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg.........................gvrgvgaggIV.STAYCLLYKL.YTLR.LTRK..........QLNG.LLN...............................................HTDSAYIRA............L....GFMY...L.....RYTQP........................PGDL....YDWY.E.....DYLQDEE.---------...................EIDVKa..gGGQVLTIGQMVYQ.FM.......TKLDWFS..T..LFPRIPVPIQKQIE-k...................................................................
V9DTB5_PHYPR/11-61                   .................................................q-SVHGVNPQTLVEKIMRNRIYAS.IYWKEQCFGLT.......................................A........-EALVDKILS-..------..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....----...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------rqqegsw.............................................................
B2GUF6_XENTR/35-178                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PADL....WDWY.E.....DFLDDEE.---------...................-----....-------------.--.......-------..-..---------------vchq................................................................
Q7RLR7_PLAYO/177-256                 ...............................................lem----TNTSTYNVNNLLRNNILSS.EYFR-SLITLK.......................................T........FKEVLDEILSY..ADHAEP..............YCIG.STR...........................................AP.STLFCCLYKL.FTMH.LSKK..........QV--.---...............................................---------............-....----...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------i...................................................................
C9ZJZ9_TRYB9/195-343                 .......................kqhkqqqssnheavtslresqrherrv-----------------------.-----------.......................................-........-ESLLHYCEQN..VLYIGV..............--MD.EEG...........................................KA.TPFLLAIGAF.YKLG.LTRH..........DALV.HFA...............................................RHHRRTIRA............L....ALFI...A.....RYTTA........................PEEL....EPFF.T.....PSLTDEV.VVACAEDQQ...................-----....--VTCSMRQLAED.LL.......LHDEVCE..A..---------------wpptlhpf............................................................
B2WHZ6_PYRTR/23-234                  .................................................k-LIRGQNPALLFEKGVRERITES.YYWKEQCFGLN.......................................A........-ATLCDRAAE-..LKFIGG..............-TTG.ING...........................................KP.TPFLCLAFKM.LQLV.PDKD..........IILE.YLNfrdddddeeqkdhdtdanadaenghisdtdsttaaakktldlnakgkLGNFKYLRC............L....AAFY...I.....RLAWE........................PVEI....YTTL.E.....PLLTDYR.KIKRRLKDA...................-----....-FTLTYIDQFVDD.LL.......TKERICG..T..SLWKLPSRANLEDL-d...................................................................
B3N7K4_DROER/10-175                  ..................................................KNVHGTNPQYLIEKIIRSRIYDS.KYWKEQCFALT.......................................A........-ELLVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TQFLCLTLKM.LQIQ.PEKD..........IVVE.FIK...............................................NEEFKYVRA............L....GAFY...L.....RLTGA........................ALDC....YKYL.E.....PLYIDNR.KLRRQNRAG...................-----....QFEIVYMDEYIDE.LL.......RNDRVCD..I..ILPRIQKRSILEEN-n...................................................................
C5LD14_PERM5/10-181                  ................................................ag--AHGGNPQFLISQIVRDRVYSL.RYWKEECFGLN.......................................A........-ETILDKAAE-..LKYVGT..............-VYG.SLQ...........................................RP.SPFLCLLVKL.LQIG.PEKE..........IIKS.FIDlsa.........................................gddAGELRYLRA............L....ACTY...L.....RYIGR........................PDEI....YNWL.E.....PVLWDYR.QIVVRKLDG...................-----....SFEISNLDTWVNT.LL.......TEDEIIT..L..GLPKLPQRHILEER-e...................................................................
B4HSN2_DROSE/10-175                  ..................................................KNVHGTNPQYLIEKIIRSRIYDS.KYWKEQCFALT.......................................A........-ELLVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TQFLCLTLKM.LQIQ.PEKD..........IVVE.FIK...............................................NEEFKYVRA............L....GAFY...L.....RLTGA........................ALDC....YKYL.E.....PLYIDNR.KLRRQNRAG...................-----....QFEIVYMDEYIDE.LL.......RNDRVCD..I..ILPRIQKRSILEEN-n...................................................................
A0A023B5L5_GRENI/10-175              .................................................r-SVHGTNPQFLINQITRNRIYDS.AYWKEYCFGLN.......................................A........-VTLLDKAAG-..LKYVGS..............-VYG.GNN...........................................KA.CPFLCLLLKL.LQIG.PSDS..........VVDE.YME...............................................QTDFKYLQA............L....SAVY...L.....RLTGS........................PERI....YRKL.E.....ELYTDNR.LLRLRLNNG...................-----....SFKLFHVDEFIDE.LL.......HSNVCIN..I..DLPPLPNRNLLEQN-l...................................................................
B0WBK3_CULQU/28-153                  .................................................l-PLWGNESTMNLNPLILANIQGS.SYFKVSLFKLK.......................................T........YHEVVDEIYYQ..VKHLEP..............WERG.SRKtsgqtgmcg.........................gvrgvgaggIV.STAFCLLYKL.YTLR.LTRK..........QVNG.LLT...............................................HTDSPYIRA............L....GFM-...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------ncfiksrcv...........................................................
R1F3N7_EMIHU/15-180                  .................................................i-SVHGTNPQNLVEKILRSKIYNH.AYWKEHCFGLT.......................................A........-ESLVDKAME-..LDTVGG..............-TFG.GIR...........................................EP.SHFIQLTLKM.LQIQ.PEKE..........IVLE.FIK...............................................NEDYKYVRA............L....GAFY...L.....RLTGR........................PAEV....FQYL.E.....PLYNDYR.KLRRRLASG...................-----....EYCLVHVDELVDE.LL.......RDEYVFD..L..ALPHLPKRHTLV---asg.................................................................
Q2QKC4_WHEAT/10-175                  .................................................r-SIHGTNPQNLVEKIVRAKIYQS.NYWKEQCFGLT.......................................A........-ETLVDKAME-..LDYTGG..............-THG.GNR...........................................RP.TPFLCLALKM.LQIQ.PDKE..........IVVE.FIK...............................................DEDYKYVRV............L....GAFY...L.....RLTGT........................VADV....YQYL.E.....PLYNDYR.KIRQKLSDG...................-----....KFTLTHVDEFIDE.LL.......TKDYSCG..T..ALPRIQKRWILEA--sg..................................................................
Q7SHZ0_NEUCR/24-191                  ...............................................lap---NGLNPATIMEKAVRERIIDS.YFYKEQCFGVN.......................................E........-ADIVDRVVEH..VDFIGG..............-VYG.TVQ...........................................KP.SPFLCLAFKL.LQLA.PSDD..........ILNE.YLQf.............................................gGEKFKYLRA............L....ALFY...I.....RLTRK........................DQDV....YKTL.E.....PFLEDRR.KLRRKGRNG...................-----....-TSLTYMDVFVDD.LL.......TKDRVCA..T..SLWKMRKRDILEDL-d...................................................................
E7NHW7_YEASO/15-219                  ..................................................KQLNNQSVSLVIPRLTRDKIHNS.MYYKVNLSNES.......................................Lrg....ntMVELLKVMIGA..FGTIKGqng.......hlhmMVLG.GIE...........................................--.--FKCILMKL.IEIR.PNFQ..........QLNF.LLNvk..........................................nenGFDSKYIIA............L....LLVY...A.....RLQYYylngn.............nkndddENDL....IKLF.Kvq.lyKYSQHYF.KLKSFPLQVdc...............faHSYNE....ELCIIHIDELVDW.LA.......TQDHIWG..I..PLGKCQWNKI-----ynsde...............................................................
G2R425_THITE/24-192                  ...............................................lap---NGLNPATIMEKAVRERIVES.YFYKEQCFGVN.......................................E........-ADIVDRVVEH..VHFIGG..............VYGS.GGQ...........................................RP.TPFLCLAFKL.LQLA.PGDD..........VLRE.YIGf.............................................gGDKFKYLRA............L....ALFY...V.....RLTRP........................DKDV....YMTL.E.....PFLEDRR.KLRRKGRNG...................-----....-TSLTYMDEFVDD.LL.......TKDRVCG..T..SLWKMRKRDILEDL-e...................................................................
B0JYW3_XENTR/10-175                  .................................................h-SVHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LKYVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRT............L....GALY...M.....RLTGT........................ATDC....YKYL.E.....PLYNDYR.KVKVQNRNG...................-----....EFELMHVDEFIDQ.LL.......HEERVCD..V..ILPRLQKRFVLEET-e...................................................................
E3KGQ2_PUCGT/10-176                  .................................................l-SIHGTNPQFLIDKVLRSRIYES.EYWKESCFGLT.......................................A........-ESIIDKTVFE..LSYLGS..............-TFT.ANL...........................................RP.TVFICLLLKL.LQLQ.PEKE..........IILE.YLR...............................................AEEFKYLRA............L....AAFY...V.....RLTFS........................PINV....YQTL.E.....PLLQDYR.KLRTRNLDG...................-----....SYGLMTFDELIDS.LL.......TETIVFE..V..VLPRLTSRKVLEEL-e...................................................................
W6Q0P6_PENRO/20-204                  ................................................pl--VRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTSIGG..............-TYG.VSE...........................................KP.TPFLCLAFKL.LQLG.PDRE..........VILE.LLNytdpgsgdea...........................edpddalvkeRGDFKYLRA............L....AAFY...V.....RLTFD........................PVDV....YKTL.E.....PLLLDYR.KLKRRVRDT...................-----....-FTLTYMDQFIDD.LL.......TKDRVCG..T..SLWKLPPRSQLEDL-d...................................................................
A0A058ZG82_9EUKA/14-178              .................................................k-SYHGTNPMNLIPKIMRERIFNS.LYWKERCFGLN.......................................D........-ADVVDRAAE-..ITHIGG..............-TYG.HTN...........................................TA.TPFICLALKL.LR-S.PNRE..........TLIA.FID...............................................QTHFKYLRA............L....GAFV...F.....RLIAP........................SADI....YNYL.E.....PLLIDLR.KLRMRNQEG...................-----....EFYLSFLDSFVDE.LL.......TETHVLG..V..PMPTLVQRHVLEA--ag..................................................................
Q95Y35_CAEEL/55-239                  .................................................l-PVWGNKVTMNLNTLVLENIRES.YYYKNNLVEID.......................................N........FQTLIEQIFYQ..VKHLEP..............WEKG.TRRlqgmtgmcg.........................gvrgvgaggVV.SSAYCLLYRL.FNLK.ISRK..........QLIS.MLN...............................................SRQSVYIRG............L....GFMY...I.....RYTQP........................PADL....WYWL.E.....PYLDDDR.---------...................EIDPRs..gGGDLMTFGQLVRT.MI.......NKLDWYG..T..LFPRIPVPIQKDID-e...................................................................
J9B997_WUCBA/47-231                  .................................................l-PLWGNTQTMNLNALVLENIIQC.TYYKNYLAETT.......................................G........FQQLTEEIYYS..VKHLEP..............WERG.TRKtqgmtgmcg.........................gvrgvgaggVV.STAFCLLYKL.FTIR.LSRK..........QLVS.MIN...............................................NSDSPYIRG............I....GFMY...I.....RFCQP........................PQDL....WAWM.E.....PYLDDEE.---------...................QIDPRs..gGGDVMVMAQVVKM.ML.......TKLDWYG..T..LFPRIPVPIQKEI--el..................................................................
W0T4H3_KLUMA/14-213                  ..................................................KQLNHQSTSLVVPQTFRNRVMSS.MYYKVNLTPIS.......................................Mrg....dtIVQLIPIIVRD..LGSLNErks........phmGVCG.GVE...........................................--.--FKCLLMKM.INLR.PPWD..........QLKV.LLEp............................................heSFNNKYITV............L....ILCY...L.....RISYYflseth...........sneqgisFGLL....HDMM.K.....KYIKDHR.KLKSYPLDVdc...............wsQAIKK....ELVISHLDEIVDW.LC.......EKSEIWG..I..PLGKCSW-CKIWD--ddd.................................................................
M7YQW6_TRIUA/1-101                   .................................................m-----------------------.-----------.......................................-........---------E-..LDHTGG..............-THD.GNR...........................................RP.PPFLCLALKV.LQIQ.PNKE..........IVLE.FIK...............................................NEDYKYVRV............L....GAFY...L.....RLTGT........................VADV....YQYL.E.....PLYNDYR.KISQKLSDG...................T----....-------------.--.......-------..-..---------------srtleprrsaledd......................................................
K7JAP2_NASVI/32-188                  .................................................l-PLWGNERTMNLNPLILTNIQSS.HYFKVNLYELK.......................................T........YHEVIDEIYYK..VSHLEP..............WEKG.SRK...........................................TA.G---------.-QTG.MCGG..........QLNG.LIN...............................................HPDSPYIRA............L....GFMY...I.....RYTQP........................PPDL....FSWY.D.....DYLEDEE.---------...................ELDVKa..gGGQVMKMGDILKQ.FL.......TKLEWFS..T..LFPRIPVPIQKELE-q...................................................................
PR38A_DANRE/10-175                   .................................................n-SVHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LKFVGG..............-VYG.GNV...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRL............L....GAMY...M.....RLTGT........................SVDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HAERMCD..I..ILPRLQKRQVLEEA-e...................................................................
A0A034WTL0_BACDO/22-206              .................................................l-PLWGNEATMNLNPLILANIQGS.SYFKVHLFKLK.......................................T........YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg.........................gvrgvgaggIV.STAYCLLYKL.YTLR.LTRK..........QVNG.LLN...............................................HTDSPYIRA............L....GFMY...L.....RYTQP........................PADL....YDWY.E.....DYFQDEE.---------...................EIDVKa..gGGQTITIGQVVYQ.FL.......TKLDWFS..T..LFPRIPVPIQKQIE-k...................................................................
A5K1F2_PLAVS/159-321                 ...............................................lem----TNTTTYNVNTLLRNNILSS.EYFR-SLVPLK.......................................T........FKEVVDEIHLY..ADHVEP..............YCIG.STR...........................................AP.STLFCCLYKL.FTMH.LSEK..........QMKM.LIE...............................................SRDSCYIRA............C....GFLY...L.....RYVHS........................PANL....WMWF.E.....PYLLDED.--QFVTSAD...................-----....KRKKQTIGEYIQC.LL.......ADDKYFN..T..VLPRMPIKIK-----nty.................................................................
G7XH18_ASPKW/20-207                  ................................................pl--VRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTCIGG..............-VYG.VSE...........................................KP.SPFLCLAFKL.LQLN.PERD..........IILE.YLNfsdpanddnnd........................esyeegngvvkaRGDFKYLRA............L....AAFY...V.....RLTFE........................PVEV....YKTL.E.....PLLLDYR.KLKRRVRDS...................-----....-FTLTYMDQFVDE.LL.......TKERVCG..T..SLWKLPARQVLEDL-d...................................................................
K7H0X6_CAEJA/52-236                  .................................................l-PIWGNQVTMNLNTLVLENIRES.YYYKNNLIEID.......................................S........FQALVEQIFYQ..VKHLEP..............WEKG.TRRlqgmtgmcg.........................gvrgvgaggVV.SSAFCILYRL.FNLR.MTRK..........QLIS.MLN...............................................SRQSVYIRG............I....GFMY...I.....RYTQP........................PSDL....WYWL.E.....PYLDDES.---------...................EIDPRs..gGGDCMTFGMMVRT.MI.......NKLDWYG..T..LFPRIPVPIQKEID-e...................................................................
F2PU74_TRIEC/20-222                  ................................................pl--IRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTYIGG..............-TYG.VGQ...........................................KP.TPFLCLAFKL.LQLA.PEKE..........VILE.YLNfhdpeadeedsntrgdsad.........adgdaddaqdradaailraTGDFKYLRA............L....AAFY...I.....RLTFE........................PVEI....YKTL.E.....PLLTDYR.KLKRRTKEG...................-----....-FLLTYMDQFVDD.LL.......TKDRVCG..T..SLWKIPTRTMLEDL-d...................................................................
S6EYV6_ZYGB2/14-210                  ..................................................KQLNHQSVSLVIPRIARDKIHNA.MYYRVNLNTVS.......................................Lrg....dtIECLSKVIVRD..LGSLAEpvs.......fqqvHVLG.GIE...........................................--.--FQCLLMKL.VEIR.PTWD..........QLEV.MLQed...........................................ntGFNNKYIVG............L....ILAY...I.....RIQYYflqv................edplAQRF....RVLF.K.....HYYNDYR.KMKSVLFDQdc...............wtKSQTV....SVNILHMDELVEW.LL.......EREEIWG..I..PLGKCQWKELEE---sss.................................................................
Q5F399_CHICK/50-103                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VR----..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....----...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------lraaaw..............................................................
R0L3G4_ANAPL/1-110                   ..................................................-----------------------.-----------.......................................-........-----------..------..............----.---...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HEERVCD..I..ILPRLQKRYVLEEA-e...................................................................
M2MPP1_BAUCO/19-184                  ................................................rl--IRGDNPLKLFEKAVRDRIIDS.YYWKEQCFGLN.......................................A........-ATILDRATE-..LTFIGG..............-TYG.VAQ...........................................KP.TPFLCLAFKL.LQIV.PDKE..........IILF.YLE...............................................QEEFKYLRA............L....AAFY...I.....RLAWE.......................kDEEV....YTTL.E.....PYLSDAR.KLKRRTREG...................-----....-WALTHVDEFIDD.LL.......IKGRLCA..T..TLPKINPRLFLEDED....................................................................
M2RVJ4_ENTHI/2-162                   .............................................sgper----------RLETILRNKIYNC.EYWKQQCFTLT.......................................S........-ETILDEIVK-..LHDFGG..............-TYG.VLK...........................................KP.TKFIVLIMKL.LMLR.PDKS..........IIYE.YIM...............................................NEEFKYVRV............I....GAFY...L.....RLIGS........................SKEC....YQFI.E.....PLYYDYR.PLKYRIDSK...................-----....HYEIITIDQFAWN.LL.......HLDYYCD..I..TLPIITPRPVIE---shg.................................................................
Q756P8_ASHGO/14-224                  ..................................................KQLSNQSTSLVIPKIARLRIHNS.MYYKINLYPTG.......................................Lrg....ntLKQLVRVLVRD..LGACKHrsg........pmlHICG.NTE...........................................--.--FQCLLMKV.IEIR.PTWS..........QIYT.LLQlgde.......................................rktgKFNNKYIAV............L....ILVY...L.....RIQYYfladekaes.....fppeadgdvtAAKV....KALF.A.....HFLADYR.KVKCLDLEVdc...............wsGATQK....SVSVQHVDEIVDW.LC.......TKDSIWG..I..PLGRCRWLAD-----vlead...............................................................
C5Z3V3_SORBI/3-166                   ..............................................iqss----GRSIEGLMEKVLSVNILSS.DYFK-ELFKYK.......................................T........YHEVVDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.SSAFCLLYKL.FTMK.LTVK..........QMHG.LLK...............................................HQDSPYIRA............I....GFLY...L.....RYVAE........................PKTL....WSWY.E.....PYIKDGE.---------...................EFAPG...sNGKSTTMGVYVRD.LL.......LGQYYFD..S..LLPRVPLPI------lrqvt...............................................................
R8BK18_TOGMI/23-190                  ...............................................lap---NGLNPATIMEKAVRERIVDS.YFFKEQCFGVN.......................................E........-ADVVDRVVEH..VSFVGG..............-TYG.GVQ...........................................KP.TPFLCLAFKL.LQLA.PGDD..........VLAE.YLEy.............................................gGDKFKYLRA............L....AAFY...I.....RLTRQ........................AKEV....YTML.E.....PYLEDRR.KLRRKGRAG...................-----....-TSLTYVDEFIDD.LL.......IKDRVCG..T..SLWKMPKRDLLEDL-e...................................................................
M7NMD2_PNEMU/15-179                  .................................................q-SIHSMNPVNLIEKIIRERILEC.RYYKEMCFGLT.......................................A........-ATICDRAVK-..MKYIGG..............-QY-.LNQ...........................................RP.TEFLCLTFKL.LQLQ.PEKE..........IILE.YLY...............................................ANDFKYLQA............L....AAFY...I.....RLTFP........................AKEC....YLIL.E.....PFLNDYR.KLRIRYSTG...................-----....LYGLSYIDEFVDH.LL.......NQERVCD..I..ALPRLPTRFILEE--me..................................................................
W6MI80_9ASCO/16-181                  .................................................a-RVHGVNPVFLVEKIIRERILDS.LYWKKDCFHLN.......................................A........-LTILDKAVA-..LRMVGT..............YSNV.NRT...........................................KP.CIFMCLLLKM.LQIQ.PSPE..........IVNY.LLR...............................................QPHFKYVTA............L....AALY...V.....RLTSS........................SVQV....YKTL.E.....PLLEDYR.KLVLFDGMK...................-----....-KRLIHMDELVDD.LL.......TKEKFCD..L..MMPRLVDRLQLEEQ-e...................................................................
G2XP06_BOTF4/21-188                  ...............................................lap---NGLNPATVLEKPVRERIVDC.YFWKDQCFALN.......................................E........-ADIVSRVVSH..VTFIAG..............-TYG.DSQ...........................................RP.SPFLCLAFQL.LQLG.PGDD..........ILKE.YMGy.............................................gGEKFKYLRA............L....ALFY...W.....RMTRQ........................AKDV....YTML.E.....GYLEDRR.KLRRKTRTG...................-----....-TTLTFMDQFVDD.LL.......TKDRVCG..T..TLWKMPKREILEDL-e...................................................................
X0BDR0_FUSOX/25-192                  ...............................................vap---NGLNPATIMEKAVKDRIVDS.YFYKEQCFALN.......................................E........-ADIVDRVVEH..VNFIGG..............-TYG.VTQ...........................................KP.SPFLCLAFKL.LELS.PSDA..........VLME.YLKy.............................................gGEAFKYLRA............L....ACFY...F.....RLTRQ........................AKDV....YEML.E.....PFLEDRR.KLRRRGRAG...................-----....-VVLTFMDEFVDE.LL.......TKERVCG..T..SLWKMPKREVLEDL-e...................................................................
Q4Z0V3_PLABA/10-175                  ..............................................iksf----GSNPQFLISNIIRNKIYDS.PYWKEKCFALT.......................................S........-ESIIDQAVN-..LKYAGG..............-TYG.GNR...........................................KP.TRFLCLVLKL.LQLQ.PDKD..........IIYE.FIK...............................................NEEFIYLRA............L....GIFY...L.....RLIGK........................GIEI....YKNI.E.....PILFDYR.KIRIRLQDG...................-----....SFQKMYMDVFADN.CL.......VFNNFLD..V..DFPPLTKRIVLEEN-n...................................................................
B6K0B4_SCHJY/16-179                  .................................................g-PVHEMNPTFLIEKILRERIVEC.AYWKEQCFGLN.......................................A........-ASLVDRAVQ-..IQCIGG..............--QS.SHQ...........................................RP.TEFICLVYKL.LQLA.PEDE..........IVLQ.YLN...............................................ATEFKYLRA............I....AAFY...I.....RLVWK........................DARV....FETL.E.....PLLNDYS.KLRTLDMNG...................-----....-YGLTHMDEYVDA.LL.......NEQRVCD..I..ALPPLMSRIQLEDL-e...................................................................
C5K8A2_PERM5/121-217                 ...............................................lql----TNTTTYNYPQMLHQQLAKS.AYYH-SIQPLD.......................................T........PEAIIDEIKTR..CKDAEP..............YAPG.SHT...........................................AP.STMFCCLYRL.FVMR.INSK..........VLGQ.LIN...............................................YHGAPYVRS............I....----...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------eei.................................................................
Q8MR43_DROME/24-208                  .................................................l-PFWGNESSMNLNALILANIQSS.SYFKVHLFKLK.......................................T........YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg.........................gvrgvgaggIV.STAYCLLYKL.YTLR.LTRK..........QING.LLN...............................................HTDSAYIRA............L....GFMY...L.....RYTQP........................PGDL....YDWY.E.....DYLQDEE.---------...................EIDVKa..gGGQVLTIGQMVYQ.FM.......TKLDWFS..T..LFPRIPVPIQKQIE-k...................................................................
G8ZTX6_TORDC/14-208                  ..................................................KELNNQSVSLVIPRLTRDRIHNV.IYYKANLHTVA.......................................Lrg....dtMKQLCKVIIRD..LGTLQStsi........nrkNVLG.GV-...........................................--.-EFKCILMKL.VEIR.PTWD..........QLAL.LLRnp...........................................hpSYNNKYVIA............L....VLTY...L.....RVQYFylkn................ddilAQNI....KGAF.K.....EYICDYR.KMKSVSLEMdc...............wsASQNV....TVEIIHMDELVDW.LT.......TKDEIWG..I..PLGRCQWCSSL----dld.................................................................
A9V7J1_MONBE/525-692                 ..............................................yvcd------SKTMNLGHVLYSNIRDS.SYFRERCAELE.......................................S........IDHIIDEIYEQ..VNHLEP..............FVRK.PSN...........................................AP.STAFCLLYTL.FCFR.PKER..........DLDK.IVT...............................................HKDSPYIRA............I....GFLY...L.....RYTAD........................ADTI....WTWF.S.....DFLDDPT.PLKVKYAKM...................-----....-APEEPIGLWLRS.LL.......TDLQYCDpqA..RLPRIPVMKEREIR-d...................................................................
A0A058Z0D6_9EUKA/4-170               ................................................le--RHGNETTMNLNPALHQNIMGS.RYFK-NLYNLT.......................................T........FEEVVSEISDE..VTFLEP..............FIPG.-TR...........................................DP.SSAFCLLLKL.FTMK.PTVN..........QMRR.MLN...............................................YPRSVYVRC............V....GLLY...L.....RYAFP........................PARL....MEWY.A.....DMLFDET.PVVVEGRHG...................-----....-ARSMPLGRYVRNhLL.......LDNKYFG..T..IMPLLPFRVMES---ikq.................................................................
R7VC16_CAPTE/10-175                  .................................................a-TIKGTNPQYLVEKIIRSRIYEC.QFWKEECFALT.......................................A........-ELLVDKAMQ-..LKYIGG..............-VYS.GVV...........................................KP.TPFICLLLKM.LQIQ.PEKD..........IILE.FIR...............................................QQEFKYVRA............L....GAMY...M.....RLTGT........................SLDC....FKFL.E.....PLLLDYR.KMRRQNRDG...................-----....KYELLHFDEFVDE.LL.......TQERVCD..C..ILPRIQKRHVLEET-n...................................................................
H3H0K3_PHYRM/37-201                  .................................................l-AVYGNDTTYNLNTLLHQNILQS.AYFH-DLYKLK.......................................T........YHEVVDEIYYR..VDHAEP..............WSPG.TAR...........................................IP.SSCFCLLHKF.FLMR.LTRK..........QMQG.LLR...............................................HTDSPYIRV............V....GFLY...L.....RFAFD........................PDEL....WTWF.E.....PFLEDPE.---------...................EFNASa..nTSLKTTIGEWLIS.LL.......EENNYFG..T..ILPRIPKKIE-----dgik................................................................
W2KVC3_PHYPR/21-185                  .................................................q-SVHGVNPQTLVEKIMRNRIYAS.IYWKEQCFGLT.......................................A........-ETLVDKAVE-..LQEFGG..............-TFG.GNQ...........................................QP.THFLCLLLKM.LQLQ.PELE..........VVKQ.FIE...............................................NEDYKYVTV............L....GAVY...L.....RLVGK........................PLEV....YTLL.E.....PLLSDYR.KIRKRNVIG...................-----....-WEITHVDEIADA.LL.......HEEYYID..L..ALPRLADRELLEKN-e...................................................................
K3WW49_PYTUL/39-203                  .................................................l-PIYGNQTTYNLNTLLHQNILQS.AYFH-ELYNLK.......................................T........YHEVVDEIYYR..VDHAEP..............LSPG.TAR...........................................IP.STCFCLLHKF.FLMR.LTMK..........QMQG.LLK...............................................HTDSPYIRA............V....GFLY...L.....RYTCD........................PEKL....WGWY.E.....PYLDDKE.---------...................EFNAAa..nPNVKTTIGEWLVG.LL.......EDINYFG..T..ILPRIPKKIED----sik.................................................................
R7Q9W9_CHOCR/53-171                  ...............................................lhs---RGTDPQNLLEPSLRHSVYLS.RFWNESCFGVT.......................................L........-ADVVPLAAR-..LDRISA..............-V--.-TA...........................................PP.TPFLCLLLKL.LQLS.PQEP..........EIAV.FLM...............................................QNDYRYARL............L....GAFY...V.....RLALP........................P---....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------partsrcwhhaaaltaqa..................................................
I2FP71_USTH4/10-174                  .................................................v-SIHGRNPQHLIEKTIRYRIYES.AFWKEHCFGLS.......................................S........-STILPLAVS-..LHHIGG..............-LVG.-LE...........................................RP.SHFLCLVQKL.LQIQ.PEDS..........VIKA.YLD...............................................ACEFKYLRA............L....TAFY...I.....RLTCK........................STEV....YQLL.E.....PMLQDGR.KLRWRSADG...................-----....GYEVLHMDEWVDM.LL.......REERVCD..I..ILPRLSKREVCQ---vrd.................................................................
N1P3X3_YEASC/15-219                  ..................................................KQLNNQSVSLVIPRLTRDKIHNS.MYYKVNLSNES.......................................Lrg....ntMVELLKVMIGA..FGTIKGqng.......hlhmMVLG.GIE...........................................--.--FKCILMKL.IEIR.PNFQ..........QLNF.LLNvk..........................................nenGFDSKYIIA............L....LLVY...A.....RLQYYylngn.............nkndddENDL....IKLF.Kvq.lyKYSQHYF.KLKSFPLQVdc...............faHSYNE....ELCIIHIDELVDW.LA.......TQDHIWG..I..PLGKCQWNKI-----ynsde...............................................................
U6CYF9_NEOVI/1-71                    ..............................................vrgv-----------------------.-----------.......................................-........-----------..------..............---G.TGG...........................................IV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.---------...................-----....-------------.--.......-------..-..---------------....................................................................
B2RDP2_HUMAN/10-58                   .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..L-----..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....----...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------rnam................................................................
K8FDN6_9CHLO/1-120                   .................................................m-----------------------.-----------.......................................-........-----------..------..............--SG.NAR...........................................GA.STAFCILYRI.LAMEnVPHF..........KVNK.MIY...............................................HQDSVYIRC............I....GLLY...A.....RYKFYn......................dEENL....MKFFsE.....DVFKDKK.EISFAPSVD...................-----....GKKLTSFSQFAID.LI.......CSQEYFE..T..LFPRIPEVLKRK---mqa.................................................................
G1KHK2_ANOCA/10-175                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRYTGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRL............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDQ.LL.......HDERMCD..I..ILPRLQKRYVLEEA-e...................................................................
Q6FNB5_CANGA/14-216                  ..................................................KQLNNQSVSLVIPRITRDKIHNN.IYYRCNLHPVS.......................................Mrg....dtMLNLAPIIIRD..LGKLRNpyqk.....plnatLLLG.G--...........................................--.SEFKCLLMKL.IEIR.PTWE..........QIMT.LINeem.........................................veeSFENKYIVA............L....VLVY...G.....RIQYYfltfs.............ddyyddAIKW....RRLF.K.....KYLNDYR.KLKALDLNVdc...............wsTSQMQ....NVELIHLDEIVDW.LA.......TKDDIWG..I..PLGKCQWANVY----ndd.................................................................
T5ACD4_OPHSC/26-193                  ...............................................lap---NGLNPAMIMEKAVKDRIVDS.YFYKEQCFALN.......................................E........-ADIIDRVVEH..VSFIGG..............-THG.AAQ...........................................KP.SPFLCLAFKL.LELG.PSDA..........ILRE.YLAh.............................................gGEHFKYLRA............L....ACFY...V.....RLTRQ........................AKDV....YETL.E.....PFLEDRR.KLRRKGRAG...................-----....-TSLTYVDDFVDD.LL.......YKERICA..T..SLWKMPKREILEDL-d...................................................................
K3XXF9_SETIT/3-166                   ...............................................iqs---SGRSIDVLMEKVLSVNILSS.DYFK-ELYKFK.......................................T........YHEVVDEIYHQ..VDHVEP..............WMTG.NCR...........................................GP.SSAFCLLYKF.FTMK.LTVN..........QMHG.LLK...............................................HPDSPYIRA............I....GFLY...L.....RYVAE........................PKTL....WAWY.E.....PYIKDDE.---------...................EFSPG...sNGKMTTMGVYVRD.LL.......LGQYYFD..S..LLPRVPLPI------lrqvt...............................................................
Q4P5L4_USTMA/10-174                  .................................................v-SIHGTNPQFLIEKPVRARIYES.PFWKEHCFALS.......................................A........-ATILPLAVS-..LNHIGG..............-LVG.-LQ...........................................RP.SHFLCLLQKL.LQIQ.PEPA..........IINA.YLE...............................................AREFKYLGA............L....TAFY...I.....RLTYT........................SKHV....YTLL.E.....PMLEDGR.KLRWRSGDG...................-----....AYEILHMDEWVDM.LL.......REERVCD..I..ILPRLTRRDVCETR-d...................................................................
F4PA36_BATDJ/1-156                   ..................................................---------MNIHNILYLNIMSS.RYFK-SLYEKK.......................................T........YHEVIDEIYYN..VSSLEP..............FFKG.TNA...........................................--.TSAFCLLYKL.FTLK.LTEK..........QLEG.LLD...............................................HPDSPHIRA............L....GFLY...L.....RYAGQ........................PSQI....WDWF.E.....PYLDDTE.ELPVRGGPH...................-----....-PKTMTIGTFCKA.LL.......TEQKWFE..T..MLPRIPIPIAREIE-q...................................................................
D2VCT3_NAEGR/48-213                  .................................................i-NVWGNSSTMNITPYLYKKVLAS.PYFK-SLYEYK.......................................T........YHEVLDLIKN-..IKYIHP..............FTDG.DTN..........................................aEP.SIAFSLLFKL.HTLK.LSYK..........QLKG.MLQ...............................................KDMSTNTKA............M....ALLY...V.....RFAVQ........................PDEM....WDYF.R.....DFVNDEN.---------...................NTVNI....YTKRISLGEFVRS.LI.......TNQKLFG..SqcILPILPANLVR----rmed................................................................
H0ZFB3_TAEGU/10-175                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.NRASIAVPSFI.......................................S........-ELVVDKAME-..LKYVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HEERVCD..I..ILPRLQKRYVLEEA-e...................................................................
H2KVI1_CLOSI/10-175                  .................................................h-TVHGTNPQYLVEKIIRSRIYES.KYWKEHCFALT.......................................A........-ELLVDKAVE-..LRYVGG..............-VYS.GNV...........................................KP.TPFLCLALKM.LQIQ.PDKD..........IVIE.FIK...............................................QEPYKYARA............L....GAFY...L.....RLVGE........................SVEI....YKYL.E.....TLYNDFR.RLKFQDRAG...................-----....NFSLIYMDDFIDK.LL.......TEERVCD..V..ILPRLQKRSVLEEA-n...................................................................
M2RIP2_CERS8/10-173                  .................................................q-AIHGQNPQYLVESVIRNRIYES.AYWKEHCFALT.......................................A........-ESLIDKTIE-..LRAIGG..............-VYG.-NQ...........................................KP.TEFLCLLLKL.LQIQ.PEKE..........ILLE.YLQ...............................................ADEFKYLRA............L....AVMY...I.....RMTFR........................PAEV....YEIL.E.....PLLKDYR.KIRYRGMNG...................-----....-YSLTFMDEFVDS.LL.......VQERVCD..I..ILPRLTKRDVLEE--lg..................................................................
I1MBS7_SOYBN/4-166                   ..........................................qtcgrpid---------SLLEKVLCMNILSS.DYFK-ELYRLK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HPDSPYIRA............V....GFLY...L.....RYCAD........................PKTL....WNWF.E.....SYVKDDE.---------...................EFSPG...sNGRMTTMGVYVRD.LL.......LGQYYFD..T..LFPRIPVPV------lrqvv...............................................................
S9VCB1_9TRYP/46-243                  ................................................wn--LQGRSAFAVLDPTTRHRIAHA.HNMT-RCRDQP.......................................L........-LWVLEELIT-..IESVGG..............-LSG.PLF...........................................RV.EYFLCLVARV.LQAA.PDPA..........VVLA.LLR...............................................QDVHKYLRV............A....ALFM...I.....RLIGN........................VAMQ....KEAV.R.....VGWDDYR.KIRVYGDEG...................EVD--....-------------.--.......-------..-..---------------yvfdatlrgrkhpreaaegeqppvnieeakpahyfilcmdeltdrlfrvdsdgekrsqffgvplpplm
I1QLT6_ORYGL/10-175                  ..................................................KSIHGTNPQNLVEKIVRSKIYQS.TYWKEQCFGLT.......................................A........-ETLVDKAME-..LDHTGG..............-TYG.GNR...........................................KP.TPFLCLALKM.LQIQ.PDKD..........IVVE.FIK...............................................NEDYKYVRV............L....GAFY...L.....RLTAT........................VADV....YQYL.E.....PLYNDYR.KIRHKLSDG...................-----....KFTLIHVDEFIDD.LL.......TKDYSCD..T..ALPRIQKRWVLET--sg..................................................................
A0A023GJY8_9ACAR/14-198              .................................................l-PLWGNEKTMNLNNLILTNILSS.PYFKVNLYKLK.......................................T........YHEVVDEIYYN..VQHLEP..............WEKG.SRKtsgqtgmcg.........................gvrgvgaggIV.STAFCILYKL.FTLK.LTRK..........QLVG.LMN...............................................HCDSPYIRA............L....GFMY...I.....RFTQP........................PADL....VDWY.E.....PYLDDEE.---------...................ELDVKa..gGGQVLRIGDMLRH.LL.......TKLEWFA..T..LFPRIPVPIQKEIE-r...................................................................
B6AGF3_CRYMR/3-168                   ................................................eq--IGDTRKLFLISSILRNRVFSC.IYWKSECFGLD.......................................S........-ETILDKAIQ-..LDYVGS..............-TFG.PER...........................................RP.CTFLCLLVKL.LQIQ.PSLD..........IILE.YIT...............................................NPEFKYLTA............L....GIIY...L.....RLVAS........................PKDI....YINL.E.....PLYKDYR.KLKCRDLDG...................-----....SFYILCIDELIDR.CL.......RDNVLFD..I..DLPYLPKRLMLVK--eg..................................................................
Q4Q9W3_LEIMA/270-441                 nfdaelwgvlesrltdelveqvrsagaapnggrlltafeqheqnvkavlr-----------------------.-----------.......................................-........------YCEQN..VRYAG-..............-VFD.DSE...........................................EA.SPFLLAMGLC.WRLG.LTMD..........DVCR.HFA...............................................RHPRRVVRA............L....ALYL...A.....RYTLA........................PEDY....VYFF.T.....PSLCDEV.IIACTEDAQ...................-----....--VTFSMKDLSRQ.LL.......TKKDVVD..A..WLPILSKRWQE----dv..................................................................
W9QIC3_9ROSA/10-174                  ..................................................KSIRGTNPQNLVEKIVRSKIYQN.TYWKEQCFGLT.......................................A........-ETLVDKAME-..LDHVGG..............-TFG.GNR...........................................KP.TPFMCLVMKM.LQIQ.PEKE..........IVIE.FIK...............................................NDDYKYVRV............L....GAFY...L.....RLTGS........................DTDV....YQYL.E.....PLYNDYR.KIRRKLADG...................-----....NFSLTHVDEVIDE.LL.......TKDYSCD..I..ALPRIKKRWTLE---si..................................................................
V5I0G7_IXORI/14-198                  .................................................l-PLWGNEKTMNLNNLILTNILSS.PYFKVNLYKLK.......................................T........YHEVVDEIYYN..VQHLEP..............WEKG.SRKtsgqtgmcg.........................gvrgvgaggIV.STAFCILYKL.FTLK.LTRK..........QLNG.LMN...............................................HCDSPYIRA............L....GFMY...I.....RFTQP........................PADL....VDWY.E.....PYLDDEE.---------...................ELDVKa..gGGQTLRMGDMLRH.FL.......TKLEWFA..T..LFPRIPVPIQKEIE-r...................................................................
E9IFJ0_SOLIN/10-175                  ..................................................KSIRGTNPQYLIEKIIRSRIYDS.KYWKEECFALT.......................................A........-ELLVDKAME-..LRFLGG..............-VYG.GNV...........................................KP.TPFLCLILKM.LQIQ.PEKD..........IIVE.FIK...............................................NEEYKYVRA............L....GALY...M.....RLTGS........................SLDC....YKYL.E.....PLFNDNR.KLRIQNKQG...................-----....VFELIHMDELIDH.LL.......REERCCD..V..ILPRIQKRHVLEEN-n...................................................................
K9FTW7_PEND1/20-204                  ................................................pl--IRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTSIGG..............-TYG.VSE...........................................KP.TPFLCLAFKL.LQLG.PDRD..........VILE.LLNytdpgsgdea...........................enpddalvkdRGDFKYLRA............L....AAFY...V.....RLTFD........................PVDV....YKTL.E.....PLLLDYR.KLKRRVRDN...................-----....-FTLTYMDQFVDD.LL.......TKDRVCG..T..SLWKLPPRSQLEDL-d...................................................................
Q5CPB2_CRYHO/4-168                   .............................................eqssh------HKLFLVSSILRDRVFSS.IYWKGECFALD.......................................S........-ETILDKAVL-..LDYIGT..............-TYG.GDR...........................................KA.TPFLCLLVKL.LQIR.PSTE..........IVLE.YIN...............................................NPRFKYLTA............L....GIVY...L.....RLTES........................SIVI....HKSI.E.....HLYQDYR.RIRIRNLDG...................-----....SFDIIHLDELVEI.CL.......CEKKFLD..L..DFPYIHKRAVLVK--qg..................................................................
I7IHC0_BABMI/77-240                  ...............................................ssh---ENNTVISNLNPILRNNILSS.EYYK-SIAGFD.......................................T........FEEILQEIHQH..ADHAEP..............FCSA.NRL...........................................KP.STLFCCLYKL.FTMN.LEDD..........NLNL.LLE...............................................DTTSVYARC............C....GFLY...I.....RYSFH........................YEKL....YKWF.K.....PYLLDIQ.---------...................EFTIDl..aKSKTVTLGGYLHS.LL.......IDEKYFT..I..VLPRLPIKF------knnc................................................................
I1PSX7_ORYGL/3-166                   ...............................................iqt---SGKPIDLLMEKVLCMNIMSS.DYFK-ELYRLK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HPDSPYIRA............I....GFLY...L.....RYVAD........................PKIL....WTWY.E.....PYLKDDE.---------...................EFSPG...sNGRMTTMGVYVRD.LI.......LGQYYFD..S..LLPRVPLPV------irqvt...............................................................
U6MKH2_9EIME/136-301                 .................................................l-AVHGKNPQLLFSRIVRRKVYES.FFWKEECFAAT.......................................A........-ATVVELAAA-..LQYVGG..............-TFG.GIR...........................................AA.SPFLCLVLKL.LQLQ.PEKQ..........IILE.FIK...............................................QEDFKYLRA............V....GAFY...F.....RLVGP........................SAEV....YVHL.E.....PLLADYR.KLRLRLPDG...................-----....SFRVSFMDEFVDD.CL.......RKRSLFD..V..DLPPLVQRQV-----fvlqq...............................................................
B3S4R2_TRIAD/10-175                  ................................................vt--VKGTNPQYLVEKITRSRIYEC.KYWKEKCFAVT.......................................A........-ELLVDRAME-..LDHIGG..............-TFG.GNI...........................................KP.TPFLCLILKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDYKYVRA............L....GAIY...M.....RLVGT........................SNDC....YNYL.E.....PLYNDFR.KLKRKQRSG...................-----....QFQVIHMDEFVEE.LL.......TEDRACD..T..ILPRIQKRYILEQT-n...................................................................
G3Y0M7_ASPNA/20-209                  ................................................pl--VRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTSIGG..............-VYG.VSE...........................................KP.SPFLCLAFKL.LQLN.PERD..........IILE.YLNfsdpandedstg......................heerehddgvvkaRGDFKYLRA............L....AAFY...V.....RLTFE........................PVEV....YKTL.E.....PLLLDYR.KLKRRVRDS...................-----....-FTLTYMDQFVDE.LL.......TKERVCG..T..SLWKLPARQVLEDL-d...................................................................
A0A059JZU0_TRIRU/20-222              ................................................pl--IRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTYIGG..............-TYG.VGQ...........................................KP.TPFLCLAFKL.LQLA.PEKE..........VILE.YLNfhdpeadeedlkvrgdstd.........adggagdaqdradaailkaTGDFKYLRA............L....AAFY...I.....RLTFE........................PVEI....YKTL.E.....PLLTDYR.KLKRRTKEG...................-----....-FLLTYMDQFVDD.LL.......TKDRVCG..T..SLWKIPTRTILEDL-d...................................................................
V9KJZ8_CALMI/61-245                  .................................................l-PLWGNEKTMNLNPLILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHIEP..............WEKG.SRKtsgqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRG............L....GFMY...I.....RYTQP........................PADL....WDWY.E.....SFLDDEE.---------...................ELDVKa..gGGCVMTIGEMIRS.FL.......TKLEWFS..T..LFPRIPVPVQKN---ldq.................................................................
M7XZP0_RHOT1/10-174                  .................................................l-SVHGTNPQYLVPTVIRKRVYDT.LYWKEHCFALN.......................................S........-ATIIDRAVE-..LKYIGG..............-TYA.NTR...........................................-P.TEFMCLVLKL.LQLQ.PERE..........IVLE.YLR...............................................AEEFKYLRA............L....AAFY...V.....RLTFD........................SLNA....YETL.E.....PLLDDYR.KLRFRGMDG...................-----....SYSILTMDEFVDQ.LL.......AGEMVCE..I..QLPRLTQRKVLEDT-e...................................................................
Q4QCT1_LEIMA/4-144                   ........................................nlkgraaias-----------LDPPTRYRVLHS.HTMT-RCANKP.......................................L........-LWVLEELIT-..LRYLGG..............-LTG.PLH...........................................TA.NYFICLVVRL.LQIC.PSVA..........IVRV.MLE...............................................QDVHKYLRA............A....ALLI...I.....RLIGN........................VELQ....REAM.R.....VGWSDYR.KLCLYGSDP...................-----....-------------.--.......-------..-..---------------aqelaeststtaaga.....................................................
S6BKY2_BABBO/10-107                  ................................................vm--VHGTNPQNLFSKILRDKVYNS.MYWKESCFGLT.......................................A........-ESIIDKAID-..LQYIGG..............-TFG.GNR...........................................QP.SPFLCLVLKL.LQIQ.PEIE..........IIQE.YIR...............................................NEEFKYLRA............L....GIYY...M.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------....................................................................
F6SUR6_MONDO/10-175                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
E1ZPB8_CHLVA/2-179                   ................................................eq---YGNQTTFNLESVLLQNIKRS.QYWEKRAKDIA.......................................D........WSELVDEIFET..VDNVEP..............WMSG.NAR...........................................GP.STAFNLLYRL.CQLK.PDVR..........QVRQ.MLD...............................................HVDSTFIRA............I....GLLY...L.....RYVCD........................PRQL....WDWF.R.....NYVRDEE.ICKAGLLSLlf...............tqEFEPSp.pgLGRTVTIGAFARD.IL.......LDQFYFE..T..IFPRVPKP-------ggadr...............................................................
J3MVI2_ORYBR/10-175                  ..................................................KSIHGTNPQNLVEKIVRSKIYQS.TYWKEQCFGLT.......................................A........-ETLVDKAME-..LDHTGG..............-TYG.GSR...........................................KP.TPFLCLALKM.LQIQ.PDKD..........IVVE.FIK...............................................NEDYKYVRV............L....GAFY...L.....RLTGT........................VADV....YQYL.E.....PLYNDYR.KIRQKLSDG...................-----....KFTLTHVDEFIDE.LL.......TKDYSCD..T..ALPRIQKRWVLET--sg..................................................................
W2S0L2_9EURO/19-185                  ................................................pl--IRGQNPATFIETATRDRITDS.LYWKEQCFGLN.......................................A........-ATLLDRAVE-..LTYIGG..............-TYG.VGM...........................................RP.TPFLCLAFKL.LTIV.PDRD..........IVLE.YLNr.............................................gGEEWKYLRA............L....AAFY...I.....RLTFD........................PAEI....YKTL.E.....PFLEDSR.KLRRRRKEI...................-----....-YVLTYMDEFVDE.LL.......TKKRSMG..T..ALWPMPSRQALEDL-d...................................................................
N4U2P3_FUSC1/25-192                  ...............................................vap---NGLNPATIMEKAVKDRIVDS.YFYKEQCFALN.......................................E........-ADIVDRVVEH..VNFIGG..............-TYG.VTQ...........................................KP.SPFLCLAFKL.LELS.PSDA..........VLME.YLKy.............................................gGEAFKYLRA............L....ACFY...F.....RLTRQ........................AKDV....YEML.E.....PFLEDRR.KLRRRGRAG...................-----....-VVLTFMDEFVDE.LL.......TKERVCG..T..SLWKMPKREVLEDL-e...................................................................
F0XVG8_AURAN/1-161                   ................................................mv--LHGNQETFNLNPLLANCILNH.EYSR-VLWEMG.......................................P.......sFDKLVAEARTK..VTHVEP..............WQRG.TSR...........................................TP.STAFCIVMRL.FQLN.LHEG..........HVRA.LLD...............................................QRDAPWVRC............V....GFLY...L.....RYVCP........................PGDL....WKWC.E.....DVLLDDG.---------...................AAPVE....PRGDVSLSQWLRG.LL.......TDQKYFG..T..ILPRIPLKI------er..................................................................
A4HE72_LEIBR/304-441                 .........................ftafeqheqnvkavlhycetnvcya-----------------------.-----------.......................................-........-----------..------..............GVFD.DHE...........................................EA.SPFLVAMGLC.WRLG.LTMD..........DVCR.HFA...............................................RHPRRVIRA............L....ALYL...A.....RYTLA........................PEDY....VYFF.T.....PSLCDEV.VIACTEDAQ...................-----....--VTLSMRDLSRQ.LL.......TKNDVVD..A..WLPILSKHWQ-----vnv.................................................................
H2KT99_CLOSI/29-213                  .................................................l-KLWGNQQTMNLNTMVYTNIVQS.PYFKANLIELR.......................................T........YHEVIDEIYYK..VEHLEP..............WERG.SRRvggqsgmcg.........................gvrgvgaggIV.STAFCLLYKL.FTLK.LTRK..........QLKG.LLD...............................................HPDSPYIRA............L....GFMY...I.....RYCLP........................PEDF....WWWY.A.....PYLDDAE.---------...................EIDVKa..gGGSMMTIGSMIQH.WL.......TKLDWFG..T..LFPRIPVPVQKK---lee.................................................................
PR38A_HUMAN/10-175                   .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
Q5DGL2_SCHJA/27-211                  .................................................l-KLWGNPQTMNLNTMIYTNIVQS.PYFKANLVELK.......................................T........YHEVIDEIYYK..VEHLEP..............WERG.SRRiggqtgmcg.........................gvrgvgaggIV.STAYCLLYKL.FTLK.LTRK..........QLKG.LLD...............................................HPDSPYIRA............L....GFMY...I.....RYCIP........................PEDF....WWWY.S.....PYWSDPE.-----ELD-...................-VKPG....GGCIMTIGNMLEH.WL.......TKLDWFS..T..LFPRIPVPVQKK---lee.................................................................
A4RRH8_OSTLU/10-175                  .................................................k-TVRGMDPQNIMERITRDKVYAM.TYWKEKCFAVS.......................................A........-EALVDLAVD-..LRAVGG..............-IYG.GNN...........................................RA.TEFLCLTLKL.LQIQ.PEKE..........IILE.FIK...............................................NEDHKYVRL............L....GAFY...L.....RLVGK........................PTDV....YQYL.E.....PLLNDYR.KVRYRSRDG...................-----....KYVLTHVDEFVNN.LL.......TKDMFCD..V..ALPRVPHRQALEA--ag..................................................................
H2R123_PANTR/10-175                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
I6UEY9_ENCHA/2-166                   ..............................................qykg-----------INRMTREKILSS.EEFK-SMRSFT.......................................E........-SDVVESICT-..LDSIGG..............LVRG.---...........................................VP.HRFLCLVQKM.GAIS.MKEE..........AIAI.SLEnlrptepr...............................iedssmkkFRGNVCLIA............A....SLLY...L.....RLSKR........................FDDY....RSLT.K.....SFLMDFR.KIPVIDSQN...................-----....NRTFMYLDVLADD.LL.......NKNRIFN..V..HLG------------ganrt...............................................................
G3VUT2_SARHA/10-175                  .................................................h-HIHGTNPQFLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDRATE-..LRFVGG..............-VFG.PNI...........................................QP.TPFLCLTLKM.LQIQ.PEKD..........IVIE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AMDC....YNYL.E.....PLYNDNR.KSRIQNRNG...................-----....DFEFIHVDEFIDQ.LL.......HSERVCD..I..ILPRLQKRHVLEET-n...................................................................
S3BY96_OPHP1/25-192                  ...............................................vap---NGLNPATIMEKAVRERIIES.YFWKEQCFGVN.......................................E........-ADIVDRVVDH..VSCIGG..............-TTG.TSQ...........................................KP.TPFLCLAFKL.LQLA.PSDE..........ILAA.YLSq.............................................gGEKFKYLRA............L....ALFY...V.....RLTRP........................AADV....FKTL.E.....PFLADKR.KLRRKGRAG...................-----....-TQLTFVDDFVDD.LL.......TKSRVCA..T..SLWKLPQREDLED--vg..................................................................
A3GFM9_PICST/15-192                  ...............................................dkr---NVLNRAHLIEPIVRHRIQDS.LFYKQHLHLTN.......................................E........-ASILPVIIDQ..VHYLAG..............--MD.SSG...........................................RP.SPFICCLLRL.LELE.PSME..........IVQT.CLDq............................................lgYNEFKYLTA............L....MLIY...I.....RLVGS........................SDLV....YTTF.D.....KYLSDFR.KLRTKLKSP...................IFNEKglpiNYRLTYFDEWIDN.ML.......LQERVMD..I..ILPRLTPRRNLVE--kg..................................................................
W9IMM9_FUSOX/25-192                  ...............................................vap---NGLNPATIMEKAVKDRIVDS.YFYKEQCFALN.......................................E........-ADIVDRVVEH..VNFIGG..............-TYG.VTQ...........................................KP.SPFLCLAFKL.LELS.PSDA..........VLME.YLKy.............................................gGEAFKYLRA............L....ACFY...F.....RLTRQ........................AKDV....YEML.E.....PFLEDRR.KLRRRGRAG...................-----....-VVLTFMDEFVDE.LL.......TKERVCG..T..SLWKMPKREVLEDL-e...................................................................
PR38B_RAT/47-231                     .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
G3TY10_LOXAF/47-231                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
L9KRQ0_TUPCH/10-175                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.ANI...........................................KP.MPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
G3MTI6_9ACAR/14-198                  .................................................l-PLWGNEKTMNLNNLILTNILSS.PYFKVNLYKLK.......................................T........YHEVVDEIYYN..VQHLEP..............WEKG.SRKtsgqtgmcg.........................gvrgvgaggIV.STAFCILYKL.FTLK.LTRK..........QLVG.LMN...............................................HCDSPYIRA............L....GFMY...I.....RFTQP........................PADL....VDWY.E.....PYLDDEE.---------...................ELDVKa..gGGQVLRIGDMLRH.LL.......TKLEWFA..T..LFPRIPVPIQKEIE-r...................................................................
Q57XW0_TRYB2/195-343                 .......................kqhkqqqssnheavtslresqrherrv-----------------------.-----------.......................................-........-ESLLHYCEQN..VLYIGV..............--MD.EEG...........................................KA.TPFLLAIGAF.YKLG.LTRH..........DALV.HFA...............................................RHHRRTIRA............L....ALFI...A.....RYTTA........................PEEL....EPFF.T.....PSLTDEV.VVACAEDQQ...................-----....--VTCSMRQLAED.LL.......LHDEVCE..A..---------------wpptlhpf............................................................
Q2U457_ASPOR/20-209                  ................................................pl--VRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTSIGG..............-TYG.VSE...........................................KP.TPFLCLAFKM.LQLN.PDRD..........IVLE.YLNftdpvndeegeq......................taaeqaengvvkqRGDFKYLRA............L....AAFY...V.....RLTFD........................AVDV....YKTL.E.....PLLLDYR.KLKRRVRDS...................-----....-VVLTYVDQFVDD.LL.......TKDRVCG..T..SLWKLPSRQQLEDL-d...................................................................
D7MIA4_ARALL/4-168                   .................................................i-QTNGRAYESLLEKVLSMNILSS.DYFK-ELYGLK.......................................T........YHEVIDEIYNQ..VNHVEP..............WMGG.NCR...........................................GP.STAYCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HTDSPYIRA............V....GFLY...L.....RYVAD........................AKTL....WTWY.E.....PYIKDDE.---------...................EFSPG...sNGRMTTMGVYVRD.LL.......LGLYYFD..T..LFPRIPVPVMRQ---ivs.................................................................
U3IFV6_ANAPL/4-188                   .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKTID-q...................................................................
G5B2Y6_HETGA/1-99                    ..................................................-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.---------M.LQIQ.PEKE..........IIIE.FLK...............................................NEDCKYVRL............L....GALY...T.....RLTGT........................AIDC....YKYL.E.....PLYKDYR.KIKSQKQNG...................-----....ELELMHVDDFIDV.LL.......HSETVCE..I..ILPRLQKRYVLQEA-e...................................................................
U5FR78_POPTR/10-175                  ..................................................KNIRGTNPQNLVEKILRSKIYQH.TYWKEQCFGLT.......................................A........-ETLVDKAME-..LDHLGG..............-TYG.GNR...........................................KP.TPFMCLVMKM.LQIQ.PEKD..........IVVE.FIK...............................................NEDYKYVRV............L....GAFY...L.....RLTGT........................DIDV....YRYL.E.....PLYNDYR.KLRKKLTDG...................-----....KFALTHMDEVIDE.LL.......TKDYSCD..I..AMPRIKKRWTLET--la..................................................................
G3I797_CRIGR/6-93                    ...............................................vky---AHHNPQYMVEKIIRTRIYES.KYWKEESYGLT.......................................A........-ELVVNKAME-..LRFVGV..............-VYG.GNI...........................................KP.TPFLGLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDF-----............-....----...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------n...................................................................
K9FM30_PEND2/20-204                  ................................................pl--IRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTSIGG..............-TYG.VSE...........................................KP.TPFLCLAFKL.LQLG.PDRD..........VILE.LLNytdpgsgdea...........................enpddalvkdRGDFKYLRA............L....AAFY...V.....RLTFD........................PVDV....YKTL.E.....PLLLDYR.KLKRRVRDN...................-----....-FTLTYMDQFVDD.LL.......TKDRVCG..T..SLWKLPPRSQLEDL-d...................................................................
H0WS15_OTOGA/10-175                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
Q8II38_PLAF7/11-175                  ...............................................knf----GSNPQYLISNIIRSKIYDS.PYWKEKCFALT.......................................S........-ESIIDQAIN-..LKYVGG..............-TYG.GNR...........................................KP.TRFLCLILKL.LQIQ.PDKD..........IIYE.YIK...............................................NEDFVYLRA............L....GIFY...L.....RLIGK........................SLEV....YNHL.E.....PILFDYR.KIRMRLQNG...................-----....TFEKIYMDVFVDN.CL.......ILNNFLD..V..DFPTLTKRQVLEEN-n...................................................................
V9FB38_PHYPR/37-201                  .................................................l-PIYGNDTTYNLNTLLHQNILQS.AYFH-ELYKFR.......................................T........YHEVVDEIYYR..VDHAEP..............WSPG.TAR...........................................IP.SSCFCLLHKF.LLMR.LTRK..........QMQG.LLR...............................................HTDSPYIRV............V....GFLY...L.....RFTCD........................PEEL....WTWF.E.....PFLEDPE.---------...................EFNASa..nPSVKTTIGEWLIS.LL.......EENNYFG..T..ILPRIPKKIE-----dgik................................................................
E3RUL4_PYRTT/23-233                  .................................................k-LIRGQNPALLFEKGVRERITES.YYWKEQCFGLN.......................................A........-ATLCDRAAE-..LKFIGG..............-TTG.ING...........................................KP.TPFLCLAFKM.LQLV.PDKD..........IILE.YLNfrdddedeehnedntdanadaen.ghvsdtestaaakktldlnakgkLGNFKYLRC............L....AAFY...I.....RLAWE........................PVEI....YTTL.E.....PLLTDYR.KIKRRLKDA...................-----....-FTLTYIDQFVDD.LL.......TKERICA..T..SLWKLPSRANLEDL-d...................................................................
B4NNL6_DROWI/10-175                  ..................................................KNVHGTNPQYLIEKIIRSRIYDS.KYWKEQCFALT.......................................A........-ELLVDKAME-..LRFVGG..............-VFG.GNI...........................................KP.TQFLCLTLKM.LQIQ.PEKD..........IVVE.FIK...............................................NEEFKYVRA............L....GAFY...L.....RLTGA........................ALDC....YKYL.E.....PLYIDNR.KLRRQNRSG...................-----....QFEIVYMDEYIDE.LL.......RNDRVCD..I..ILPRIQKRTILEEN-n...................................................................
A0A059ADM4_EUCGR/1-112               .................................................m-----------------------.-----------.......................................-........-----------..------..............--TG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HPDSPYIRA............I....GFLY...L.....RYAAD........................PKTL....WSWC.E.....PYVKDEE.---------...................EFSPG...sNGRMTTMGVYLRD.LL.......LGQYYFD..T..LFPRIPVPVL-----rqiv................................................................
C1H036_PARBA/67-261                  ................................................pl--IRGVNPATLFEKAVRDRITES.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTYIGG..............-TYG.LAQ...........................................KP.TPFLCLAFKM.LQLS.PEKE..........IVLE.YLNfndpetghdgvygen.................nveedhdtdsgvvkaVGDFKYLRA............L....AAFY...I.....RLTFD........................AAEI....YTTL.E.....PLLADYR.KLKRRTKDG...................-----....-FLLTYMDQFVDD.LL.......TKDRVCA..T..SLWKLPSRTQLEDL-d...................................................................
E6NU38_JATCU/10-175                  ..................................................KSIRGTNPQNLVEKILRSKIYQN.TYWKEQCFGLT.......................................A........-ETLVDKAME-..LDHLGG..............-TFG.GNR...........................................KP.TPFMCLVMKM.LQIQ.PEKD..........IVVE.FIK...............................................NDDYKYVRI............L....GAFY...L.....RLTGT........................DVDV....YRYL.E.....PLYNDYR.KLRQKLPDG...................-----....KFALTHVDEVIDE.LL.......TKDYSCD..V..ALPRIKKRWTLES--lg..................................................................
Q6CS55_KLULA/14-213                  ..................................................KQLNHQSASLVVPQIFRNKVSSC.MYYKFNLTPAS.......................................Lrg....dtIVELIPVIVRD..FGTMDErkt........phvTVLG.GIE...........................................--.--FKCLLMKL.INLR.PPWE..........QLKV.LLEp............................................hePLNNKYIAA............L....VLCY...M.....RISYYfltesn...........pseqdisFNLL....HDLM.K.....KYILDHR.KLKSYSLDMdc...............wsSSIKK....EIKLIHFDELIDW.LC.......DRNEIWG..I..PLGKCNW-CKI----wddee...............................................................
G8YR38_PICSO/12-187                  ...............................................dkr---NVLNKASLVEPIVRHRVQDS.IFYKQYLYLTN.......................................E........-STILNVIIEH..VHYIGG..............--TS.ANG...........................................KP.SPFLCCMVRL.LELE.PKQE..........IIQM.YLSq............................................mgTNTFKYLTA............M....TLMY...I.....RFVGS........................SEEI....YSIL.E.....EYYKDYR.KLRFQLKYPr................dhNGVHK....LYTLTYMDEWVDD.LL.......HKERLVD..L..ILPRLPPRRFL----qei.................................................................
G1Q147_MYOLU/28-211                  .................................................l-QLWGNEKTMNLNPMILTNI-SS.PYFKGQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgiggIV.STAFCLLYKL.FTLK.LTRK..........QVVG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLWS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
I3ND88_SPETR/50-234                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
Q7PX02_ANOGA/10-175                  ..................................................KNVHGTNPQYLIEKIIRSRIYDS.KYWKEQCFALT.......................................A........-ELLVDKAME-..LRFVGG..............-VFG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IVVE.FIK...............................................NEEFKYVRA............L....GAFY...L.....RLTGS........................SLDC....YKYL.E.....PLYNDNR.KLRKQNRMG...................-----....AYELIHMDEFIDE.LL.......REERVCD..I..ILPRIQKRHVLEEN-n...................................................................
W7TLT3_9STRA/33-198                  .................................................l-PIHGNQTTYNVNTLLANNIMGC.DYFR-ALYPLQ.......................................T........YHEVIDEVYNK..VTHVEP..............WATG.TSR...........................................LP.STAFCLLFKF.FTMR.LTKK..........QVTG.LLT...............................................HSDSPYIRA............I....GFLY...L.....RYACD........................PKQI....WDWY.A.....PYLDDSE.---------...................EFAPSs..dPNALTTLGLWLRG.LL.......SDLHYYG..T..MLPRIPVPLERK---ikm.................................................................
W6XT96_COCCA/23-228                  ................................................al--IRGQNPALLFEKGVRERITES.YYWKEQCFGLN.......................................T........-ATLCDRAAE-..LKFIGG..............-TTG.ITG...........................................KP.TPFLCLAFKM.LQLV.PEKE..........IILE.YLNfrddeddeddkaevkkengd......aaanddddsakkeldlnaagkLGCFKYLRC............L....AAFY...I.....RLAWE........................PVEI....YKTL.E.....PLLTDYR.KIKRRLKDT...................-----....-FTLTHVDQFIDD.LL.......TKDRICA..T..SLWKLPSRAILEDL-d...................................................................
PR38B_HUMAN/47-231                   .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
F7HY13_CALJA/10-175                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
W5HDU6_WHEAT/23-68                   ...............................................lqt---SGRPIEVLMEKVLSMNIVSS.DYFK-ELYKIK.......................................T........YHEVIDEIYNQ..V-----..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....----...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------....................................................................
E9AUQ4_LEIMU/4-145                   .........................................nlkgraava----------ALDPPTRYRVLHS.HTMT-RCANKP.......................................L........-LWVLEELIT-..LRYLGG..............-LAG.PLH...........................................TA.NYFISLVVRL.LQIC.PSVA..........IVRV.MLE...............................................QDVHKYLRA............A....ALLI...I.....RLIGN........................VELQ....REAM.R.....VGWSDYR.KLCLYGSDP...................-----....-------------.--.......-------..-..---------------aqelaestsataagae....................................................
G3QMW7_GORGO/10-175                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
W7JYK7_PLAFO/173-335                 ...............................................lem----TNTTTYNVNTLLRNNILSS.EYFK-SLIPIK.......................................T........FKEVVDEIHSY..ADHVEP..............YCIG.SNR...........................................AP.STLFCCLYKF.FTMQ.LSEK..........QLKS.LIE...............................................NKDSCYIRA............C....GFLY...L.....RYVHS........................PANL....WMWF.E.....PYLLEED.---------...................EFSISc..dKRRKVTIGEYVQS.LL.......SDDKYFN..T..VLPRLPIKIK-----nvy.................................................................
Q9FHS8_ARATH/4-159                   ................................................iq--SNGRAYESLLEKVLSMNILSS.DYFK-ELYGLK.......................................T........YHEVIDEIYNQ..VNHVEP..............WMGG.NCR...........................................GP.STAYCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HTDSPYIRA............V....GFLY...L.....RYVAD........................AKTL....WTWY.E.....PYIKDDE.---------...................EFSPG...sNGRMTTMGVY---.--.......---YYFD..T..LFPRIPVPV------mrqiv...............................................................
N4VSA6_COLOR/24-191                  ...............................................lap---NGENPATIMEKAVRERIIKS.EYYLAQCFALN.......................................E........-ADIVDRVVED..VTCVGG..............-TYG.VTQ...........................................KP.TTFLCLAFKL.LQLA.PSDD..........VVQT.YLAh.............................................gGDKFKYLRA............L....ACFY...V.....RMTRR........................PKDV....YLLL.E.....PFLEDRR.KLRKKGREQ...................-----....-TTLTYVDEFVDD.LL.......VKTRVCA..T..SFRELPKRVDLVD--lg..................................................................
E4YZY4_OIKDI/10-175                  .................................................n-TIKGTNPQFLIEKIIRSRIYES.RYWKEECFALT.......................................A........-ELLVDKALQ-..LKYIGG..............-TTA.AHV...........................................KP.TPFLCLLCKM.LQIQ.PEKD..........IVIE.FIK...............................................QDEFKYVRC............L....GAMY...L.....RLTGN........................SVEC....YKYL.E.....ELLADFR.RVKTMNKMG...................-----....AFETSHIDEFIDS.LL.......IEDRVCE..V..ILPRLQRRAVLEEQ-g...................................................................
L7LUD5_9ACAR/14-223                  .................................................l-PLWGNDKTMNLNNLILTNILSS.PYFKVNLYKLK.......................................T........YHEVVDEIYYN..VQHLEP..............WEKG.SRKtsgqtgmcggvrgvxlepwekgsrktsgqtgmcggvrgvgaggIV.STAFCILYKL.FTLK.LTRK..........QLVG.LLN...............................................HCDSPYIRA............L....GFMY...I.....RFTQP........................PADL....IDWY.E.....PYLDDEE.---------...................ELDVKa..gGGQVLRIGDMLRH.ML.......TKLEWFA..T..LFPRIPVPIQKEIE-r...................................................................
J6E9Q7_SACK1/15-219                  ..................................................KQLNNQSVSLIIPRLTRDKIHNS.MYYKVNLSNES.......................................Lrg....ntMLELLKVIIDA..LGTLRGqdg.......hlnmAVLG.GVE...........................................--.--FKCILMKL.VEIR.PNLK..........QLAF.LLDvk..........................................nvkDFNSKYIIA............L....VLVY...A.....RLQYYylndq.............nknnsyENDL....IQLF.Kvq.lyKYSQQFF.KLKSFPLQVdc...............faHSQNE....GLCIVHVDELVDW.LV.......TQDHIWG..I..PLGKCQWSKI-----ydsee...............................................................
S8GGV4_TOXGO/10-175                  ..................................................QQVHGCNPQTLVSRIIRRKIYES.AFWKEQCFALT.......................................A........-ETVLEPCVG-..LTYVGG..............-TYG.GKR...........................................QP.APFLCLVLKL.LQIQ.PEPE..........IILE.FIK...............................................QEQFKYLRA............V....GAFY...L.....RLVGR........................ACEV....YTHL.E.....PLLADYR.KLRLRLADG...................-----....KFTIVCMDEFVDD.CL.......RKTNFLD..V..DLPVLPKREVLESE-g...................................................................
R1EHA8_BOTPV/20-176                  ................................................al--IRGQNPALLFEKAVRDRIIES.YYWKEQCFGLN.......................................A........-ATLCDRAAE-..LTFVGG..............-TYG.GLG...........................................KP.TPFLCLAFKL.LQLV.PEKE..........IILA.YLNwpedeeredg...........................esdeghapgvKGDFKYLRA............L....AAFY...I.....RLAWE........................PVDI....YKTL.E.....PLLADYR.KLKRRMRDG...................-----....-------------.--.......-------..-..---------------fvltplnll...........................................................
W2VPF5_PHYPR/9-173                   ................................................qi--VHGVNPQTLVEKIMRNRIYAS.IYWKEQCFGLT.......................................A........-ETLVDKAVE-..LQEFGG..............-TFG.GNQ...........................................QP.THFLCLLLKM.LQLQ.PELE..........VVKQ.FIE...............................................NEDYKYVTV............L....GAVY...L.....RLVGK........................PLEV....YTLL.E.....PLLSDYR.KIRKRNVIG...................-----....-WEITHVDEIADA.LL.......HEEYYID..L..ALPRLADRELLEKN-e...................................................................
G0VC19_NAUCC/15-211                  ..................................................KELNNQSVSLVIPRLTRDKIHNV.LYYKVNLTSTS.......................................Lrg....ntMLQLSKIIIRD..LGQLKDsns........lknYLVG.GVE...........................................--.--FKCLLMKL.IEIR.PTFD..........QITM.LLEkkk........................................spddTFENKYIVA............L....ILTY...L.....RIQYYylk..................lhdASHL....INLF.R.....EYINDYR.KLKGIDMDMdc...............wsMSQQL....KVEIIHIDELVDR.LA.......TNNNIWG..I..PLGKCQWSNIF----eldd................................................................
A0A024W143_PLAFA/173-335             ...............................................lem----TNTTTYNVNTLLRNNILSS.EYFK-SLIPIK.......................................T........FKEVVDEIHSY..ADHVEP..............YCIG.SNR...........................................AP.STLFCCLYKF.FTMQ.LSEK..........QLKS.LIE...............................................NKDSCYIRA............C....GFLY...L.....RYVHS........................PANL....WMWF.E.....PYLLEED.---------...................EFSISc..dKRRKVTIGEYVQS.LL.......SDDKYFN..T..VLPRLPIKIK-----nvy.................................................................
V4ZI95_TOXGO/10-175                  ..................................................QQVHGCNPQTLVSRIIRRKIYES.AFWKEQCFALT.......................................A........-ETVLEPCVG-..LTYVGG..............-TYG.GKR...........................................QP.APFLCLVLKL.LQIQ.PEPE..........IILE.FIK...............................................QEQFKYLRA............V....GAFY...L.....RLVGR........................ACEV....YTHL.E.....PLLADYR.KLRLRLADG...................-----....KFTIVCMDEFVDD.CL.......RKTNFLD..V..DLPVLPKREVLESE-g...................................................................
C8Z8W9_YEAS8/15-219                  ..................................................KQLNNQSVSLVIPRLTRDKIHNS.MYYKVNLSNES.......................................Lrg....ntMVELLKVMIGA..FGTIKGqng.......hlhmMVLG.GIE...........................................--.--FKCILMKL.IEIR.PNFQ..........QLNF.LLNvk..........................................nenGFDSKYIIA............L....LLVY...A.....RLQYYylngn.............nkndddENDL....IKLF.Kvq.lyKYSQHYF.KLKSFPLQVdc...............faHSYNE....ELCIIHIDELVDW.LA.......TQDHIWG..I..PLGKCQWNKI-----ynsde...............................................................
W2MYS7_PHYPR/11-61                   .................................................q-SVHGVNPQTLVEKIMRNRIYAS.IYWKEQCFGLT.......................................A........-EALVDKILS-..------..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....----...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------rqqegsw.............................................................
PR38B_DANRE/25-209                   .................................................l-PLWGNEKTMNLNPMILTNVLSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VNHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HSDSPDIRA............L....GFMY...I.....RYTQP........................PPDL....VDWY.D.....EFLDDEE.---------...................ELDVKa..gGGCVMTVGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKAID-q...................................................................
H2ZEL3_CIOSA/29-213                  ................................................lt--CWGNPRTMNLNHLVLTNVQNS.PYFKVRLFELK.......................................T........YHEVVDEIYYK..VDHLEP..............WERG.TRKtagqtgmcg.........................gvrgvgaggVV.STSFCILFKL.FTLK.LTRK..........QVNG.LLN...............................................HTDSPFIRG............L....GVMY...I.....RYTQA........................PKDL....WNWY.E.....PYLEDEE.---------...................EIDVKa..gGGCVMTIGMMIRT.VL.......TKLDWFS..T..LFPRIPVPIQKEID-e...................................................................
A1YKG0_BRASY/3-151                   ...........................................iqssgrp-------IEVLMEKVLSMNIVSS.DYFK-ELYKIK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKL.FTMK.LTMN..........QMHG.LLK...............................................HPDSPYIRA............I....GFLY...L.....RYVAE........................PKTL....WTWY.E.....PYIKDDE.---------...................EFSPG...sNGKMTTMGVYVRD.VL.......LGQ----..-..---------------vyll................................................................
B8B2Q7_ORYSI/4-173                   ...........................................qssgrpi--------DVLMEKVLSVNILSS.DYFK-ELYRLK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.SSAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HPDSPYIRA............V....GFLY...L.....RYVAE........................PKTL....WSWY.E.....PYIKDDE.---------...................EFSPG...sNGKMTTMGVYVRD.LLlgqvhseQKRYYFD..S..LLPRVPLP-------ilrqvt..............................................................
B3MXQ1_DROAN/35-219                  .................................................l-PFWGNETSMNLNPLILANIQSS.SYFKVHLFKLK.......................................T........YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg.........................gvrgvgaggIV.STAYCLLYKL.YTLR.LTRK..........QING.LLN...............................................HTDSAYIRA............L....GFMY...L.....RYTQP........................PGDL....YDWY.E.....DYLQDEE.---------...................EIDVKa..gGGQVLTIGQMVYQ.FM.......TKLDWFS..T..LFPRIPVPIQKQIE-k...................................................................
S7UNW7_TOXGO/142-303                 ...............................................emt-----DSTTYNVNALLRSNILSS.EYFK-SLHELK.......................................T........VPEVVDEITQY..AQHAEP..............YCSG.SSR...........................................AP.STLFCCLYKL.FTMK.LTTK..........QLEQ.LLD...............................................YSDSPYVRC............T....GFLY...L.....RYVHP........................PEKL....WKWY.E.....QYFLDDE.-VFAASSD-...................-----....TKRTTTMGEYVES.LI.......MEDKYFN..T..VLPRLPVKVK-----nly.................................................................
F1L9R6_ASCSU/10-175                  ................................................vt--VKGTNPQYLVEKIIRTRIYDS.KYWKEECFALT.......................................A........-ELVVDRGIE-..LRYVGG..............-IYA.GNV...........................................KP.TPFLCLSLKL.LQIQ.PEKD..........IIVE.FIR...............................................QEEYKYIRA............L....GAMY...L.....RLTFS........................SIEV....YKYL.E.....PLYNDYR.KLRYMNKDG...................-----....RFELVYMDEFIDN.LL.......RQERYCD..I..QLPRLQSRQALEE--vg..................................................................
W4KIC8_9HOMO/10-173                  .................................................q-AIHGQNPQFLVETVIRNRIYES.SFWKEHCFALT.......................................A........-ETLIDKSLE-..LRCIGG..............-VYG.N-Q...........................................RP.TEFLCLLLKL.LQIQ.PEKE..........ILLE.YLQ...............................................ADEFKYLRA............L....TAIY...I.....RMTFG........................ASDV....YELL.E.....PLLKDFR.KLRYRNTTG...................-----....-NNITFIDDFVDQ.LL.......NDERVCD..I..ILPRIPKRQMLEE--ag..................................................................
U6J4Q3_ECHGR/1-99                    ..................................................-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.---------M.LQIQ.PDKD..........IVIE.FIK...............................................QEDYKYARA............L....GAFY...L.....RLVGE........................SVEI....YKYL.E.....ALYNDFR.KLKQQDTTG...................-----....KFSIVRMDEFIDQ.LL.......NEERVCD..V..ILPRLQKRSVLEDN-n...................................................................
B4P3Y2_DROYA/10-175                  ..................................................KNVHGTNPQYLIEKIIRSRIYDS.KYWKEQCFALT.......................................A........-ELLVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TQFLCLTLKM.LQIQ.PEKD..........IVVE.FIK...............................................NEEFKYVRA............L....GAFY...L.....RLTGA........................ALDC....YKYL.E.....PLYIDNR.KLRRQNRAG...................-----....QFEIVYMDEYIDE.LL.......RNDRVCD..I..ILPRIQKRSILEEN-n...................................................................
Q6IP13_XENLA/17-182                  .................................................h-SVHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LKFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRA............L....GALY...M.....RLTGT........................ATDC....YKYL.E.....PLYNDYR.KVKVQNRDG...................-----....EFELMHVDEFIDQ.LL.......HEERVCD..V..ILPRLQKRFVLEET-e...................................................................
A7F153_SCLS1/21-188                  ...............................................lap---NGLNPTTILEKPVRERIVDC.YFWKDQCFALN.......................................E........-ADIVSRVVSH..VTFIAG..............-TYG.DSQ...........................................RP.SPFLCLAFKL.LQLG.PSDE..........ILQE.YMGy.............................................gGEKFKYLRA............L....ALFY...W.....RMTRQ........................AKDV....FMVL.E.....GYLDDRR.KLRRKTRTG...................-----....-TTLTFMDQFVDD.LL.......TKDRVCG..T..TLWKMPKREILEDL-e...................................................................
S9VFC1_9TRYP/46-243                  ................................................wn--LQGRSAFAVLDPTTRHRIAHA.HNMT-RCRDQP.......................................L........-LWVLEELIT-..IESVGG..............-LSG.PLF...........................................RV.EYFLCLVARV.LQAA.PDPA..........VVLA.LLR...............................................QDVHKYLRV............A....ALFM...I.....RLIGN........................VAMQ....KEAV.R.....VGWDDYR.KIRVYGDEG...................EVD--....-------------.--.......-------..-..---------------yvfdatlrgrkxpreaaegeqppvnieeakpahyfilcmdeltdrlfrvdsdgekrsqffgvplpplm
H2ARW2_KAZAF/14-210                  ..................................................KQLNHQSVSLIIPRLTRDRIHNN.IYYKVNLQPTS.......................................Lrg....dtLLELSKVIIRD..LGTLKDlsv........nkvHVLG.GME...........................................--.--FKCLLMKL.IEIR.PTIN..........QLFA.MLNpan.........................................antNFEDKYITA............L....IITY...L.....RIQYFylt.................daqeCLRM....KNLF.K.....KCIKDYR.KLKSLSLQSdc...............wsPSEEL....TVAVVHMDELTEW.LV.......SKEQIWG..I..PLGKCQWADIF----ddds................................................................
N9V888_ENTHI/2-162                   .............................................sgper----------RLETILRNKIYNC.EYWKQQCFTLT.......................................S........-ETILDEIVK-..LHDFGG..............-TYG.VLK...........................................KP.TKFIVLIMKL.LMLR.PDKS..........IIYE.YIM...............................................NEEFKYVRV............I....GAFY...L.....RLIGS........................SKEC....YQFI.E.....PLYYDYR.PLKYRIDSK...................-----....HYEIITIDQFAWN.LL.......HLDYYCD..I..TLPIITPRPVIE---shg.................................................................
L8X0R2_THACA/10-163                  .................................................i-HIHGQNPQFLVEKVIRTRIWES.AYWKEQCFALT.......................................G.......rPESLIDKAIE-..LNSIGG..............-VYG.N-Q...........................................RP.TDFISLLLKL.LQIQ.PEKE..........ILIE.YLM...............................................VDEFKYLRA............L....AAMY...I.....RMTFP........................PVEV....YELL.E.....PLLKDYR.KLRLRNMDQ...................-----....-------------.LL.......TEERVCD..I..ILPRLAKREVLEET-e...................................................................
C5GJR6_AJEDR/20-214                  ................................................pl--IRGANPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTYIGG..............-TYG.LAQ...........................................KP.TPFLCLAFKL.LQLA.PEKD..........IVLE.YLNfhdpenerveggegn.................gleeeqdandgvvkaVGDFKYLRA............L....AAFY...I.....RLTFD........................AADI....YRTL.E.....PLLVDYR.KLKRRTKDG...................-----....-FMLTYIDQFVDD.LL.......TKDRVCG..T..SLWKLPSRTQLEDL-d...................................................................
K3W962_PYTUL/10-174                  .................................................q-SIHGVNPQHLIEKIMRNRIYAS.VYWKEQCFGLT.......................................S........-ETLVDKAIE-..LNYFGG..............-TFG.GNQ...........................................QP.TPFLCLLLKM.LQLQ.PELE..........VVRE.FIQ...............................................NEEYKYVSV............L....GAVY...L.....RLVGK........................PLEI....YSIL.E.....PMYSDYR.KIRKRNVIG...................-----....-WEITHIDEIVDA.LL.......FEEYYID..L..ALPRMVDREFYEK--ng..................................................................
E9AXK8_LEIMU/273-441                 ....daelwsvlesrltdelveqvrssgaapnggrlltafeqheqnvkav-----------------------.-----------.......................................-........----LRYCEQN..VRYAG-..............-VFD.DNE...........................................EA.SPFLLAMGLC.WRLG.LTMD..........DVCR.HFA...............................................RHPRRVVRA............L....ALYL...A.....RYTLA........................PEDY....VYFF.T.....PSLCDEV.IIACTEDAQ...................-----....--VTFSMKDLSRQ.LL.......TKNDVVD..A..WLPIVSKH-------wqeg................................................................
B7QBZ1_IXOSC/10-175                  .................................................h-SVRGTNPQYLIEKIIRSRIYDS.RYWKEECFALT.......................................A........-ELLVDKAME-..LKFIGG..............-VYG.GNV...........................................KP.TPFLCLLLKM.LQIQ.PEKD..........IVVE.FIR...............................................QEDFKYVRA............L....GANY...M.....RLVGS........................SLDC....YKYL.E.....PLYNDYR.KLRRQNRDG...................-----....TFAIVHMDELIDE.LL.......REERAAD..V..ILPRIQKRHVLEET-n...................................................................
M3Y690_MUSPF/10-175                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
A0A024Y362_YEASX/15-219              ..................................................KQLNNQSVSLVIPRLTRDKIHNS.MYYKVNLSNES.......................................Lrg....ntMVELLKVMIGA..FGTIKGqng.......hlhmMVLG.GIE...........................................--.--FKCILMKL.IEIR.PNFQ..........QLNF.LLNvk..........................................nenGFDSKYIIA............L....LLVY...A.....RLQYYylngn.............nkndddENDL....IKLF.Kvq.lyKYSQHYF.KLKSFPLQVdc...............faHSYNE....ELCIIHIDELVDW.LA.......TQDHIWG..I..PLGKCQWNKI-----ynsde...............................................................
K4B140_SOLLC/10-175                  ..................................................KSIRGTNPQNLVEKILRSKIYQN.TYWKEQCFGLT.......................................A........-ETLVDKAME-..LDHLGG..............-TFG.GNR...........................................KP.SPFICLVMKM.LQIQ.PEKD..........IVVE.FIK...............................................NEDYKYVRV............L....GAFY...L.....RLTGT........................DIDI....YRYL.E.....PLYNDYR.KLRRKSADG...................-----....QYALTHVDEYIDE.LL.......TTDYSCD..I..ALPRIKKRWILEQN-k...................................................................
E9QD55_DANRE/25-170                  .................................................l-PLWGNEKTMNLNPMILTNVLSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VNHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HSDSPYIRA............L....GFMY...I.....RYTQP........................PPDL....VDWY.D.....EFLDDEE.VC-------...................-----....-------------.--.......-------..-..---------------rhgs................................................................
A0A026WAG5_CERBI/37-224              .................................................l-PLWGNERTMNLNPLILTNIQSS.HYFKVNLYELK.......................................T........YHEVIDEIYYK..VSHLEP..............WEKG.SRKtagqtgmcggr.....................fmqvrgvgaggIV.STAYCLLYKL.FTLR.LTRK..........QLNG.LIN...............................................HPDSPYIRA............L....GFMY...I.....RYTQP........................PADL....FTWY.S.....DYLEDEE.---------...................ELDVKa..gGGQTMKMGDILKQ.FL.......TKLEWFS..T..LFPRIPVPIQKD---le..................................................................
Q8RUP2_ORYSJ/23-76                   ..............................................kkvv---------------LSVNILSS.DYFK-ELYRLK.......................................T........YHEVINVIYNQ..VDHVEQ..............WMTG.Q--...........................................--.----------.----.----..........----.---...............................................---------............-....----...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------llwplqrll...........................................................
S4RLN9_PETMA/10-137                  .................................................h-SIRGTNPQYLVEKIIRTRIYES.KYWKEECFALT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLVLKM.LQIQ.PEKD..........IVVE.FIR...............................................NEDFKYVRL............L....GAMY...M.....RLTGT........................PMDC....YKYL.E.....PLYNDYR.KIKRQARSG...................-----....-------------.--.......-------..-..---------------....................................................................
A5C7T6_VITVI/10-175                  ..................................................KSIRGTNPQNLVEKILRSKIYQN.TYWKEQCFGLT.......................................A........-ETLVDKAME-..LDHLGG..............-TFG.GNR...........................................KP.TPFMCLVMKM.LQIQ.PEKD..........IVVE.FIK...............................................NEEYKYVRI............L....GAFY...L.....RLTGI........................DTDV....YQYL.E.....PLYNDYR.KLRRKLSDG...................-----....NYSLTHVDEVIDE.LL.......TKDYSCD..V..ALPRIKKRWTLES--lg..................................................................
A1YKF9_BRASY/3-165                   ...........................................iqssgrp-------IEVLMEKVLSMNIVSS.DYFK-ELYKIK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKL.FTMK.LTMN..........QMHG.LLK...............................................HPDSPYIRA............I....GFLY...L.....RYVAE........................PKTL....WTWY.E.....PYIKDDE.---------...................EFSPG...sNGKMTTMGVYVRD.VL.......LGQYYFD..S..LLPRVPL--------lilrqv..............................................................
A6ZV57_YEAS7/15-219                  ..................................................KQLNNQSVSLVIPRLTRDKIHNS.MYYKVNLSNES.......................................Lrg....ntMVELLKVMIGA..FGTIKGqng.......hlhmMVLG.GIE...........................................--.--FKCILMKL.IEIR.PNFQ..........QLNF.LLNvk..........................................nenGFDSKYIIA............L....LLVY...A.....RLQYYylngn.............nkndddENDL....IKLF.Kvq.lyKYSQHYF.KLKSFPLQVdc...............faHSYNE....ELCIIHIDELVDW.LA.......TQDHIWG..I..PLGKCQWNKI-----ynsde...............................................................
W8BTB5_CERCA/10-175                  ..................................................KNIHGTNPQYLVEKIIRSRIYDS.KYWKEQCFALT.......................................A........-ELLVDKAME-..LRFIGG..............-VYG.GNI...........................................KP.TQFLCLTLKM.LQIQ.PEKD..........IVVE.FIK...............................................NEEFKYVRA............L....GAFY...L.....RLTGS........................ALDC....YKYL.E.....PLYNDNR.KLRRQNRAG...................-----....QYEIVHMDDFIDE.LL.......RSDRVCD..I..ILPRIQKRTVLEEN-n...................................................................
A0A028JMB5_TRIRU/20-222              ................................................pl--IRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTYIGG..............-TYG.VGQ...........................................KP.TPFLCLAFKL.LQLA.PEKE..........VILE.YLNfhdleadeedlkvrgdstd.........adggagdaqdradaailkaTGDFKYLRA............L....AAFY...I.....RLTFE........................PVEI....YKTL.E.....PLLTDYR.KLKRRTKEG...................-----....-FLLTYMDQFVDD.LL.......TKDRVCG..T..SLWKIPTRTILEDL-d...................................................................
A0A016STM2_9BILA/62-272              .................................................l-PIWGNQQTMNLNGLVLENVKES.YYYKNHLVEID.......................................S........AQQLLDEVFYK..VKHLEP..............WEKG.TRKvqgmtgmcg.........................gvrgvgaggVV.SSAFCLLYRF.FKVR.LTRK..........QLIS.MIN...............................................SRVSPYIRG............L....GFMY...I.....RYTQP........................PADL....WEWF.E.....PYLVGCL.--SSIGKGNygfplstidahpffkddeeEIDPRs..gGGDIMTFGQVVRI.ML.......TKLDWYG..T..LFPRIPVPIQKEID-e...................................................................
S9XEH7_SCHCR/14-177                  ................................................dv--VHQMLPTFLVGKILRERIVES.FYWKEQCFGLN.......................................A........-ASLIDRAVR-..LEYIGG..............-QFG.-NQ...........................................RP.TEFICLLYKL.LQVA.PEKE..........IVLE.YLS...............................................IPEFKYIRA............L....AAFY...I.....RLTWP........................DPDV....YQAL.E.....PLLNDYR.KLRVRDHNG...................-----....-FYVSHMDEFIDD.LL.......NEETVCD..V..TLPPLMSRYQLEEL-d...................................................................
A0A024UYP7_PLAFA/11-175              ...............................................knf----GSNPQYLISNIIRSKIYDS.PYWKEKCFALT.......................................S........-ESIIDQAIN-..LKYVGG..............-TYG.GNR...........................................KP.TRFLCLILKL.LQIQ.PDKD..........IIYE.YIK...............................................NEDFVYLRA............L....GIFY...L.....RLIGK........................SLEV....YNHL.E.....PILFDYR.KIRMRLQNG...................-----....TFEKIYMDVFVDN.CL.......ILNNFLD..V..DFPTLTKRQVLEEN-n...................................................................
E9IDC1_SOLIN/82-265                  .................................................l-PLWGNERTMNLNPLILTNIQSS.HYFKVNLYELK.......................................T........YHEVIDEIYYK..VSHLEP..............WEKG.SRKtagqtgmcg.........................gvrgvgaggIV.STAYCLLYKL.FTLR.LTRK..........QLNG.LIN...............................................HPDSPYIRA............L....GFMY...I.....RYTQP........................PADL....FSWY.S.....DYLEDEE.---------...................ELDVKa..gGGQTMKMGDILKQ.FL.......TKLEWFS..T..LFPRIPVPIQKD---le..................................................................
A0A010R8A1_9PEZI/24-191              ...............................................lap---NGENPATIMEKAVRERIIDS.YFYKEQCFAVN.......................................E........-ADIVDRVVEH..VTFIGG..............-TSG.VTQ...........................................KP.TPFLCLAFKL.LQLA.PSDE..........VLET.YLGf.............................................gGDKFKYLRA............L....ACFY...V.....RMTRK........................AKDV....YLLL.E.....PFLEDRR.KLRRKGRAG...................-----....-TSLTFMDDFVDD.LL.......TKTRVCA..T..SFRELPKRVDLVD--lg..................................................................
H9K930_APIME/10-175                  ..................................................KSIRGTNPQYLVEKIIRSRVYDS.KYWKEECFALT.......................................A........-ELLVDKAME-..LRYIGG..............-VYG.GNV...........................................KP.TPFLCLILKM.LQIQ.PEKD..........IIVE.FIK...............................................NEEFKYVRA............L....GALY...M.....RLTGS........................SLDC....YKYL.E.....PLFNDNR.KLRRQNKQG...................-----....KFELIHMDEFIDD.LL.......REERCCD..V..ILPRIQKRHVLEEN-n...................................................................
C9S9P5_VERA1/26-193                  ...............................................lap---NGENPAKIMEKAVIGRIVDA.QYFQYQCFALN.......................................E........-AGIVDRVVND..VKFIGG..............-TYG.SAQ...........................................KP.TPFLCLAFKL.LQLA.PSDA..........VLEM.YLSf.............................................gGDKFKYLRA............L....ACFY...I.....RMTRR........................AKDV....YAIL.E.....RYLVDRR.KLRRKGRQG...................-----....-TSLTFVDEFVDD.LL.......TKTRVCA..T..SFRELPRRTDLVD--lg..................................................................
W9YWJ5_9EURO/19-185                  ................................................pl--IRGQNPALLFETPMRDRITDS.LYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTYIGG..............-TYG.VAM...........................................KP.TPFICLAFKL.LTLV.PDKE..........IILE.YLKn.............................................gGEEWKYLRA............L....AAFY...V.....RLTFD........................PADI....YKTL.E.....PLLEDYR.KLRLRRRET...................-----....-YELIHVDEFVDN.LL.......TKERVCG..T..SLWKLPGRQLLEDL-d...................................................................
B5X2T8_SALSA/10-175                  .................................................n-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAMA-..LKFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRL............L....GAMY...M.....RLTGT........................SVDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELQHVDEFIDE.LL.......HSERMCD..I..ILPRLQKRQVLEEA-e...................................................................
W5AB44_WHEAT/3-167                   ...............................................iqt---SGKPIDMLMEKVLCMNILSS.DYFK-ELYRMK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HPDSPYIRA............I....GFLY...L.....RYVAD........................PKIL....WTWY.E.....PYLKDDE.---------...................EFSPG...sNGRMTTMGVYVRD.LI.......LGQVCFD..S..ILPRVPVPVVR----qvtt................................................................
X1YD78_ANODA/10-175                  ..................................................KNVHGTNPQYLIEKIIRSRIYDS.KYWKEQCFALT.......................................A........-ELLVDKAME-..LRFVGG..............-VFG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IVVE.FIK...............................................NEEFKYVRA............L....GAFY...L.....RLTGS........................SLDC....YKYL.E.....PLYNDNR.KLRKQNRMG...................-----....AYELIHVDEFIDE.LL.......REERVCD..I..ILPRIQKRHVLEET-t...................................................................
F4PZZ0_DICFS/118-283                 ..................................................KTIHGTHSRNLIEKILRIKIQSH.PYWKEKCMGLN.......................................E........-ETLVDRAMA-..LTSFGG..............-TWG.GMK...........................................QP.THFICLMLKM.LQIQ.PDKD..........IIIE.FIT...............................................NQDFKYVRI............L....GAFY...L.....RLVGK........................PVDI....YNYL.E.....PLYNDYR.SVRMKNDLG...................-----....QFNKIHVDEFVQE.LL.......TGNYACE..I..VLPNLPSRRTLEQQ-g...................................................................
B9G228_ORYSJ/166-246                 .................................................q-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.----------.----.----..........----.---...............................................---KRYVRV............L....GAFY...L.....RLTAT........................VADV....YQYL.E.....PLYNDYR.KIRHKLSDG...................-----....KFTLTHVDEFIDD.LL.......TKDYSCD..T..ALPRIQKRWVLET--sg..................................................................
H3FY63_PRIPA/61-245                  .................................................l-PVWGNQKTMNLNGLVLENVLQC.TYYKQVLAECS.......................................T........YQQIVDEIYMH..VRHLEP..............WEKG.TRKvqgmtgmcg.........................gvrgvgaggVI.SSAFCLLYKL.FNIR.ITRK..........QLVS.MIN...............................................SNQSAYLRG............M....GFMY...I.....RFCQP........................PSDL....WNWL.E.....PYLDDED.---------...................TVDPRs..gGGDELTFGQIARM.ML.......TKLDWYG..T..LFPRIPVPIQKDID-e...................................................................
G0W4U6_NAUDC/16-223                  ..................................................KQLNNSSVSLVIPRITRDKIHNS.IYYKVNLTSQS.......................................Lrg....ntMVQLIQVIVRD..FGKLKSqshshssdtmvvrnHLV-.---...........................................GG.TEFKCLLMKI.IELK.PTIE..........QIWI.LLEdh..........................................ddtEFDNKYITV............L....IITY...I.....RIQYFfigk................ndslARKF....QDIF.Q.....KCLNNYT.KLKCFQLDAdcw............spslSLSEE....SVRIIYMDEVVDW.LL.......TKDNIWG..I..PLGKCQWVAE-----igave...............................................................
D8SIA1_SELML/5-138                   ..............................................vqtc----GKPIQTLVEHVVNVNILSS.EYFK-ELYRLK.......................................T........FHEVVDEIYNH..VAHVVP..............WMTG.NSR...........................................GP.SPAFCLLCKF.FTMK.LTDE..........QVQE.FLN...............................................HADSPYVCA............LfsfvAPVF...L.....RYYGD........................PSTL...fWQWF.K.....PYIEDDE.---------...................-----....-------------.--.......-------..-..---------------myvnpikl............................................................
Q8SUF7_ENCCU/2-164                   ..............................................qykg-----------INRMTREKILGS.EEFK-RMRSFT.......................................H........-ADVIQSICS-..LDSIGG..............LIRG.---...........................................TP.HKFLCLVQKM.GATS.LSED..........AVAV.DLAnlkplepk...............................plgspaemFHGNVYFIA............A....SLFY...L.....RLSKR........................FHKY....RPLI.G.....LFLADFR.KIPVVDGQN...................-----....NRTFMYLDVLADD.LL.......NKSRIFN..V..HLSR-----------ad..................................................................
K2GU44_ENTNP/2-162                   .............................................sgper----------RLETILRNKIYNC.EYWKQQCFTLT.......................................S........-ETILDEIVK-..LHDFGG..............-TYG.VLK...........................................KP.TKFIVLIMKL.LMLR.PDKR..........IIYE.YIM...............................................NEEFKYIRV............I....GAFY...L.....RLIGS........................SKEC....YQFI.E.....PLYYDYR.PLKYRIDSK...................-----....HYEIITIDQFAWN.LL.......HLDYYCD..I..TLPIITTRPVIES--hg..................................................................
S9YKY6_9CETA/13-80                   .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRK...........................................TA.----------.----.----..........----.---...............................................---------............-....----...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------gqtgmcg.............................................................
I1HL97_BRADI/3-166                   ................................................iq--TSGKPINMLMEKVLCMNILSS.DYFK-ELYRMK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HPDSPYIRA............I....GFLY...L.....RYVAD........................PKVL....WTWY.E.....PYLKDDE.---------...................EFSPG...sNGHMTTMGVYVRD.LI.......LGQYYFD..S..ILPRVPVPV------irqvt...............................................................
G3WWZ2_SARHA/30-174                  ...............................................svq-----------------------.-----------.......................................-........-------VVQ-..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
C4JA01_MAIZE/1-55                    .................................................m-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....----...-.....-----........................----....--WY.E.....PYLRDDE.---------...................EFSPG...sNGRKTTMGVYVRD.LI.......LGQYYFD..S..LLPRIPLPVTRQ---ita.................................................................
PR38A_XENLA/10-175                   .................................................h-SVHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LKFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRA............L....GALY...M.....RLTGT........................ATDC....YKYL.E.....PLYNDYR.KVKVQNRDG...................-----....EFELMHVDEFIDQ.LL.......HEERVCD..V..ILPRLQKRFVLEET-e...................................................................
R4X9K4_TAPDE/21-184                  .................................................t-TVHGVNPAFLIEKITRERILDS.LYFKDQCFGLT.......................................A........-STVLDRVVG-..LTYIGG..............-IY-.SIG...........................................RP.TEFICLVFKM.LQLA.PEKD..........IILH.YLH...............................................DDEFKYLRA............L....AALY...V.....RLVFS........................PKDV....YLTL.E.....PLLTDYR.KLKVRGQNG...................-----....-FRLDYMDNFIDQ.LL.......TEPRVFD..I..ALPNLMSRPLLEDL-d...................................................................
M3XUF9_MUSPF/49-233                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
W8BU66_CERCA/1-136                   .............................mepwergsrktsgqtgmcggv-----------------------.-----------.......................................-........-----------..------..............----.--Rgvg.....................................aggIV.STAYCLLYKL.YTLR.LTRK..........QVNG.LLN...............................................HTDSPYIRA............L....GFMY...L.....RYTQP........................PADL....YDWY.E.....DYLQDEE.---------...................EIDVKa..gGGQVITVGQMVYQ.FL.......TKLDWFS..T..LFPRIPVPIQKQIE-k...................................................................
E2BCA0_HARSA/10-175                  ..................................................KSIRGTNPQYLVEKIIRSRIYDS.KYWKEECFALT.......................................A........-ELLVDKAME-..LRYIGG..............-VYG.GNV...........................................KP.TPFLCLILKM.LQIQ.PEKD..........IIVE.FIK...............................................NEEFKYVRA............L....GALY...M.....RLTGS........................SLDC....YKYL.E.....PLFNDNR.KLRMQNKQG...................-----....VYELIHMDEFIDN.LL.......REERSCD..V..ILPRIQKRHVLEEN-n...................................................................
W9ZJQ2_FUSOX/25-192                  ...............................................vap---NGLNPATIMEKAVKDRIVDS.YFYKEQCFALN.......................................E........-ADIVDRVVEH..VNFIGG..............-TYG.VTQ...........................................KP.SPFLCLAFKL.LELS.PSDA..........VLME.YLKy.............................................gGEAFKYLRA............L....ACFY...F.....RLTRQ........................AKDV....YEML.E.....PFLEDRR.KLRRRGRAG...................-----....-VVLTFMDEFVDE.LL.......TKERVCG..T..SLWKMPKREVLEDL-e...................................................................
E4XHG4_OIKDI/82-282                  .................................................l-PVHGNERTMNLNHMVLANITES.AYFRCDLLQIK.......................................T........YDEMIDEIYYK..VTHLEP..............WEKG.SRKhftgsatgaergmayss.........ipgvqnyvgvrgvgqggIV.STPFCCLYKL.WTIK.LTRK..........QVEL.MCD...............................................HVDSPFIRG............L....GFLY...L.....RFSLP........................PQNL....LEFL.Q.....PYFNDQE.---------...................EVDPKa..gGGDPMTMGALILA.ML.......EENHWYG..T..MLPRIPAKHLQEIR-r...................................................................
A0A023F4I6_TRIIF/24-208              .................................................l-PLWGNERTMNLNPLILTNIQSS.HYFKVNLYELK.......................................T........YHEVIDEIYYK..VAHLEP..............WEKG.SRKtagqtgmcg.........................gvrgvgaggIV.STAYCLLYKL.FTLK.LTRK..........QLNG.LIT...............................................HPDSPYIRA............L....GFMY...I.....RYTQP........................PPDL....WDWY.D.....EYLDDNE.---------...................ELDVKa..gGGQVMTIGNILKN.FL.......CKLEWFS..T..LFPRIPVPIQQKIE-k...................................................................
H3B6U1_LATCH/36-219                  .................................................l-PLWGSEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VAHIEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....PFLDDEE.---------...................ELDVKa..gGGCIMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKN---ld..................................................................
A0A016ST41_9BILA/62-272              .................................................l-PIWGNQQTMNLNGLVLENVKES.YYYKNHLVEID.......................................S........AQQLLDEVFYK..VKHLEP..............WEKG.TRKvqgmtgmcg.........................gvrgvgaggVV.SSAFCLLYRF.FKVR.LTRK..........QLIS.MIN...............................................SRVSPYIRG............L....GFMY...I.....RYTQP........................PADL....WEWF.E.....PYLVGCL.--SSIGKGNygfplstidahpffkddeeEIDPRs..gGGDIMTFGQVVRI.ML.......TKLDWYG..T..LFPRIPVPIQKEID-e...................................................................
G4U7T3_NEUT9/24-191                  ...............................................lap---NGLNPATIMEKAVRERIIDS.YFYKEQCFGVN.......................................E........-ADIVDRVVEH..VDFIGG..............-VYG.TVQ...........................................KP.SPFLCLAFKL.LQLA.PSDD..........ILNE.YLQf.............................................gGEKFKYLRA............L....ALFY...I.....RLTRK........................DQDV....YKTL.E.....PFLEDRR.KLRRKGRNG...................-----....-TSLTYMDVFVDD.LL.......TKDRVCA..T..SLWKMRKRDILEDL-d...................................................................
C1MPU3_MICPC/21-183                  ...............................................qal----DNGKSYNMEKVLRTNILAS.DYFS-QLVKMN.......................................D........FYELVDEIYNE..VDHVEP..............WMSG.NAR...........................................GP.STAFCLLYRL.FTME.IEDN..........EVKH.LIN...............................................HGDSPYIRA............L....GFLY...V.....RYARD........................PKEF....GRWF.D.....EFLRDEE.---------...................EFSPS...pHGKSVTMGAFVRD.LI.......LDQYYFE..T..IFPRIPEVS------rralv...............................................................
PRP38_YEAST/15-219                   ..................................................KQLNNQSVSLVIPRLTRDKIHNS.MYYKVNLSNES.......................................Lrg....ntMVELLKVMIGA..FGTIKGqng.......hlhmMVLG.GIE...........................................--.--FKCILMKL.IEIR.PNFQ..........QLNF.LLNvk..........................................nenGFDSKYIIA............L....LLVY...A.....RLQYYylngn.............nkndddENDL....IKLF.Kvq.lyKYSQHYF.KLKSFPLQVdc...............faHSYNE....ELCIIHIDELVDW.LA.......TQDHIWG..I..PLGKCQWNKI-----ynsde...............................................................
I1F795_AMPQE/2-83                    ................................................lc-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.----------.----.----..........----.---...............................................---SKYVRA............L....GALY...L.....RIVGT........................SVEC....YKYL.E.....PLYNEYR.KIKYKNRQG...................-----....KFELSHVDEFVDS.LL.......REDRVCD..V..ILPRIQKRHILEET-e...................................................................
M0U4G2_MUSAM/3-166                   .............................................iqtsg-----RPIDTLLEKVLSMNILSS.DYFK-ELYRLK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HPDSPYIRA............I....GFLY...L.....RYVAD........................PKTL....WTWF.E.....PYIKDGE.---------...................EISPG...sNGRLTTMGIYVRD.LL.......LGQYYFD..T..LFPRIPIPVMR----qiv.................................................................
K4DTH9_TRYCR/9-176                   ................................................wn--LKGRSAVAALDPSTRHRIMQS.HAMASSFHKPL.......................................L........-ATL-EVLIT-..TQYVGG..............-LTG.PLQ...........................................KP.EPFICHVTRL.LQIT.PDPS..........IVLA.MLH...............................................QDVHKYLRV............A....ALFI...I.....RLIGN........................EAMM....REAM.R.....VGWEDYR.KIRVYGYVE...................-----....-------------.--.......-------..-..---------------dlagtidskennapdeeegfvrapaygimcvdeitdrlfnv...........................
K6UDH3_9APIC/42-122                  ................................................lt-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.------LLKL.LQIQ.PDKD..........IIYE.YIK...............................................NEEFIYLRA............L....GIFY...L.....RLIGK........................SLEI....YRYL.E.....PILFDYR.KLRIRLQNG...................-----....TFEKIYMDEFVDN.CL.......-------..-..---------------....................................................................
M3UPS3_ENTHI/7-169                   .................................................l-PTQGNTRTMNIDSILFTNITHS.DYMFKTLGSIH.......................................S........ISDLIDIIIND..VHYISP..............YIQK.SSS...........................................SP.STAFCVLLRL.FQLN.PTPD..........DIRM.MST...............................................H-SNKYVRC............I....AALI...I.....RYSIQ........................FNLL....LSYL.K.....PFVDDRA.-VVNISLHG...................-----....-EKTKQIKCLVKD.LI.......LEPKFEG..C..ILPRIPQ--------vyykp...............................................................
A0A026WC55_CERBI/10-175              ..................................................KSIRGTNPQYLVEKIIRSRIYDS.KYWKEECFALT.......................................A........-ELLVDKAME-..LRFIGG..............-VYG.GNV...........................................KP.TPFLCLILKM.LQIQ.PEKD..........IIVE.FIK...............................................NEEFKYVRA............L....GALY...M.....RLTGS........................SLDC....YKYL.E.....PLFNDNR.KLRLQNKQG...................-----....AFELIHMDEFIDN.LL.......KDERSCD..V..ILPRIQKRHVLEEN-n...................................................................
V7PDY7_9APIC/10-175                  ..............................................iksf----GSNPQFLISNIIRNKIYDS.PYWKEKCFALT.......................................S........-ESIIDQAVN-..LKYVGG..............-TYG.GNR...........................................KP.TRFLCLVLKL.LQLQ.PDKD..........IIYE.FIK...............................................NEEFIYLRA............L....GIFY...L.....RLIGK........................GIDI....YKNI.E.....PILFDYR.KIRIRLQDG...................-----....SFQKIYMDVFADN.CL.......VFSNFLD..V..DFPPLTKRVVLEEN-n...................................................................
R0L434_ANAPL/3-187                   .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKTID-q...................................................................
K7HSD9_CAEJA/1-166                   .................................................k-TVKGTNPQFLVEKIIRQRIYDS.MYWKEHCFALT.......................................A........-ELVVDKGMD-..LRYIGG..............-IYA.GNI...........................................KP.TPFLCLALKM.LQIQ.PDKD..........IVLE.FIQ...............................................QEEFKYIRA............L....GAMY...L.....RLTFE........................STEI....YKYL.E.....PLYNDFR.KLRFMNKMG...................-----....RFEAIYMDDFIDN.LL.......REDRYCD..I..QLPRLQKRWALEE--vd..................................................................
G1XLI7_ARTOA/22-185                  ................................................pt--IHSMNPLLLMEKIIRERIIDS.MYWKEQAWGLN.......................................A........-ATLLDRAVE-..LQFIGG..............-QY-.ANQ...........................................KP.TPFICLILKM.LQLN.PERE..........ILLE.YVQ...............................................DEDFKYLRV............L....AAFY...I.....RLAWP........................AAEI....YKTL.E.....PLMADYR.KIRLRTQSG...................-----....-YKLTFVDEFIDE.LL.......TKERVCD..I..ALPRMPTRAQLEDM-d...................................................................
R9ACJ1_WALI9/10-173                  .................................................s-SIHGRNPQHLIENVIRQRVYES.AFWKEQCFALT.......................................A........-ETIIDKAVE-..MQSIGG..............-VYG.NAR...........................................-P.LPFMCLLLKL.LQLQ.PERE..........IIFE.YLQ...............................................AEEFKYLRA............L....AAMY...T.....RLCFK........................SFEV....FDIL.E.....PLLQDYR.KLRLRNNSG...................-----....-YHITHMDQFIDE.LL.......TEERVCD..I..ILPRLTRRDVLEE--ve..................................................................
B8BCS7_ORYSI/10-175                  ..................................................KSIHGTNPQNLVEKIVRSKIYQS.TYWKEQCFGLT.......................................A........-ETLVDKAME-..LDHTGG..............-TYG.GNR...........................................KP.TPFLCLALKM.LQIQ.PDKD..........IVVE.FIK...............................................NEDYKYVRV............L....GAFY...L.....RLTAT........................VADV....YQYL.E.....PLYNDYR.KIRHKLSDG...................-----....KFTLTHVDEFIDD.LL.......TKDYSCD..T..ALPRIQKRWVLET--sg..................................................................
F7H0L0_MACMU/47-189                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.---------...................-----....-------------.--.......-------..-..---------------fyt.................................................................
W5EZF1_WHEAT/1-99                    ..................................................-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.---------M.LQIQ.PDKE..........IVVE.FIK...............................................NEDYKYVRV............L....GAFY...L.....RLTGT........................VADV....YQYL.E.....PLYNDYR.KIRQKLSDG...................-----....KFTLTHVDEFIDE.LL.......TKDYSCD..T..ALPRIQKRWILEA--sg..................................................................
U6HES1_ECHMU/27-211                  .................................................l-KLWGNQVTMNINPMIHTNIIQS.PYFKTNLIELK.......................................T........YHEVIDEIYYK..VTHLEP..............WERN.SRRmggqtgmcg.........................gvrgvgaggIV.STAYCLLFKL.FTLK.LTRK..........QLKG.LLE...............................................HPDSPYIRA............L....GFMY...I.....RYCLP........................PEDL....WMWF.A.....PYLDDEE.E--------...................-IDVRa..gGGCSMTIGAMLGQ.WL.......TKLDWFS..T..LFPRIPVPVQKKID-e...................................................................
W7E3G4_COCVI/23-228                  ................................................al--IRGQNPALLFEKGVRERITES.YYWKEQCFGLN.......................................T........-ATLCDRAAE-..LKFIGG..............-TTG.ITG...........................................KP.TPFLCLAFKM.LQLV.PEKE..........IILE.YLNfrddeddeddkaevkkengd......aaanddddsakkeldlnaagkLGCFKYLRC............L....AAFY...I.....RLAWE........................PVEI....YKTL.E.....PLLTDYR.KIKRRLKDT...................-----....-FTLTHVDQFIDD.LL.......TKDRICA..T..SLWKLPSRAILEDL-d...................................................................
A0A024WI92_PLAFA/173-335             ...............................................lem----TNTTTYNVNTLLRNNILSS.EYFK-SLIPIK.......................................T........FKEVVDEIHSY..ADHVEP..............YCIG.SNR...........................................AP.STLFCCLYKF.FTMQ.LSEK..........QLKS.LIE...............................................NKDSCYIRA............C....GFLY...L.....RYVHS........................PANL....WMWF.E.....PYLLEED.---------...................EFSISc..dKRRKVTIGEYVQS.LL.......SDDKYFN..T..VLPRLPIKIK-----nvy.................................................................
F0VCL2_NEOCL/132-293                 ...............................................emt-----DSTTYNVNALLRSNILAS.EYFK-SLHELK.......................................T........VPEVVDEIAQY..AQHAEP..............YCSG.SSR...........................................AP.STLFCCLYKL.FTMK.LTTK..........QVEQ.LLD...............................................YSDSPYVRC............A....GFLY...L.....RYVHP........................PEKL....WKWY.E.....AYFLDDE.---------...................EFAASa..dAKRTTTVGEYVES.LI.......MEDKYFN..T..VLPRLPVKVK-----nly.................................................................
PR38B_MOUSE/48-232                   .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
B9PT26_TOXGO/142-303                 ...............................................emt-----DSTTYNVNALLRSNILSS.EYFK-SLHELK.......................................T........VPEVVDEITQY..AQHAEP..............YCSG.SSR...........................................AP.STLFCCLYKL.FTMK.LTTK..........QLEQ.LLD...............................................YSDSPYVRC............T....GFLY...L.....RYVHP........................PEKL....WKWY.E.....QYFLDDE.-VFAASSD-...................-----....TKRTTTMGEYVES.LI.......MEDKYFN..T..VLPRLPVKVK-----nly.................................................................
M0Z3R7_HORVD/3-165                   ..............................................lqts----GRPIEVLMEKVLSMNIVSS.DYFK-ELYKIK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKL.FTMK.LTVN..........QMHG.LLK...............................................HPDSPYIRA............I....GFLY...L.....RYAAD........................PKTL....WTWY.E.....PYIQDDE.---------...................EFSPG...sNGKMTTMGVYVRD.VI.......LGQYYFD..S..LLPRVPL--------lilrqv..............................................................
PR38A_MACFA/10-175                   .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
J4W4G8_BEAB2/24-191                  ...............................................lap---NGLNPANIMEKAVKDRITDS.YFYKEQCFALN.......................................E........-ADIVDRVVEH..VRFIGG..............-TSG.TAQ...........................................KP.SPFLCLAFKL.LELS.PSDA..........VLAE.YLAy.............................................gGEHFKYLRA............L....ACFY...L.....RLTRQ........................AKDV....YETL.E.....PFLADRR.KLRRKGRER...................-----....-TTLTYMDEFVDD.LL.......SKDRVCA..T..SLWKMPKREILEDL-e...................................................................
D2V594_NAEGR/1-165                   .................................................t--VHSTNSQNLIEQITRNKIFNS.IYYKEECFGLN.......................................A........-ATVIDKAEN-..LDSIGG..............-TFG.GLR...........................................KP.TNFLSLLMKM.LQIE.VDLE..........STVA.YIH...............................................NGEFKYLTA............L....GALY...L.....RLVGN........................AVDV....YEQL.E.....PLYSDYR.KLRLRLIDG...................-----....SCKILHMDEFIEM.LL.......TSDSFCD..V..KLPFLLSRKVLEKN-g...................................................................
H0V990_CAVPO/21-205                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
M3VYN3_FELCA/10-175                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
PR38A_XENTR/10-175                   .................................................h-SVHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LKYVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRT............L....GALY...M.....RLTGT........................ATDC....YKYL.E.....PLYNDYR.KVKVQNRNG...................-----....EFELMHVDEFIDQ.LL.......HEERVCD..V..ILPRLQKRFVLEET-e...................................................................
A0A024W6R0_PLAFA/11-175              ...............................................knf----GSNPQYLISNIIRSKIYDS.PYWKEKCFALT.......................................S........-ESIIDQAIN-..LKYVGG..............-TYG.GNR...........................................KP.TRFLCLILKL.LQIQ.PDKD..........IIYE.YIK...............................................NEDFVYLRA............L....GIFY...L.....RLIGK........................SLEV....YNHL.E.....PILFDYR.KIRMRLQNG...................-----....TFEKIYMDVFVDN.CL.......ILNNFLD..V..DFPTLTKRQVLEEN-n...................................................................
H0V4L8_CAVPO/10-175                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
A0A015N4G5_9GLOM/7-171               .................................................l-ETWGSETTMNLNNILYQNIQAS.PYFK-HLYELK.......................................T........YHEVIDEIFNH..VESLEP..............FLKG.TTA...........................................--.STAFCLLYKL.WTLR.LTVK..........QVNG.LIE...............................................HTDSPHIRA............L....GFLY...L.....RYVCK........................PIHL....WEWF.E.....EYLDDEE.EVQIQGGP-...................-----....RPVIITIGKMCRQ.LL.......TEQKWLG..T..ILPRIPVPIAREIE-q...................................................................
W4ZSU7_WHEAT/50-203                  ...............................................gri----GANPQMLVENTVRSGIYRS.SYWRERCFGLT.......................................A........-ETLVGRAVE-..LDHVGG..............-TFG.RNG...........................................-P.TPFLCLALKM.LQMQ.PDRE..........TVVG.FIS...............................................NEEHRYLRA............L....GAFY...L.....RLTGT........................GADV....RRYL.E.....PLSNDHR.EIRERISDE...................-----....EFTLTDVGYFIDK.LL.......TQDSCCD..T..ALPRI----------....................................................................
H2ZEL4_CIOSA/4-188                   ................................................lt--CWGNPRTMNLNHLVLTNVQNS.PYFKVRLFELK.......................................T........YHEVVDEIYYK..VDHLEP..............WERG.TRKtagqtgmcg.........................gvrgvgaggVV.STSFCILFKL.FTLK.LTRK..........QVNG.LLN...............................................HTDSPFIRG............L....GVMY...I.....RYTQA........................PKDL....WNWY.E.....PYLEDEE.---------...................EIDVKa..gGGCVMTIGMMIRT.VL.......TKLDWFS..T..LFPRIPVPIQKEID-e...................................................................
Q4UCH1_THEAN/10-175                  .................................................h-LIHGTNPQFLFSKILRDKVYNS.FYWKESCFGLT.......................................A........-ESLIDKAVQ-..IKYVGG..............-TFG.GNR...........................................QP.SPFICLVLKM.LQIQ.PEME..........IVHE.YIK...............................................NEDYKYLRA............L....GIYY...M.....RLVGT........................AVEV....YRTL.E.....PFLADYR.KLRFRNIDG...................-----....SYVIKYMDEFVDD.CL.......TNSTYLD..V..DLPPLSKRMNLEA--tk..................................................................
B4F7Y9_MAIZE/3-166                   ..............................................iqss----GRSIEGLMEKVLSVNILSS.DYFK-ELFKYK.......................................T........YHEVVDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.SSAFCLLYKL.FTMK.LTVK..........QMHG.LLK...............................................HQDSPYIRA............I....GFLY...L.....RYVAE........................PKTL....WTWY.E.....PYIKDDE.---------...................EFAPG...sNRKVTTMGVYVRD.LL.......LGQYYFD..S..LLPRVPLPI------lrqvt...............................................................
M0X6G7_HORVD/3-166                   ...............................................iqt---SGKPIDMLMEKVLCMNILSS.DYFK-ELYRMK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HPDSPYIRA............I....GFLY...L.....RYVAD........................PKIL....WTWY.E.....PYLKDDE.---------...................EFSPG...sNGRMTTMGVFVRD.LI.......LGQYYFD..S..ILPRVPVPVVR----qvt.................................................................
G0PED8_CAEBE/1-148                   ..................................................-----------------------.-----------.......................................-........--TLVEQIFYQ..VKHLEP..............WEKG.TRRlqgmtgmcg.........................gvrgvgaggVV.SSAYCLLFRL.FNLR.ISRK..........QLIS.MLN...............................................SRQSVYIRG............I....GFMY...I.....RYTQP........................PADL....WYWL.E.....PYLDDDS.---------...................EIDPRs..gGGDLMSFGQMVRT.MI.......NKLDWYG..T..LFPRIPVPIQKEID-e...................................................................
V4AYJ2_LOTGI/4-188                   .................................................l-AVWGNEKTMNLNNLILTNIQSS.PYFKINLFNLK.......................................T........YHEVIDEIYYK..VSHLEP..............WEKG.SRKtagqtgmcg.........................gvrgvgaggIV.SSAYCLLYKL.YTLK.LTRK..........QLNG.LLT...............................................HSDSPYIRG............L....GFMY...I.....RYTQP........................PADL....WEWY.E.....PYFDDDE.---------...................EVDVKa..gGGHVMLIGEMIRQ.WL.......VKLEWYS..T..LFPRIPVPIQKDI--ds..................................................................
I3JLV3_ORENI/10-175                  .................................................n-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LKFVGG..............-VFG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRL............L....GAMY...M.....RLTGT........................AVDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFEVMHVDEFIDG.LL.......QSERMCD..V..ILPRLQKRQVLEEA-e...................................................................
S8F818_TOXGO/142-303                 ...............................................emt-----DSTTYNVNALLRSNILSS.EYFK-SLHELK.......................................T........VPEVVDEITQY..AQHAEP..............YCSG.SSR...........................................AP.STLFCCLYKL.FTMK.LTTK..........QLEQ.LLD...............................................YSDSPYVRC............T....GFLY...L.....RYVHP........................PEKL....WKWY.E.....QYFLDDE.-VFAASSD-...................-----....TKRTTTMGEYVES.LI.......MEDKYFN..T..VLPRLPVKVK-----nly.................................................................
U6MUF7_9EIME/120-282                 ...............................................vqm----TDSTTYNVNQLLRGNIMSS.EYFK-SLHQFK.......................................S........FNEVVDELAAF..ADHAEP..............YCSG.STR...........................................AP.STLFCCLYKL.FTLK.LTEK..........QMHM.LLN...............................................HRESPYVRC............T....GFLY...L.....RYVHP........................PDQL....WKWY.E.....PYFLDDE.---------...................QFTPGa..dPNRVISMGEYVQS.LL.......TEDKYFS..T..VLPRLPVLV------knvy................................................................
G1NUQ8_MYOLU/10-176                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................----V....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
B4JL98_DROGR/29-213                  .................................................l-PLWGNETSMNLNPLILANIQSS.SYFKVHLFKLK.......................................T........YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg.........................gvrgvgaggIV.STAYCLLYKL.YTLR.LTRK..........QVNG.LLN...............................................HTDSAYIRA............L....GFMY...L.....RYTQP........................PGDL....YDWY.E.....DYLQDEE.---------...................EIDVKa..gGGQVVTIGQMVYQ.FM.......TKLDWFS..T..LFPRIPVPIQKQIE-k...................................................................
S8D204_9LAMI/10-175                  ..................................................KSIRGTNPQNLVEKILRSKIYQN.TFWKEQCFGLT.......................................A........-ETLVDKAME-..IDHLGG..............-TFG.GNR...........................................KP.TPFMCLVMKM.LQIQ.PDKE..........IVVE.FIK...............................................NPEYKYVRA............L....GAFY...L.....RLTGT........................DVDV....YRYL.E.....PLYNDYR.KLRIKANDG...................-----....KFALTHVDEFIDD.LL.......TKDYSCD..I..ALPRIKKRWTLEN--lg..................................................................
E6R495_CRYGW/9-172                   .................................................t-AVHGSNPQYLIEKVIRARIYDS.LYWKEHCFALT.......................................A........-ESIIDKAIE-..LRAVGG..............-VT-.DRQ...........................................TP.TPFICLVLKL.LQLQ.PEKE..........ILIE.YLL...............................................AEEFKYLRA............L....AAFY...V.....RLTFR........................SLEV....YEIL.E.....PLMKDYR.KLRVVHAGG...................-----....-YSLTYFDEFIDE.LL.......TQERVCD..I..ILPRLTQRSVLEET-e...................................................................
K7GEC3_PELSI/50-234                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
Q9VYE9_DROME/24-208                  .................................................l-PFWGNESSMNLNALILANIQSS.SYFKVHLFKLK.......................................T........YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg.........................gvrgvgaggIV.STAYCLLYKL.YTLR.LTRK..........QING.LLN...............................................HTDSAYIRA............L....GFMY...L.....RYTQP........................PGDL....YDWY.E.....DYLQDEE.---------...................EIDVKa..gGGQVLTIGQMVYQ.FM.......TKLDWFS..T..LFPRIPVPIQKQIE-k...................................................................
D2HBF7_AILME/36-220                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
Q2H4I5_CHAGB/24-112                  ...............................................lap---NGLNPATIMEKAVRERIVDS.YFYKEQCFGVN.......................................E........-ADIVDRVVEH..VDHIGG..............-VAG.IVQ...........................................KP.TPFLCLAFKL.LQLA.PADD..........ILDE.Y--...............................................---------............-....----...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------prlwrre.............................................................
D8QIS6_SCHCM/10-173                  ..................................................KQIHGQNPQFLVETVIRNRIWES.SYWKEHCFALT.......................................A........-ESLIDKAIS-..LRAIGG..............-VYG.N-Q...........................................RP.TEFLCLLLKL.LQIQ.PEKE..........ILVE.YLQ...............................................ADEFKYLRA............L....AAMY...I.....RMTFR........................AVDV....YELL.E.....PLLKDYR.KIRYRDMGG...................-----....-YRLTFIDEFVDS.LL.......TEERVCD..I..ILPRLQKREILEEN-g...................................................................
M7BDA2_CHEMY/30-111                  .................................................y-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.----------.----.----..........----.---...............................................--ESKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
U6LVE5_9EIME/1-146                   ..................................................---------------------ES.FFWKNDCFAAT.......................................A........-ESLVEIAIKN..LFYVGG..............-TFG.GIR...........................................TP.APFLCLVLKL.LQLQ.PDKM..........IVLE.YIK...............................................QEDFKYLRA............V....GAFY...F.....RLVAP........................SDEV....YVHL.E.....PLLTDYR.KLRLRKNDG...................-----....TFILTYMDVFIDD.CL.......RKHNLFD..V..DLPPLTKRNVFV---qqn.................................................................
Q4CZI2_TRYCC/9-176                   ................................................wn--LKGRSAVAALDPSTRHRIMQS.HAMASSFHKPL.......................................L........-ATLEVLITP-..-QYVGG..............-LTG.PLQ...........................................KP.EPFICHVTRL.LQIT.PDPS..........IVLA.MLH...............................................QDVHKYLRV............A....ALFI...I.....RLIGN........................EAMM....REAM.R.....VGWEDYR.KIRVYGYVE...................-----....-------------.--.......-------..-..---------------dlegtidskennapdeeegfvrapaygimcvdeitdrlfnv...........................
R7SBP5_TREMS/8-160                   .................................................l-SIHGSNPQYLIEKVIRARIYDS.LYWKEHCFALN.......................................A........-ESIIDKAIT-..LHAIGG..............-TYD.-RQ...........................................TP.TPFICLTLKL.LQLQ.PEKE..........ILME.YLL...............................................AEEFKYLRA............L....AALY...I.....RLTFR........................SMDV....YEIL.E.....PLMKDYR.KLRIRHPGG...................-----....-YSLTYFDQFIDD.LL.......KEERVCD..I..ILPR-----------....................................................................
G0QNU7_ICHMG/10-175                  .................................................n-SIRGQNPQSLIEAVIRQKIYQN.RYWKESLTGLT.......................................A........-ESIIDEAIK-..LQYIAG..............-TYG.GSR...........................................KP.SKFLMLSLKL.LQIS.PSKE..........IVIE.YIR...............................................QEEYKYLTA............L....GCFH...L.....RLVGQ........................PEHV....YNYL.E.....PLYQDYR.KLRFRNLNG...................-----....SFCIFYMDEFVES.LI.......NQEVYID..T..LLPHIIKRHILEE--tg..................................................................
G1PFY0_MYOLU/28-212                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
W6KQG9_9TRYP/4-158                   ................................................nl---KGRQAVASLDPATRYRITRS.QAMS-QCANKP.......................................L........-LWVLEELTS-..VVAVGG..............-LSG.SLH...........................................KV.EYFLCLLTRL.LQIG.PSPD..........IVLA.MLR...............................................QELHKYVKV............A....ALFI...I.....RFIGN........................DIMV....QEAV.K.....LGLDDYR.KIRVYGSDE...................-----....-------------.--.......-------..-..---------------tpvtlfvtpgvkrprdmdesnhelpvgnq.......................................
W9XE09_9EURO/19-185                  ................................................pl--VRGQNPALLLETAMRDRITDS.LYWKEQCFGLN.......................................A........-ATLCDRAVE-..LSYIGG..............-TYG.VAM...........................................KP.TPFICLAFKL.LTLV.PDRE..........IVLE.YLQn.............................................gGEEWKYLRA............L....AAFY...V.....RLTFE........................PADI....YKTL.E.....PFLEDSR.KLRQRRKES...................-----....-YVLIHMDEFVDN.LL.......TKDRVCG..T..SLWKLPARQLLEDL-e...................................................................
F5HEN9_CRYNB/9-170                   .................................................t-AVHGSNPQYLIEKVIRARIYDS.LYWKEHCFALT.......................................A........-ESIIDKAID-..LRAIGG..............-VT-.DRQ...........................................TP.TPFICLVLKL.LQLQ.PEKE..........ILIE.YLL...............................................AEEFKYLRA............L....AAFY...V.....RLTFR........................SLEV....YEIL.E.....PLMKDYR.KLRVVHAGG...................-----....-YSLTHFDEFIDE.LL.......TQERVCD..I..ILPRRIK--------slneka..............................................................
L8IKN7_9CETA/10-175                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
G3IJU9_CRIGR/1-120                   ...........................................mcggvrg-----------------------.-----------.......................................-........-----------..------..............--VG.TGG...........................................IV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSTYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....PFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
C5DED7_LACTC/14-227                  ..................................................KQLNHQSTSLVIPQLARTRIHNS.MYYKINLDPAS.......................................Lrg....dtMVQLSKTMMRD..FGTCRDnar........rmaLVCG.GVE...........................................--.--FKCLLMKL.VHLR.PQWG..........QIVT.ILQkgn........................................erssKFDNKYLVV............L....VLVY...L.....RIQYYflpdtsdeekvtgvlnlnkrgsvsSGTL....RGLF.R.....IYLSDYR.KVKSINLETdy...............wyNSASK....VPKTLHIDEVVDW.LC.......TQDQIWG..I..PLGRCQW-CN-----ifket...............................................................
M3XER9_FELCA/48-232                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
J9VL34_CRYNH/9-172                   .................................................t-AVHGSNPQYLIEKVIRARIYDS.LYWKEHCFALT.......................................A........-ESIIDKAID-..LRAIGG..............-VT-.DRQ...........................................TP.TPFICLVLKL.LQLQ.PEKE..........ILIE.YLL...............................................AEEFKYLRA............L....AAFY...V.....RLTFR........................SLEV....YEIL.E.....PLMKDYR.KLRVVHAGG...................-----....-YSLTHFDEFIDE.LL.......TQERVCD..I..ILPRLTQRSVLEET-e...................................................................
G5AUI5_HETGA/10-175                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
G5DX06_SILLA/4-168                   ..............................................lqts----GKPIDSLVEKVLCMNILSS.DYFR-DLFRLK.......................................T........YHEVVDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HPDSPYIRA............I....GFLY...L.....RYAGD........................AKTL....WNWF.E.....PYVNDDE.---------...................EFSPG...sNGKMTTMGVYVRD.LL.......LGQYYFD..T..LFPRVPVTVL-----rqits...............................................................
E5S6X1_TRISP/427-611                 .................................................l-NFWGNKETMNLNHLVLENIVSS.PYYKNTLLPLK.......................................T........HFEVIDEIYYN..VEHLEP..............WEKG.TRKttgqtgmcg.........................gvrgvgaggVV.SSAFCLLYKL.FTLK.LTRK..........QLTA.ILN...............................................HPDSCYIRG............L....GFMY...I.....RFCLH........................PATF....WSWY.E.....PYFEDSE.---------...................EIDPKa..gGGDLMTIGEMVKS.LL.......TKLDWYS..T..LFPRIPVPIQKEI--dl..................................................................
A0A024GSS3_9STRA/10-174              .................................................q-SIHGIHAQHLIEKIMRNRIYSS.LYWKEECFGLT.......................................C........-ETLVDKAIA-..LDHFGG..............-TFG.GNQ...........................................KP.TPFLCLLLKM.LQLQ.PDLE..........VVQE.FIQ...............................................NEEYKYVTV............L....GMVY...L.....RLVGK........................SADI....YTLL.E.....PLYCDYR.KIRKRNVIG...................-----....-WEITHVDEIVDA.LL.......HEEYYID..L..TLPHLIDRVL-----edale...............................................................
A0A024XRX9_YEASX/15-219              ..................................................KQLNNQSVSLVIPRLTRDKIHNS.MYYKVNLSNES.......................................Lrg....ntMVELLKVMIGA..FGTIKGqng.......hlhmMVLG.GIE...........................................--.--FKCILMKL.IEIR.PNFQ..........QLNF.LLNvk..........................................nenGFDSKYIIA............L....LLVY...A.....RLQYYylngn.............nkndddENDL....IKLF.Kvq.lyKYSQHYF.KLKSFPLQVdc...............faHSYNE....ELCIIHIDELVDW.LA.......TQDHIWG..I..PLGKCQWNKI-----ynsde...............................................................
F1Q7F0_DANRE/25-209                  .................................................l-PLWGNEKTMNLNPMILTNVLSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VNHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HSDSPYIRA............L....GFMY...I.....RYTQP........................PPDL....VDWY.D.....EFLDDEE.---------...................ELDVKa..gGGCVMTVGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKAID-q...................................................................
B4J994_DROGR/10-175                  ..................................................KNVHGTNPQYLIEKIIRSRIYDS.KYWKEQCFALT.......................................A........-ELLVDKAME-..LRFVGG..............-VYG.GNI...........................................RP.TQFLCLTLKM.LQIQ.PEKD..........IVVE.FIK...............................................NEEFKYVRA............L....GAFY...L.....RLTGA........................AIDC....YKYL.E.....PLYIDNR.KLRRQNRAG...................-----....QFEIVYMDEYIDE.LL.......RNDRVCD..I..ILPRIQKRAILEEN-n...................................................................
S2JQG7_MUCC1/11-174                  .................................................a-SIHGRHPLHLIEKIIRERIQNS.LYWKEKCYGLS.......................................A........-ATLMDRAFE-..LEYIGG..............-MYG.NHQ...........................................-P.TEFLCLTLKL.LTLL.PEKD..........IIIE.LIK...............................................QEDVKYLRA............L....GAFY...L.....RLTGK........................SKEI....YQYL.E.....PLLNDYR.KLRVRAGDG...................-----....-YSLTHMDSFIDD.LL.......HKDRVCD..I..ILPRLTSRYVLEQND....................................................................
Q6BW00_DEBHA/12-188                  ............................................dksnvi------RKAYLVEPIIRHRIQDS.LFYKQYLYLTN.......................................E........-ATILPVITSQ..VKYIGS..............--TN.ANG...........................................KP.TPFVCCFLRL.LELE.PSRD..........IIEM.CLHq............................................lgTKEFKYLTA............L....IMLY...I.....RVVWP........................YEDV....ITTL.E.....PFYSDYR.KLRFQLKSPi................mvKGMPI....LYKLSHMDVWCDE.LL.......NNERVVD..L..ILPRMVPRHVLFE--rg..................................................................
G3MFX1_9ACAR/105-174                 ...........................................lfevdgt-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....----...-.....-----........................VADV....YQYL.E.....PLYNDYR.KIRRKLADG...................-----....NFCLTHVDEVIDE.LL.......TKDYSCD..I..ALPRVQKRWTLEA--sg..................................................................
L7M8D1_9ACAR/10-175                  .................................................h-SVRGTNPQYLVEKIIRSRIYDS.RYWKEECFALT.......................................A........-ELLVDKAME-..LRYIGG..............-VYG.GNV...........................................KP.APFLCLLLKM.LQIQ.PEKD..........IVVE.FIR...............................................QDEFKYVRA............L....GANY...M.....RLVGS........................SLDC....YKYL.E.....PLYNDYR.KLRRQNRDG...................-----....VYVIVHMDEFIDE.LL.......REERVVD..I..ILPRIQKRQVLEES-g...................................................................
T1JA16_STRMM/13-197                  .................................................l-PLWGNDKSMNLNSLILTNIQSS.HYFKVNLFDLK.......................................T........YHEVIDEIYYK..VTHLEP..............WEKG.SRKtsgqtgmcg.........................gvrgvgaggIV.STAFCLLYKL.FTLK.LTRK..........QVNG.LIT...............................................HCDSAYIRA............L....GFMY...I.....RYTQP........................PQDL....WDWF.E.....SYLDDDE.---------...................ELDVKa..gGGCMMSIGEMLRH.YL.......TKLEWYS..T..LFPRIPVPIQKEIE-k...................................................................
G5A621_PHYSP/9-173                   .................................................q-SVHGVNPQTLVEKIMRNRVYAS.VYWKEQCFGLT.......................................A........-ETLVDKAVE-..LTEFGG..............-TFG.GNQ...........................................QP.THFLCLLLKM.LQLQ.PELE..........VVRQ.FIE...............................................NDDYKYVTV............L....GAVY...L.....RLVGK........................PREV....YELL.E.....PLLSDYR.KIRKRNVIG...................-----....-WEITHVDEIADA.LL.......NEEYYVD..L..ALPRLVDRELLERN-e...................................................................
B3NWQ4_DROER/26-210                  .................................................l-PFWGNETSMNLNPLILANIQSS.SYFKVHLFKLK.......................................T........YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg.........................gvrgvgaggIV.STAYCLLYKL.YTLR.LTRK..........QING.LLN...............................................HTDSAYIRA............L....GFMY...L.....RYTQP........................PSDL....YDWY.E.....DYLQDEE.---------...................EIDVKa..gGGQVLTIGQMVYQ.FM.......TKLDWFS..T..LFPRIPVPIQKQIE-k...................................................................
C6TI40_SOYBN/10-175                  ..................................................KSIRGTNPQNLVEKILRSKIYQN.TYWKEQCFGLA.......................................A........-ETLVDKAME-..LDHLGG..............-TYG.GNR...........................................KP.TPFMCLVMKM.LQIQ.PEKE..........IIIE.FIK...............................................NEDYKYVRI............L....GAFY...L.....RITGS........................DIDV....YRYL.E.....PLCNDYR.KLRRKLADG...................-----....QFALTHVDEVIDE.LL.......TKDYSCD..I..AMPRVKKRWTLES--lg..................................................................
G9N2S0_HYPVG/26-193                  ...............................................lap---NGLNPATIMEKAVKDRIVDS.YFYKEQCFALN.......................................E........-ADIIDRVVEH..VNFIGG..............-THG.ASQ...........................................KP.SPFLCLAFKL.LELA.PSDA..........ILDE.YLSy.............................................gGEHFKYLRA............L....ACFY...V.....RLTRQ........................PKDV....YQTL.E.....PFLEDRR.KLRRKARTG...................-----....-TSLTYVDEFVDD.LL.......TKDRVCA..T..SLWKMPKRETLEDL-e...................................................................
M9PHQ4_DROME/24-177                  .................................................l-PFWGNESSMNLNALILANIQSS.SYFKVHLFKLK.......................................T........YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg.........................gvrgvgaggIV.STAYCLLYKL.YTLR.LTRK..........QING.LLN...............................................HTDSAYIRA............L....GFMY...L.....RYTQP........................PGDL....YDWY.E.....DYLQDEE.EIDVK----...................-----....-------------.--.......-------..-..---------------agggqvsql...........................................................
B4R4A9_DROSI/197-381                 .................................................l-PFWGNESSMNLNALILANIQSS.SYFKVHLFKLK.......................................T........YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg.........................gvrgvgaggIV.STAYCLLYKL.YTLR.LTRK..........QING.LLN...............................................HTDSAYIRA............L....GFMY...L.....RYTQP........................PSDL....YDWY.E.....DYLRDEE.---------...................EIDVKa..gGGQVLTIGQMVYQ.FM.......TKLDWFS..T..LFPRIPVPIQKQIE-k...................................................................
Q8RWB1_ARATH/4-168                   ................................................iq--SNGRAYESLLEKVLSMNILSS.DYFK-ELYGLK.......................................T........YHEVIDEIYNQ..VNHVEP..............WMGG.NCR...........................................GP.STAYCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HTDSPYIRA............V....GFLY...L.....RYVAD........................AKTL....WTWY.E.....PYIKDDE.---------...................EFSPG...sNGRMTTMGVYVRD.LL.......LGLYYFD..T..LFPRIPVPVMRQ---ivs.................................................................
Q0U5G5_PHANO/25-223                  ................................................al--IRGQNPALLFEKGVRERITES.YYWKEQCFGLN.......................................A........-ATLCDRAAD-..LKFIGG..............-TTG.ITG...........................................KP.TPFLCLAFKM.LQLV.PEKA..........IVLE.YLNfggdeeeedeeggvkke.............eeedgdekpqdpnaagkLGQFKYLRC............L....AAFY...I.....RLAWE........................PVEI....YKTL.E.....PLLTDYR.KIKRRLKDA...................-----....-FTLTYVDQFIDD.LL.......TKDRMCA..T..SLWKLPSRANLEDL-d...................................................................
L5LXA6_MYODS/1-171                   ..................................................--------------MILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrevltggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
G8C0B1_TETPH/14-216                  ..................................................KQLNNQSVSLVIPRLTRDKIHNS.MYYKVNLTDNS.......................................Lrg....ntVLQLSKVIVRD..LGTLLNgss........qqlNVIG.GVE...........................................--.--FKCILMKL.VEMR.PTWE..........QLLS.LLNidndfn...................................svgtvgEFDNKYITA............L....VLTY...I.....RIQYHfins................dhqlFNKC....KKLF.K.....LYMNDYR.KLKSIAFGTnc...............wsMSQAI....DVGIGHIDELVEW.LA.......TKNDIWG..L..PLAMCSW-CNLD---eas.................................................................
W2THV3_NECAM/65-249                  .................................................l-PVWGNQQTMNLNGLVLENVKES.YYYKNHLVEID.......................................S........AQQLLDEVFYK..VKHLEP..............WEKG.TRKvqgmtgmcg.........................gvrgvgaggVV.SSAFCLLYRF.FKVR.LTRK..........QLIS.MIN...............................................SRVSPYIRG............L....GFMY...I.....RYTQP........................PTDL....WEWF.E.....PYLDDEE.---------...................EIDPRs..gGGDVMTFGQVVRI.ML.......TKLDWYG..T..LFPRIPVPIQKEID-e...................................................................
I0YZI6_9CHLO/10-175                  .................................................r-SVHGTNPQNLVEKILRMKIYSS.MYWKEHCFALT.......................................A........-ESLVDKAVD-..LKYVGG..............-TFG.GQR...........................................AP.TQFMCLMLKL.LQLQ.PEKE..........IIVE.FIK...............................................NEDYKYVRI............L....GAFY...L.....RLVGR........................PLEV....YQYL.E.....PLYNDYR.KVRLRNADG...................-----....NFALTHMDEIIDQ.ML.......YSEYLFD..V..AMPRIPNRVTMER--ls..................................................................
M5ELW3_MALS4/10-174                  .................................................l-AIHGTNPQFLVERVIRTRIYDS.TYWKQDCFALN.......................................A........-ASLVDKAVE-..LTYVGG..............-TYG.ALR...........................................-P.SPFLCLVCKL.LQLQ.PDRD..........IVLE.YLA...............................................AEDLKYLRA............L....AAMY...I.....RLTFP........................SLEV....YELL.E.....PLLNDYH.KLRWRDMTG...................-----....QYSLSYMDEFIDQ.LL.......TEERVCD..L..ILPRLTKRAVLERK-e...................................................................
B8C9N6_THAPS/41-204                  ............................................placpd-------DTFNIHPMLLQNIAKS.PYFQKCCEKLG.......................................D........WNTLVDEIYYE..VKHMEP..............WTAG.ASK...........................................SP.STAFCLLLRL.FTLR.CTEK..........QMSL.MLE...............................................HVDSPYIRC............I....GFLY...L.....RYAAE........................PSTL....WSWY.E.....QYLYDEE.PVQIRQGKA...................-----....---DTTVGEYIRS.LL.......EDLEYYG..T..RLPRLPLT-------lerqfk..............................................................
M3ZTE6_XIPMA/10-175                  .................................................n-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LKFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRL............L....GAMY...M.....RLTGT........................AVDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HAERVCD..I..ILPRLQKRQVLEEA-e...................................................................
V6U1Q1_GIAIN/1-137                   ..................................................-----------MEHTTRRAILNS.PLYLMEFKHLG.......................................V........IGLLKDVLLT-..-RNIDL..............-KYG.--R...........................................EP.SRFLCALVRL.YMLH.PDRS..........IVNE.MLS...............................................VRNFAYANA............F....AAIH...V.....RCYWP........................SLDI....HKAL.T.....PLMSNYT.KIHVSGLES...................-F--G....LQGHIPLDVLIEA.LL.......-------..-..---------------wqsta...............................................................
T0QUG7_9STRA/50-213                  .................................................l-PVHGNATTYNLNKMLFDNIMQS.VYFG-QLYALK.......................................T........YHEVVDEIYYR..VDHAEP..............LSPG.TAR...........................................IP.SSCFCLLLKF.CTMR.LTQN..........QMQG.LLK...............................................HVDSPYIRC............V....GFLY...L.....RYTMD........................PEEL....WSWF.E.....PYLDDAE.---------...................EFNASa..nDKIVTTTGAWLRT.LL.......EEINYFG..T..ILPRIPKKI------ldgi................................................................
Q7RC31_PLAYO/10-175                  ..............................................iksf----GSNPQFLISNIIRNKIYDS.PYWKEKCFALT.......................................S........-ESIIDQAVN-..LKYVGG..............-TYG.GNR...........................................KP.TRFLCLVLKL.LQLQ.PDKD..........IIYE.FIK...............................................NEEFIYLRA............L....GIFY...L.....RLIGK........................GIDI....YKNI.E.....PILFDYR.KIRIRLQDG...................-----....SFQKIYMDVFADN.CL.......VFSNFLD..V..DFPPLTKRVVLEEN-h...................................................................
C1LKA9_SCHJA/27-211                  .................................................l-KLWGNPQTMNLNTMIYTNIVQS.PYFKANLVELK.......................................T........YHEVIDEIYYK..VEHLEP..............WERG.SRRiggqtgmcg.........................gvrgvgaggIV.STAYCLLYKL.FTLK.LTRK..........QLKG.LLD...............................................HPDSPYIRA............L....GFMY...I.....RYCIP........................PEDF....WWWY.S.....PYWSDPE.---------...................ELDVKa..gGGCIMTIGNMLEH.WL.......TKLDWFS..T..LFPRIPVPVQKK---lee.................................................................
A0A022TM69_TRIRU/20-222              ................................................pl--IRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTYIGG..............-TYG.VGQ...........................................KP.TPFLCLAFKL.LQLA.PEKE..........VILE.YLNfhdpeadeedlkvrgdstd.........adggagdaqdradaailkaTGDFKYLRA............L....AAFY...I.....RLTFE........................PVEI....YKTL.E.....PLLTDYR.KLKRRTKEG...................-----....-FLLTYMDQFVDD.LL.......TKDRVCG..T..SLWKIPTRTILEDL-d...................................................................
K0SK04_THAOC/10-174                  .................................................a-AVHGTNPQNLVEYITRQKIYDS.LYWKEECFGLS.......................................A........-SDVATKAVE-..LKALGG..............-SYG.GNS...........................................KP.TRFLCLILKM.LQIQ.PEEG..........IVEQ.FLE...............................................NEDFKYVRA............L....GAFY...L.....RLTGR........................PSEI....FELI.E.....PLFNDHR.KLRYRTPTG...................-----....-WVITYMDQLADE.LL.......HQDRYCG..I..ALPHLPKRDVLET--ag..................................................................
B8NUH3_ASPFN/20-209                  ................................................pl--VRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTSIGG..............-TYG.VSE...........................................KP.TPFLCLAFKM.LQLN.PDRD..........IVLE.YLNftdpvndeegeq......................taaeqaengvvkqRGDFKYLRA............L....AAFY...V.....RLTFD........................AVDV....YKTL.E.....PLLLDYR.KLKRRVRDS...................-----....-VVLTYVDQFVDD.LL.......TKDRVCG..T..SLWKLPSRQQLEDL-d...................................................................
M5G439_DACSP/10-173                  .................................................t-SVHGTNPQHLIETVIRSRIYES.LYWKEHCFALT.......................................A........-ETLIDKAIE-..LNCIGG..............-MYG.N-Q...........................................RP.THFMCLLLKL.LQIQ.PEKE..........ILIE.YLL...............................................VEEFKYLRA............L....AALY...I.....RLVFR........................PAEV....YELL.E.....PLLKDYR.KIRLRNMSG...................-----....-YVLTYMDEYIDE.LL.......REERVCD..I..ILPRMTKRDILEE--ve..................................................................
W7MMC8_GIBM7/25-192                  ...............................................vap---NGLNPATIMEKAVKDRIVDS.YFYKEQCFALN.......................................E........-ADIVDRVVEH..VNFIGG..............-TYG.VTQ...........................................KP.SPFLCLAFKL.LELS.PSDA..........VLME.YLKy.............................................gGEAFKYLRA............L....ACFY...F.....RLTRQ........................AKDV....YQML.E.....PFLEDRR.KLRRRGRAG...................-----....-VVLTFMDEFVDE.LL.......TKERVCG..T..SLWKMPKREVLEDL-e...................................................................
B4Q236_DROYA/28-212                  .................................................l-PFWGNENSMNLNPLILANIQSS.SYFKVHLFKLK.......................................T........YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg.........................gvrgvgaggIV.STAYCLLYKL.YTLR.LTRK..........QING.LLN...............................................HTDSAYIRA............L....GFMY...L.....RYTQP........................PSDL....YDWY.E.....DYLQDEE.---------...................EIDVKa..gGGQVLTIGQMVYQ.FM.......TKLDWFS..T..LFPRIPVPIQKQIE-k...................................................................
M4EH49_BRARP/4-168                   .................................................i-QTNGRAYESLLEKVLSMNIVSS.DYFK-ELYGLK.......................................T........YHEVIDEIYNQ..VSHVEP..............WMGG.NCR...........................................GP.STAYCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HTDSPYIRA............V....GFLY...L.....RYVAD........................AKTL....WTWY.E.....PYIKDDE.---------...................EFAPG...sNGRTTTMGVYVRD.LL.......LGLYYFD..T..LFPRIPVPVMRQ---ivs.................................................................
U5FGX6_POPTR/3-167                   .................................................i-QTNGKPIDSLLEKVLCMNILSS.DYFK-ELYRLK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STSFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HKDSPYIRA............V....GFLY...L.....RYAGD........................PKTL....WNWF.E.....PYIKDDE.---------...................EFSPG...tSGRKTTMGVYVRD.LL.......LGQYYFD..T..LFPRIPVPVMRQ---its.................................................................
K0KUA6_WICCF/15-175                  ................................................st--HKGQNSILLIEKIIRERIFDS.LYWKQYCFNVN.......................................A........-ALILDRCVE-..IRCVGG..............--LE.TSG...........................................KP.MGFICLLVKL.IQLM.PQRE..........IIEF.YLN...............................................QGKFKYLKV............L....AMVF...I.....RLVYR........................DGGL....---L.K.....KQLNDYR.KVRLYEHGE...................-----....-YKLSYVDEIADK.LL.......NDEMFIG..L..NLPYMKTNGDDE---sdd.................................................................
W5UFD4_ICTPU/10-175                  .................................................n-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LKFIGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRL............L....GAMY...M.....RLTGT........................SVDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HGERVCD..I..ILPRLQKRQVLEEA-e...................................................................
I1H1P3_BRADI/3-165                   ...........................................iqssgrp-------IEVLMEKVLSMNIVSS.DYFK-ELYKIK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKL.FTMK.LTMN..........QMHG.LLK...............................................HPDSPYIRA............I....GFLY...L.....RYVAE........................PKTL....WTWY.E.....PYIQDDE.---------...................EFSPG...sNGKMTTMGVYVRD.VL.......LGQYYFD..S..LLPRVPL--------lilrqv..............................................................
S7NM55_MYOBR/1-94                    .................................................m-----------------------.-----------.......................................-........---------E-..LRFMGG..............-IYG.GNL...........................................RP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVFM............L....GALY...M.....RLTGT........................AIDY....YKFL.E.....PLYNDYR.KIKSQNQNE...................-----....EFELIQV------.--.......-------..-..---------------d...................................................................
H2N7E1_PONAB/19-176                  .....................................kylvekdhsnaks--------------------MSS.KYWKEECFGLT.......................................A........-ELVVDKL-E-..LRFVGGv...........ygWAII.KTQ...........................................--.HPFLCLTL-M.LQIQ.PE-D..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
H3CJ03_TETNG/10-177                  .................................................n-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LKFVGG..............-VFG.GNI...........................................KP.TPFICLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRL............L....GAMY...M.....RLTGT........................AVDC....YKYL.E.....PLYNDYR.KVKTQNRNG...................---DS....EFELMHVDEFIDQ.LL.......HSERICD..I..ILPRLQKRHVLEET-e...................................................................
Q18942_CAEEL/10-175                  .................................................k-TVKGTNPQFLVEKIIRQRIYDS.MYWKEHCFALT.......................................A........-ELVVDKGMD-..LRYIGG..............-IYA.GNI...........................................KP.TPFLCLALKM.LQIQ.PDKD..........IVLE.FIQ...............................................QEEFKYIRA............L....GAMY...L.....RLTFD........................STEI....YKYL.E.....PLYNDFR.KLRYMNKMG...................-----....RFEAIYMDDFIDN.LL.......REDRYCD..I..QLPRLQKRWALEE--vd..................................................................
B9FRG0_ORYSJ/4-145                   ...........................................qssgrpi--------DVLMEKVLSVNILSS.DYFK-ELYRLK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.SSAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HPDSPYIRA............V....HSEQ...K.....RYYFDs.....................llPRVP....LPIL.R.....QVTGHLE.KMKLPTKQ-...................-----....-------------.--.......-------..-..---------------sgitgdssrlg.........................................................
F7GLJ8_MONDO/12-196                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
H8WYB4_CANO9/18-195                  .............................................dkrni-----LNKSYLVEPIIRHRIHDS.IFYKEHLYLTN.......................................E........-STILPIITQH..VHYISG..............--VD.SVG...........................................RP.SPFLQCLLRL.LELE.PSKE..........IINV.YLDq............................................lsYSEFKYLTA............L....ALLY...V.....RLVFP........................SEEV....YNIF.D.....QHAQDYR.KLRVKLKTP...................QFDAMqrpiHYKLGYMDEFIDG.LL.......TQERVVD..L..ILPRLIPRLSLV---erg.................................................................
A0A024TH67_9STRA/55-219              .................................................l-PIHGNQSTYNFNTLLYDNVMNS.DYFR-KLYELT.......................................T........YHEVVDEIYYR..VDHAEP..............WAAG.TSR...........................................IP.STCFCLLMKF.CTMR.LTIN..........QMQG.LLK...............................................HVDSPYIRC............V....GFLY...L.....RYTCD........................PELL....WEWY.E.....PYLGDDE.---------...................EFNASs..nDAIRTTMGAWIRS.LL.......EDINYFN..T..ILPRIPKKIQ-----dgik................................................................
S9PW36_SCHOY/14-177                  ................................................dv--VHQMLPTFLVGKILRERIVEC.FYWKEQCFGLN.......................................A........-ASLIDRAVR-..LEYVGG..............-QYG.-NQ...........................................HP.TEFICLLYKL.LQVA.PEKE..........IVMQ.YLA...............................................VPEFKYIRA............L....AAFY...I.....RLTWS........................DPEV....YQAL.E.....PLMKDYR.KLRIRDHNG...................-----....-FYVSHMDEFIDA.LF.......NEETVCD..I..TLPPLMSRYQLEEL-d...................................................................
F4PGM1_DICFS/1-133                   ...............................................mrg-----------------------.-----------.......................................-........VNEVIDEIYNK..VEYLCP..............YIPG.-TK...........................................TP.SSAYCLLYKL.YTLK.LTEE..........HMET.LIF...............................................HGDSPYIRA............I....GFLF...L.....RYAHP........................PASL....WDWF.N.....ECLDDQE.---L-----...................-IAIS...pKSKPITMELFLLG.LL.......KEQKFAE..T..ILPRIPVKVMKEL--eq..................................................................
W5DV57_WHEAT/3-53                    ................................................iq--TSGKPIDMLMEKVLCMNILSS.DYFK-ELYQMK.......................................T........YHEVIDEIYNQ..VDHVEP..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....----...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------....................................................................
K6VGZ7_9APIC/165-327                 ...............................................lem----TNTTTYNVNTLLRNNILSS.EYFR-SLVPMK.......................................T........FKEVVDEIHLY..ADHVEP..............YCIG.STR...........................................AP.STLFCCLYKL.FTMH.LSEK..........QMKV.LIE...............................................SRDSCYIRA............C....GFLY...L.....RYVHS........................PANL....WMWF.E.....PYLLDED.-LFVTSADK...................-----....-RKKQTIGEYIQC.LL.......ADDKYFN..T..VLPRMPIKIK-----nty.................................................................
E9GQD3_DAPPU/32-216                  .................................................l-PIWGNERTMNLNPLILTNIQTS.HYFKTNLSELK.......................................T........YHEVVDEIYYK..VQHLEP..............WEKG.SRKtsgqtgmcg.........................gvrgvgaggIV.STPYCLLYKL.FTLK.LTRK..........QLIG.LIT...............................................HCDSPYIRG............L....GFMH...I.....RYTQP........................PADL....FGWF.Q.....PYLEDEE.---------...................EIDPKa..gGGHPMTIGTMVRQ.LL.......TKLDWYD..S..LFPRIPVPIQINI--dr..................................................................
A0A016P7Z6_GIBZA/25-192              ...............................................vap---NGLNPATIMEKAVRDRIVDS.IYYKMQCFACN.......................................E........-ADIVDRVVED..VKFIGG..............-TYG.TTQ...........................................VP.SPFLCLAFKL.LELS.PSDA..........VLLE.YLKf.............................................gGEAFKYLRA............L....ACFY...F.....RLTRQ........................AKNV....YEML.E.....PFLEDRR.KLRRRGREG...................-----....-VKLSYMDEFVDD.LL.......TKERVCG..T..SLWKMPKREVLEDL-q...................................................................
M7WBI1_ENTHI/2-162                   .............................................sgper----------RLETILRNKIYNC.EYWKQQCFTLT.......................................S........-ETILDEIVK-..LHDFGG..............-TYG.VLK...........................................KP.TKFIVLIMKL.LMLR.PDKS..........IIYE.YIM...............................................NEEFKYVRV............I....GAFY...L.....RLIGS........................SKEC....YQFI.E.....PLYYDYR.PLKYRIDSK...................-----....HYEIITIDQFAWN.LL.......HLDYYCD..I..TLPIITPRPVIE---shg.................................................................
B4ZYI9_CAEBE/55-212                  .................................................l-PIWGNQVTMNLNTLVLENIRES.YYYKNNLVEID.......................................S........FQTLVEQIFYQ..VKHLEP..............WEKG.TRRlqgmtgmcg.........................gvrgvgaggVV.SSAYCLLFRL.FNLR.ISRK..........QLIS.MLN...............................................SRQSVYIRG............I....GFMY...I.....RYTQP........................PADL....WYWL.E.....PYLDDDS.---------...................EIDPRs..gGGDLMSFGQMV--.--.......-------..-..---------------....................................................................
V5GRF0_ANOGL/25-209                  .................................................l-PLWGNERTMNLNPLILTNIQSS.HYFKVNLYELK.......................................T........YHEVVDEIYYK..VNHLEP..............WEKG.SRRtsgqtgmcg.........................gvrgvgaggIV.STAYCLLYKL.FTLK.LTRK..........QLNG.LIS...............................................HCDSPYIRA............L....GFMY...I.....RYTFP........................PPSL....LEWY.E.....EYLEDEE.---------...................ELDVKa..gGGQTMTIGMMLRQ.WL.......VKLEWFS..T..LFPRIPVSIQQKIQ-k...................................................................
U6IAL5_HYMMI/27-211                  .................................................l-KLWGNQVTMNINPMIHTNIIQS.PYFKTNLIELK.......................................T........YHEVIDEIYYK..VTHLEP..............WERN.SRRvggqtgmcg.........................gvrgvgaggIV.STAYCLLFKL.FTLK.LTRK..........QLKG.LLE...............................................HPDSPYIRS............L....GFMY...I.....RYCLP........................PEDL....WMWF.S.....PYLDDEE.---------...................EVDVRa..gGGCTMTIGAMLEQ.FL.......TKLDWFT..T..LFPRIPVPVQKKIE-e...................................................................
S9XCT7_9CETA/1-124                   .................................................m-----------------------.-----------.......................................-........---------E-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IVVE.FIR...............................................NEDFKYVCM............L....GALY...M.....RLTGT........................AVDY....YKYL.E.....PLYSNYR.KIKSQNRNG...................-----....EFELVRVDEFIDE.LL.......HSERVCD..I..ILPQLQKRYVLEEA-e...................................................................
I1BHD0_RHIO9/11-174                  ................................................tg--IHGRHPLHLVEKIIRERIQES.IYWKEKCYGLT.......................................A........-ATLTERAVD-..VDYIGG..............-MYG.NLQ...........................................-P.TEFICLLLKL.LQLL.PEKE..........IIIE.FVK...............................................QEDFKYLRA............L....GAFY...L.....RLTGK........................SKEI....YQYL.E.....PLLNDYR.KLRARGKEG...................-----....-FSLTYMDVFVDD.LL.......TKDRVCD..I..ILPRIMARHVLEQND....................................................................
F6UK93_HORSE/47-231                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
E4YKK0_OIKDI/82-282                  .................................................l-PVHGNERTMNLNHMVLANITES.AYFRCDLLQIK.......................................T........YDEMIDEIYYK..VTHLEP..............WEKG.SRKhftgsatgaergmayss.........ipgvqnyvgvrgvgqggIV.STPFCCLYKL.WTIK.LTRK..........QVEL.MCD...............................................HVDSPFIRG............L....GFLY...L.....RFSLP........................PQNL....LEFL.Q.....PYFNDQE.---------...................EVDPKa..gGGDPMTMGALILA.ML.......EENHWYG..T..MLPRIPAKHLQEIR-r...................................................................
W4WLI1_ATTCE/10-175                  ..................................................KSIRGTNPQYLIEKIIRSRIYDS.KYWKEECFALT.......................................A........-ELLVDKAME-..LRFLGG..............-VYG.GNV...........................................KP.TPFLCLILKM.LQIQ.PEKD..........IIVE.FIK...............................................NEEFKYVRA............L....GALY...M.....RLTGS........................SLDC....YKYL.E.....PLFNDNR.KLRIQNKQG...................-----....VFELVHMDEFIDN.LL.......RDERCCD..V..ILPRIQKRHVLEEN-n...................................................................
T1EDF2_HELRO/10-175                  .................................................a-TVKGTNPQYLIEKIIRTRIYES.KFWKEECFALS.......................................A........-ELLVDKAME-..LKYLGG..............-VYA.GNV...........................................KV.SPFLCLILKM.LQIQ.PEKD..........IIVE.FIT...............................................QPDFKYVRA............L....GALY...M.....RLTGT........................SLDC....YKYL.E.....PLYLDYR.KLKRMDRNG...................-----....LFDLVHMDEYVDD.LL.......REERILD..I..ILPRIQKRHVLEE--mn..................................................................
F1LD56_ASCSU/4-173                   .............................................ssril--------------------IQC.TYYKNYLAETT.......................................G........FQQLTEEIYYN..VKHLEP..............WERG.TRKtqgmtgmcg.........................gvrgvgaggVV.STAFCLLYKL.FTIR.LTRK..........QLVS.MIN...............................................NRDSPYIRG............I....GFMY...I.....RFCQP........................PTDL....WAWM.E.....PYLEDEE.---------...................QIDPRs..gGGDVMTMAQVVKM.ML.......TKLDWYG..T..LFPRIPVPIQKEI--el..................................................................
H1VMK2_COLHI/24-191                  ...............................................lap---NGENPATIMEKAVRERIVDS.YFYKEQCFAVN.......................................E........-ADIVDRVVEH..VTFVGG..............-TYG.VTQ...........................................KP.TPFLCLAFKL.LQLA.PSDD..........VLEA.YLGl.............................................gGEKFKYLRA............L....ACFY...V.....RMTRK........................ARDV....YLLL.E.....PFLEDRR.KLRRKGRQG...................-----....-TSLTYMDDFVDD.LL.......TKTRVCA..T..SFRELPKRSDLVDL-d...................................................................
G1LRX0_AILME/10-175                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
Q17D08_AEDAE/10-175                  ..................................................KNVHGTNPQYLIEKIIRSRIYDS.KYWKEQCFALT.......................................A........-ELLVDKAMD-..IRYLGG..............-VFG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IVVE.FIK...............................................NEEFKYVRA............L....GAFY...L.....RLTGS........................SLDC....YKYL.E.....PLYNDNR.KLRRQNRLG...................-----....HYELVHMDEFIDE.LL.......REERACD..I..ILPRIQKRHVLEEN-n...................................................................
A0A024VIV8_PLAFA/154-331             ......inkkhslhfvkrkytkrklmasniqnicnfitdknknensrtkk-----------------------.---------VE.......................................-........TESIIDQAIN-..LKYVGG..............-TYG.GNR...........................................KP.TRFLCLILKL.LQIQ.PDKD..........IIYE.YIK...............................................NEDFVYLRA............L....GIFY...L.....RLIGK........................SLEV....YNHL.E.....PILFDYR.KIRMRLQNG...................-----....TFEKIYMDVFVDN.CL.......ILNNFLD..V..DFPTLTKRQVLEEN-n...................................................................
H0GV28_SACCK/15-219                  ..................................................KQLNNQSVSLIIPRLTRDKIHNS.MYYKVNLSNES.......................................Lrg....ntMLELLRVIIDA..LGTLRGqdg.......hlnmAVLG.GVE...........................................--.--FKCILMKL.VEIR.PNLK..........QLAF.LLDvk..........................................nvkDFNSKYIVA............L....VLVY...A.....RLQYYylndq.............nknnsyENDL....IQLF.Kvq.lyKYSQQFF.KLKSFPLQVdc...............faHSQNE....ELCIVHVDELVDW.LV.......TQDHIWG..I..PLGKCQWSKI-----ydsee...............................................................
B0Y458_ASPFC/33-222                  ................................................pl--VRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTSIGG..............-TYG.VAE...........................................KP.TPFLCLAFKL.LQLN.PERE..........IILE.YLNytdpgsdeetea......................taeeqarngvlgqRGDFKYLRA............L....AAFY...V.....RLTFD........................PVDV....YKTL.E.....PLLLDYR.KLKRRVRDT...................-----....-FVLTYMDQFVDD.LL.......TKDRVCG..T..SLWKLPARQQLEDL-d...................................................................
F8P4X8_SERL9/10-173                  .................................................q-AIHGQNPQFLVETVIRNRIYEA.TYWKEHCFALT.......................................A........-ETLIDKAIE-..VRFIGG..............-VYG.N-Q...........................................RP.TEFLCLLLKL.LQIQ.PEKE..........ILVE.YLQ...............................................ADEFKYMRA............L....AAMY...I.....RMTFA........................AVDV....YEML.E.....PLLKDYR.KLRYRDMAG...................-----....-YSLTFMDEFIYS.LL.......TEERVCD..I..ILPRIARRQTLEEN-g...................................................................
D7LFT1_ARALL/10-175                  ..................................................KNIRGTNPQNLVEKIVRTKIYQH.TFWKEQCFGLT.......................................A........-ETLVDKAME-..LDHLGG..............-TFG.GSR...........................................KP.TPFLCLILKM.LQIQ.PEKE..........IVVE.FIK...............................................NDDYKYVRI............L....GAFY...L.....RLTGT........................DVDV....YRYL.E.....PLYNDYR.KVRQKLADG...................-----....RFSLTHVDEVIEE.LL.......TKDYSCD..I..AMPRLKKRWTLEQN-g...................................................................
W9N9A5_FUSOX/25-192                  ...............................................vap---NGLNPATIMEKAVKDRIVDS.YFYKEQCFALN.......................................E........-ADIVDRVVEH..VNFIGG..............-TYG.VTQ...........................................KP.SPFLCLAFKL.LELS.PSDA..........VLME.YLKy.............................................gGEAFKYLRA............L....ACFY...F.....RLTRQ........................AKDV....YEML.E.....PFLEDRR.KLRRRGRAG...................-----....-VVLTFMDEFVDE.LL.......TKERVCG..T..SLWKMPKREVLEDL-e...................................................................
V9D4R0_9EURO/19-185                  ................................................pl--IRGQNPALLLETAMRDRITDS.LYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTYIGG..............-TYG.VAM...........................................KP.TPFICLAFKL.LTLV.PDRE..........IVLE.YLKn.............................................gGEEWKYLRA............L....AAFY...V.....RLTFN........................PADV....YKTL.E.....PFLEDSR.KLRQRRKEE...................-----....-YILIHMDEFVDN.LL.......TKDRVCG..T..TLWKLPARQVLEDL-d...................................................................
A2QN12_ASPNC/20-209                  ................................................pl--VRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTSIGG..............-VYG.VSE...........................................KP.SPFLCLAFKL.LQLN.PERD..........IILE.YLNfsdpandedstg......................heerehddgvvkaRGDFKYLRA............L....AAFY...V.....RLTFE........................PVEV....YKTL.E.....PLLLDYR.KLKRRVRDS...................-----....-FTLTYMDQFVDE.LL.......TKERVCG..T..SLWKLPARQVLEDL-d...................................................................
C4R8X3_PICPG/19-184                  .................................................e-KIHGVNPVFLIDKILREKILDS.LFWKKHCFLLD.......................................I........-LELQDLASE-..VEIIGT..............YDTN.QNS...........................................RA.TDYICLLLKM.LQLQ.PKDE..........IVIY.MLT...............................................QPYFKYVTA............L....AALY...I.....RLVFP........................SVRV....YQLL.E.....PLLNDYR.KLRIRKHGN...................-----....-ADLTYVDQLVDE.LL.......TEEKFCG..L..TLPRLVNRLRLEDD-g...................................................................
E1ZNW2_CHLVA/10-175                  .................................................a-AIHGTNPQNLIEYISRQKIYDS.IYWKQECFGLS.......................................A........-ERLVDKAVE-..ITEVGG..............-MQG.EPQ...........................................KP.THFICLILKM.LQIQ.PDKD..........IVVE.FIK...............................................NDDFKYLRL............L....GAFY...M.....RLVGR........................PLDV....YQYL.E.....PLYNDYR.KVRIRNFQG...................-----....RQELGHVDELIDA.ML.......HKDRLFG..I..ALPRLPARTTLE---gag.................................................................
G3PQV2_GASAC/24-208                  .................................................l-PLWGNEKTMNLNPMILTNVLSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHAEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QLMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PADL....IDWY.D.....GFLDDEE.---------...................ELDVKa..gGGCVMTVGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKLI--dq..................................................................
D8LU65_ECTSI/4-146                   .................................................r-----------------------.RYWKEHCFGLT.......................................A........-ETLVDKAMM-..LTHLGG..............-TFG.GNQ...........................................QP.TKFLCLVLKM.LQIQ.PEKE..........IIIE.FIK...............................................NEDYKYVRV............L....GAFY...L.....RLVGT........................PADI....YQYL.E.....PLYNDYR.KIRLRLTQG...................-----....-WELRTIDQQIEE.LL.......HSDISCS..I..ALPRLPKRVALEDS-k...................................................................
E4YYX7_OIKDI/82-113                  .................................................l-PVHGNERTMNLNHMVLANITES.AYFRCDLL---.......................................-........-----------..------..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....----...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------q...................................................................
K2R9I0_MACPH/20-208                  ................................................al--IRGQNPALLFEKAVRDRITES.YYWKEQCFGLN.......................................A........-ATLCDRAAE-..LTYIGG..............-TYG.GMG...........................................KA.TPFLCLAFKL.LQLV.PEKE..........IILA.YLNwpedeergsgdd.......................gededesrvpgtKGEFKYLRA............L....AAFY...I.....RLAWE........................PVEI....YKTL.E.....PLLADYR.KLKRRMRDG...................-----....-FVLTFVDQFVDD.LL.......TKDRVCA..T..SLWKLPPRTLLEDL-d...................................................................
R7TJL4_CAPTE/7-191                   .................................................l-PIHGNEKSMNLNHMILSNIQAS.PYFKVNLYDLK.......................................T........YHEVIDEIFYK..VNHLEP..............WEKG.SRKtagqtgmcg.........................gvrgvgaggIV.SSAYCLLYKL.FTLR.LTRK..........QLVG.LLQ...............................................HTDSPYIRG............L....GFMY...I.....RYTQP........................PGEI....WDWY.V.....DYLEDEE.EI-------...................--DVRa..gGGHVITIGEMCRL.FM.......TKLEWYS..T..LFPRVPVPIQKSI--en..................................................................
H2PZJ2_PANTR/47-231                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
D4AX30_ARTBC/20-222                  ................................................pl--IRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTYIGG..............-TYG.VGQ...........................................KP.TPFLCLAFKL.LQLA.PEKE..........VILE.YLNfhdpeadeedsnirrdstd.........adggaedaqdradaailkaTGDFKYLRA............L....AAFY...I.....RLTFE........................PVEI....YKTL.E.....PLLTDYR.KLKRRTKEG...................-----....-FLLTYMDQFVDD.LL.......TKDRVCG..T..SLWKIPTRTMLEDL-d...................................................................
F0ULM3_AJEC8/20-214                  ................................................pl--IRGVNPATLFEKAVRDRITES.YYWKEQCFGLN.......................................A........-ATLCDRAAE-..LSYIGG..............-TYG.LAQ...........................................KP.TPFLCLAFKL.LQLA.PEKE..........IVLE.YLNfhdpenghvegsemn.................gleeeqggasgvvkaVGDFKYLRA............L....AAFY...I.....RLTFD........................AADI....YKSL.E.....PLLTDYR.KLKRRMKDG...................-----....-FVLTYIDQFVDD.LL.......TKDRVCG..T..SLWKLPSRHQLEDL-d...................................................................
H3G9C3_PHYRM/9-173                   .................................................l-SVHGVNPQTLVEKIMRNRIYAS.IYWKEQCFGLT.......................................A........-ETLVDKAVE-..LSDFGG..............-TFG.GNQ...........................................QP.TPFLCLLLKM.LQLQ.SEIE..........VVKQ.FVE...............................................NEDYKYVTV............L....GAVY...L.....RLVGK........................PADV....YTLL.E.....PLLSDYR.KIRKRNVIG...................-----....-WEITHVDEIADA.LL.......TEEYYID..L..TLPRLVDRGLLEKN-e...................................................................
A4HYV7_LEIIN/4-144                   ........................................nlkgraaias-----------LDPPTRYRVLHS.HTMT-RCASKP.......................................L........-LWVLEELIT-..LRYLGG..............-LTG.PLH...........................................TA.NYFICLVVRL.LQIC.PSVA..........IVRV.MLE...............................................QDVHKYLRA............A....ALLI...I.....RLIGN........................VELQ....REAM.R.....VGWSDYR.KLCLYGSDP...................-----....-------------.--.......-------..-..---------------aqelaestsntaaga.....................................................
A0CFN0_PARTE/86-247                  .................................................i-PIRGENAISNMNSLVRQNILTC.PYYK-ELLQIR.......................................D........INDIVTETDKI..VTSVGT..............WA--.GPG...........................................VP.SSFFCILHKL.MSMN.LNVK..........QLQI.LCD...............................................WKLNPYVRC............L....GLLY...L.....RYSLD........................PNFL....WGWM.K.....RYILDEQ.---------...................EFKPS....KDENITIGDFCER.LL.......TDLNYYN..T..RLPRIPQQIDT----iiqa................................................................
V4NLP3_EUTSA/4-168                   .................................................i-QTNGRAYESLLEKVLSMNILSS.DYFK-ELYGLK.......................................T........YHEVIDEIYNQ..VNHVEP..............WMGG.NCR...........................................GP.STAYCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HTDSPYIRA............V....GFLY...L.....RYVAD........................AKTL....WTWY.E.....PYIKDDE.---------...................EFAPG...sNGRMTTMGVYVRD.LL.......LGLYYFD..T..LFPRIPVPVMRQ---ivs.................................................................
K4FUA1_CALMI/10-175                  .................................................h-SIHGTNPQYLIEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFIGG..............-VYG.GNI...........................................KP.SPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRL............L....GALY...M.....RLTGS........................ATDC....YKYL.E.....PLYNDYR.KVKRQSGDG...................-----....EFELIHVDEFMDE.LL.......HEERVCD..I..ILPRLQKRYVLEEA-e...................................................................
L9KRH9_TUPCH/54-238                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
K4BPW0_SOLLC/5-167                   ..........................................ktsgrpid---------QLLEKVLCMNILSS.DYFR-DLLRLK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HPDSPYIRA............I....GFLY...L.....RYLGD........................FKTL....WGWY.E.....PYLKDDE.---------...................EFSPG...sSGQMTTMGVYVRD.LF.......LGQYYFD..T..LLPRIPVPVV-----rtav................................................................
W4W0X9_ATTCE/37-225                  .................................................l-PLWGNERTMNLNPLILTNIQSS.HYFKVNLYELK.......................................T........YHEVIDEIYYK..VSHLEP..............WEKG.SRKtagqtgmcg.........................gvrgvgaggIV.STAYCLLYKL.FTLR.LTRK..........QLNG.LIN...............................................HPDSPYIRA............L....GFMY...IstvtiRYTQP........................PADL....FSWY.N.....DYLEDEE.---------...................ELDVKa..gGGQVMKMGDILKQ.FL.......TKLEWFS..T..LFPRIPVPIQKD---le..................................................................
C1ML42_MICPC/10-175                  .................................................r-SINGLNPQAIIEKITRTKIYES.PFWKERCFGVS.......................................A........-ATLVDLAMN-..LRAFGG..............-VYG.SSS...........................................KA.TDFLCLTLKM.LQIQ.PDKE..........VILE.FIK...............................................NEDCKYVRI............L....GAFY...L.....RLVGK........................SFEV....YQLL.E.....PLLLDYR.KIRHQTSQG...................-----....NFELMHVDEFVSA.LL.......TRDNFCD..I..SLPRLTHRQLLET--sg..................................................................
I3SX28_MEDTR/10-175                  ..................................................KSIRGTNPQNLVEKILRSKIYQH.TYWKEQCFGLT.......................................A........-ETLVDKAME-..LDHLGG..............-TYG.GNR...........................................KP.TPFMCLVMKM.LQIQ.PEKE..........IVIE.FIK...............................................NDDYKYVRI............L....GAFY...L.....RLTGS........................DTDV....YHYP.E.....PLYNDYR.KLRRKLPDG...................-----....QFALTHVDEVIDE.LL.......TTDYSCD..I..AMPRIKKRWTLES--lg..................................................................
F7AMT8_CALJA/47-190                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.---------...................-----....-------------.--.......-------..-..---------------hftl................................................................
E7QER7_YEASZ/15-219                  ..................................................KQLNNQSVSLVIPRLTRDKIHNS.MYYKVNLSNES.......................................Lrg....ntMVELLKVMIGA..FGTIKGqng.......hlhmMVLG.GIE...........................................--.--FKCILMKL.IEIR.PNFQ..........QLNF.LLNvk..........................................nenGFDSKYIIA............L....LLVY...A.....RLQYYylngn.............nkndddENDL....IKLF.Kvq.lyKYSQHYF.KLKSFPLQVdc...............faHSYNE....ELCIIHIDELVDW.LA.......TQDHIWG..I..PLGKCQWNKI-----ynsde...............................................................
A0A022XS47_TRISD/20-222              ................................................pl--IRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTYIGG..............-TYG.VGQ...........................................KP.TPFLCLAFKL.LQLA.PEKE..........VILE.YLNfhdpeadeedlkvrgdstd.........adggagdaqdradaailkaTGDFKYLRA............L....AAFY...I.....RLTFE........................PVEI....YKTL.E.....PLLTDYR.KLKRRTKEG...................-----....-FLLTYMDQFVDD.LL.......TKDRVCG..T..SLWKIPTRTILEDL-d...................................................................
E2B9R7_HARSA/37-220                  .................................................l-PLWGNERTMNLNPLILTNIQSS.HYFKVNLYELK.......................................T........YHEVIDEIYYK..VSHLEP..............WEKG.SRKtagqtgmcg.........................gvrgvgaggIV.STAYCLLYKL.FTLR.LTRK..........QLNG.LIN...............................................HPDSPYIRA............L....GFMY...I.....RYTQP........................PADL....FSWY.S.....DYLDDEE.---------...................ELDVKa..gGGQTMKMGDILKQ.FL.......TKLEWFS..T..LFPRIPVPIQKD---le..................................................................
W4IT64_PLAFP/11-175                  ...............................................knf----GSNPQYLISNIIRSKIYDS.PYWKEKCFALT.......................................S........-ESIIDQAIN-..LKYVGG..............-TYG.GNR...........................................KP.TRFLCLILKL.LQIQ.PDKD..........IIYE.YIK...............................................NEDFVYLRA............L....GIFY...L.....RLIGK........................SLEV....YNHL.E.....PILFDYR.KIRMRLQNG...................-----....TFEKIYMDVFVDN.CL.......ILNNFLD..V..DFPTLTKRQVLEEN-n...................................................................
B4NCI0_DROWI/51-235                  .................................................l-PFWGNETSMNLNPLILANIQSS.SYFKVHLFKLK.......................................T........YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg.........................gvrgvgaggIV.STAYCLLYKL.YTLR.LTRK..........QING.LLN...............................................HTDSAYIRA............L....GFMY...L.....RYTQP........................PGDL....YEWY.K.....DYLQDEE.---------...................EIDVKa..gGGQVLTMGQMVYQ.FM.......TKLDWFS..T..LFPRIPVPIQKQIE-k...................................................................
D4CZ38_TRIVH/20-222                  ................................................pl--IRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTYIGG..............-TYG.VGQ...........................................KP.TPFLCLAFKL.LQLA.PEKE..........VILE.YLNfhdpeadeedpnvkrdstd.........adggaedaqdkadaailkaTGDFKYLRA............L....AAFY...I.....RLTFE........................PVEI....YKTL.E.....PLLTDYR.KLKRRTKEG...................-----....-FLLTYMDQFVDD.LL.......TKDRVCG..T..SLWKIPTRTMLEDL-d...................................................................
N6TV19_DENPD/10-175                  ..................................................KSIHGTNPQYLVEKIIRSRIYDS.KYWKEECFALT.......................................A........-ELLVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IVVE.FIK...............................................NEEFKYVRA............L....GAFY...M.....RLTGS........................SLDS....YKYL.E.....PLYNDNR.KLRRQNRQA...................-----....QFELVHVDEFIDE.LL.......REERVCD..V..ILPRLQKRHILEEN-n...................................................................
B3SEX8_TRIAD/10-175                  ................................................vt--VKGTNPQYLVEKITRSRIYEC.KYWKEKCFAVT.......................................A........-ELLVDRAME-..LDHIGG..............-TFG.GNI...........................................KP.TPFLCLILKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDYKYVRA............L....GAIY...M.....RLVGT........................SNDC....YNYL.E.....PLYNDFR.KLKRKQRSG...................-----....QFQVIHMDEFVEE.LL.......TEDRACD..T..ILPRIQKRYILEQT-n...................................................................
S9X1J3_9CETA/10-175                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
E6X8B2_CELAD/97-274                  ......................................kaykevlyhsfi-----------------------.-----------.......................................-........-NKMEDDIITD..VQFHHY..............NIDN.FKT...........................................IL.NNSLGKYYKY.VVMG.FDHK..........QVAK.TLAkipnndlllidwninstpe.........nnyvfqdfgrsfykglesiTENFKKYKA............L....HFLY...P.....NYTNH........................AKET....VDYF.E.....KYCQDNN.----FEY--...................--QIK...tNPQEYTIEKGVAY.LS.......VSDRVLG..I..FLEQCRKQ-------nlep................................................................
E9C6I2_CAPO3/6-173                   .................................................l-ELWGNQQTMNLNLLLHQNILSA.RYYKEDLSELN.......................................T........YQELIDEIFNS..VSDLEP..............FMPG.GGT...........................................KA.SSAFCLLYKL.FVLR.LTEN..........QLTA.MLN...............................................HADSPFIRA............I....GFLY...L.....RYCTP........................PKDL....WDWF.E.....PYLEDQE.PIKLQWAAS...................-----....-AQPTTIGEFVRG.LL.......VDSKFLG..T..LLPRIPVPITKEIQ-a...................................................................
W3VHI3_9BASI/10-174                  .................................................v-SIHGTNPQFLIEKPVRARIYES.PFWKEHCFALS.......................................A........-ATLLPLAVD-..LHHVGG..............-LT-.GLQ...........................................RP.SHFLCLLQKL.LQIQ.PEPA..........IVDA.YLV...............................................AKEFKYLRV............L....AAFY...V.....RLTFA........................SSEI....YARL.E.....PMLEDYS.KLRWRDAGG...................-----....AYSVVHVDEVVDM.LL.......REERVCD..I..ILPRLTRRDVCETR-d...................................................................
C9ZID8_TRYB9/36-208                  ................................................wn--LKGRSAVAAFDPVTRHRILQS.QTMA-ACFHRP.......................................L........MATMEDLI-S-..VSYVGG..............-LSG.PLR...........................................KP.EPFICLIARV.LQIT.PNTA..........IVMA.MLR...............................................QDVHKYLRV............A....ALFI...I.....RLIGN........................GTAM....REAL.R.....IGWNDYR.KIRVYGSKD...................-----....-------------.--.......-------..-..---------------dctcetksrdgekadtnevegealvaapihaimcvdeitdrlfntg......................
V4T5N8_9ROSI/10-175                  ..................................................KSIRGTNPQNLVEKIVRSKIYQN.TYWKEQCFGLT.......................................A........-ETLVDKAME-..LDHLGG..............-TFG.GNR...........................................KP.TPFMCLVMKM.LQIQ.PEKD..........IVVE.FIK...............................................NDDYKYVRV............L....GAFY...L.....RLTGT........................DIDI....YRYL.E.....PLYNDYR.KLRQKSGDG...................-----....RFILTHVDEVIDE.LL.......TKDYSCD..I..ALPRIKKRWNLET--vg..................................................................
U3JST2_FICAL/1-134                   ...............................................laa-----------------------.-----------.......................................-........-ELVVDKAME-..LKYVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HEERVCD..I..ILPRLQKRYVLEEA-e...................................................................
D3B1N8_POLPA/3-164                   ..............................................levh-----GNKSMNLDQILLTNIQSS.QYFK-SLYNLK.......................................T........YHEVLSEINNH..VEYLCP..............YIP-.NTK...........................................TP.SSAYCLLFKL.YTMK.MTEN..........QMNG.IVT...............................................-HDSPFVRA............V....GFLY...L.....RYCFP........................PANL....WSWW.G.....EALGDQE.TIKVTPRSD...................-----....---PITVEELLIQ.LV.......REQRFAD..T..ILPRIPVKVMKEL--ed..................................................................
A0A022YNJ3_TRIRU/20-222              ................................................pl--IRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTYIGG..............-TYG.VGQ...........................................KP.TPFLCLAFKL.LQLA.PEKE..........VILE.YLNfhdpeadeedlkvrgdstd.........adggagdaqdradaailkaTGDFKYLRA............L....AAFY...I.....RLTFE........................PVEI....YKTL.E.....PLLTDYR.KLKRRTKEG...................-----....-FLLTYMDQFVDD.LL.......TKDRVCG..T..SLWKIPTRTILEDL-d...................................................................
G3TI91_LOXAF/47-231                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
T2MCG1_HYDVU/16-200                  .................................................l-PLWGNVQTMNINNLVVTNILSS.PYFKNELFKLK.......................................T........FHEVVDEIYYK..VDHLEP..............WEKG.SRKthgqvgmcg.........................gvrgvgaggIV.SSGYCLLFKL.FTLR.LTEK..........QVYV.LLN...............................................HTDSPYIRG............M....GFMF...I.....RYCQH........................PNTF....WDWF.E.....PYLEDEE.---------...................EIDPKa..gGGCSMTIGQLVRS.FL.......LKLDWYG..T..LFPRIPVPIHKEIE-a...................................................................
W7J6P1_PLAFA/173-335                 ...............................................lem----TNTTTYNVNTLLRNNILSS.EYFK-SLIPIK.......................................T........FKEVVDEIHSY..ADHVEP..............YCIG.SNR...........................................AP.STLFCCLYKF.FTMQ.LSEK..........QLKS.LIE...............................................NKDSCYIRA............C....GFLY...L.....RYVHS........................PANL....WMWF.E.....PYLLEED.---------...................EFSISc..dKRRKVTIGEYVQS.LL.......SDDKYFN..T..VLPRLPIKIK-----nvy.................................................................
G3VXQ4_SARHA/1-133                   ................................................sa-----------------------.-----------.......................................-........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
D8TND3_VOLCA/10-177                  ..................................................KTVHGTNPQNLVEYIVRQKIYQT.VFWKEKCFALT.......................................A........-ETMLEVAVN-..LKSVGG..............-TVG.GQR...........................................KP.SDFLCLLLKM.LQIQ.PDKE..........IVIE.YIK...............................................NEDFKYVRL............L....GAFY...M.....RLVGK........................PLEV....YQYL.E.....PLYNDYR.KATVRLQAV...................---EG....HFMLTHVDEVVDD.ML.......RKDFLFD..I..ALPRVPARLTLEK--lt..................................................................
B9SR85_RICCO/3-167                   ..............................................iqts----GKPIDSLLEKVLCMNILSS.DYFK-ELYRLK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HKDSPYIRA............I....GFLY...L.....RYAAD........................AKTL....WNWC.E.....PYIKDDE.---------...................EFSPG...sNGRNTTMGVYVRD.LL.......LGQYYFD..T..LFPRIPVPVMRQ---ivs.................................................................
M5XQR0_PRUPE/1-124                   .................................................m-----------------------.-----------.......................................-........---------E-..LDHIGG..............-TFG.GNR...........................................KP.TPFMCLVMKM.LQIQ.PEKE..........IVIE.FIK...............................................NDDYKYVRI............L....GAFY...L.....RLTGT........................DTDV....YQYL.E.....PLYNDYR.KLRRKLADG...................-----....NYALTHVDEVIDE.LL.......TKDYSCD..I..AMPRIKKRWTLEA--tg..................................................................
U5HBW6_USTV1/10-174                  .................................................l-SIHGTNPQYLIEKVIRARIYDS.LYWKEHCFALD.......................................A........-ATVIDEALK-..LQYLGG..............-TYA.NTR...........................................-P.TEFMCLTLKL.LQLQ.PERE..........IILE.YLR...............................................AEEFKYLRA............L....AAFY...V.....RLTFD........................PVNV....YEVL.E.....PLFDDYR.KLRTRGMDG...................-----....AYSITTIDEFCDQ.LL.......SEERVCE..I..QLPRLTQRRVLEET-e...................................................................
V5G3J8_BYSSN/20-207                  ................................................pl--IRGVNPATLFETAVRDRITDS.YYWKEQCFALN.......................................A........-ATLCDRAAE-..LTSIGG..............-TYG.VGQ...........................................KP.TPFLCLAFKM.LQLA.PDKE..........IVLE.YLNftdpgsdaegd........................taeeadngvvksRGDFKYLRA............L....AAFY...I.....RLTFD........................PVDI....YKSL.E.....PLLLDYR.KLRRRMRDG...................-----....-FVLTTIDQFVDD.LL.......TKDRVCA..T..SLWKIPSRQQLEDL-d...................................................................
I8IE99_ASPO3/20-209                  ................................................pl--VRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTSIGG..............-TYG.VSE...........................................KP.TPFLCLAFKM.LQLN.PDRD..........IVLE.YLNftdpvndeegeq......................taaeqaengvvkqRGDFKYLRA............L....AAFY...V.....RLTFD........................AVDV....YKTL.E.....PLLLDYR.KLKRRVRDS...................-----....-VVLTYVDQFVDD.LL.......TKDRVCG..T..SLWKLPSRQQLEDL-d...................................................................
D8SIA0_SELML/5-72                    ..........................................ehvllvnv-----------------------.-----------.......................................-........--LVVDEISNR..VDHLEG..............----.NFR...........................................GP.SPAFCLLFKL.FTMK.LTDE..........QIQG.LLN...............................................HADSPYVRA............V....RLL-...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------lf..................................................................
S8A531_DACHA/22-185                  ................................................pt--IHSMNPLLLMEKIIRERIIDS.MYWKEQAWGLN.......................................A........-ATLLDRAVD-..LQYIGG..............-QY-.ANQ...........................................KP.TAFICLVLKM.LQLN.PERE..........ILLE.YLQ...............................................DEDFKYLRA............L....AAFY...I.....RLAWP........................AAEV....YKTL.E.....PLMADYR.KLRLRTQAG...................-----....-FKLTFVDEFIDD.LL.......TKERVCD..I..ALPRMPTRAQLEDM-d...................................................................
G1QM59_NOMLE/48-232                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
M4DKE9_BRARP/10-175                  ..................................................KNIRGTNPQNLVETIVRKKIHDH.TFWKEQCFGLT.......................................A........-ETLVDKAME-..LDHVGG..............-TFG.GNR...........................................KP.TPFLCLVLKM.LQIQ.PEKE..........IVVE.FIK...............................................NDDYKYVRV............L....GAFY...L.....RLTGS........................DADV....YRYL.E.....PLYNDYR.KVRQKLADG...................-----....RFSLTHVDEVIEE.LL.......TKDYSCD..I..AMPRLKKRCTLEQN-g...................................................................
V9IBJ2_APICE/37-220                  .................................................l-PLWGNERTMNLNPLILTNIQSS.HYFKVNLYELK.......................................T........YHEVIDEIYYK..VSHLEP..............WEKG.SRKtagqtgmcg.........................gvrgvgaggIV.STAYCLLYKL.FTLR.LTRK..........QLNG.LIN...............................................HPDSPYIRA............L....GFMY...I.....RYTQP........................PADL....FNWY.S.....DYLEDEE.---------...................ELDVKa..gGGQVMKMGDILKQ.FL.......TKLEWFS..T..LFPRIPVPIQKN---ln..................................................................
W5AKT7_WHEAT/3-167                   ...............................................iqt---SGKPIDMLMEKVLCMNILSS.DYFK-ELYQMK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HPDSPYIRA............I....GFLY...L.....RYVAD........................PKIL....WTWY.E.....PYLKDDE.---------...................EFSPG...sNGRMTTMGVYVRD.LI.......LGQYYFD..S..ILPRVPVPVVR----qvtt................................................................
G7KFW5_MEDTR/3-166                   ............................................iqtsgr------PIESLLEKVLCMNILSS.DYFK-ELYRLK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HPDSPYIRA............V....GFLY...L.....RYYAD........................PKTL....WSWF.E.....PYAKDDE.---------...................EFSPG...sNGRMTTMGVYIRD.LL.......LGQYYFD..T..LFPRIPVPVM-----rqvv................................................................
R0K0D1_SETT2/23-218                  ................................................sl--IRGQNPALLFEKGVRERITES.YYWKEQCFGLN.......................................A........-ATLCDRAAE-..LKFIGG..............-TTG.ITG...........................................KP.TPFLCLAFKL.LQLV.PDKA..........IILE.YLNfrddededkqdadeq................ddedaakdtdlnaagkLGCFKYLRC............L....AAFY...I.....RLAWE........................PVEI....YKTL.E.....PLLTDYR.KIKRRLKDT...................-----....-FTLTHVDQFIDD.LL.......TRDRICA..T..SLWKLPSRAILEDL-d...................................................................
F4RZW6_MELLP/10-174                  .................................................l-SIHGTNPQFLIDKVVRSRIYDS.QYWKETCFALT.......................................A........-ESIIDCAIS-..LKYVGG..............-TYA.NVR...........................................-P.TEFMCLALKL.LQLQ.PEKE..........IILE.YLR...............................................AEEFKYLRA............L....AAFY...V.....RLTFT........................PLNV....YQTL.E.....PLLTDFR.KLRFRHMNG...................-----....SYSLVTFDDFVDS.LL.......VEERVFE..I..VLPRLTMRKV-----wkrlk...............................................................
Q4XAT0_PLACH/10-175                  ...............................................ikt---FGSNPQYLISNIIRNKIYDS.PYWKEKCFALT.......................................S........-ESIIDQAVS-..LKYVGG..............-TYG.GNR...........................................KP.TRFLCLVLKL.LQLQ.PDKD..........IIYE.FIK...............................................NEEFIYLRA............L....GIFY...L.....RLVGK........................GIEI....YKNI.E.....PILFDYR.KIRLRLQDG...................-----....SFQKIYMDVFADN.CL.......VFNNFLD..V..DFPALTKRIVLEEN-n...................................................................
C1FDQ5_MICSR/10-174                  .................................................r-NVRGTNPQNLLEAITRKKVYET.LYWKEKCFAVS.......................................A........-ESLVDLAMD-..LKTCGG..............-LCA.GKH...........................................KA.SEFLCLTLKL.LQIQ.PETE..........IVLE.FIT...............................................NENHKYIRL............L....GAFY...L.....RLVGK........................PVDV....YRYL.E.....PLLYDYR.RIRYKNSRG...................-----....VCEVKHVDELVND.LL.......CKDNFCD..V..VLPRIPRRPALE---ga..................................................................
B3MDH3_DROAN/10-175                  ..................................................KNVHGTNPQYLIEKIIRSRIYDS.KYWKEQCFALT.......................................A........-ELLVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TQFLCLTLKM.LQIQ.PEKD..........IVVE.FIK...............................................NEEFKYVRA............L....GAFY...L.....RLTGA........................ALDC....YKYL.E.....PLYIDNR.KLRRQNRAG...................-----....QFEIVYMDEYIDE.LL.......RNDRVCD..I..ILPRIQKRTILEEN-n...................................................................
A0A024UKU5_9STRA/9-173               .................................................i-SIHGVNPQHLVEKILRNRIYDC.MYWKEQCFGLT.......................................A........-ETLVDKAIE-..LTHIGG..............-HFG.GNQ...........................................QP.TPFLCLILKM.LQIQ.PDLE..........IVVE.FIK...............................................NGDYKYVTI............L....GAFY...L.....RLVGK........................PTEV....YPML.E.....ELLADYR.KIRKRNTLG...................-----....-WEMLHVDEVADI.LL.......KEEYFCD..I..ALPHLVDRYQLET--tn..................................................................
F2TEA8_AJEDA/20-214                  ................................................pl--IRGANPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTYIGG..............-TYG.LAQ...........................................KP.TPFLCLAFKL.LQLA.PEKD..........IVLE.YLNfhdpenerveggegn.................gleeeqdandgvvkaVGDFKYLRA............L....AAFY...I.....RLTFD........................AADI....YRTL.E.....PLLVDYR.KLKRRTKDG...................-----....-FMLTYIDQFVDD.LL.......TKDRVCG..T..SLWKLPSRTQLEDL-d...................................................................
A0A017SNM0_9EURO/20-202              ................................................pl--VRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAIE-..LSSIGG..............-TYG.VSE...........................................KP.TAFLCLAFKM.LQLN.PTRD..........IVLE.YLNfsdpgsdde.............................dqdnevlqnRGDFKYLRA............L....AAFY...V.....RLTFD........................AVDV....YKTL.E.....PLLLDYR.KIKRRVRDS...................-----....-FVLTYMDQFVDD.LL.......TKERMCG..T..SLWKLPSRQQLEDL-e...................................................................
W4GR42_9STRA/57-221                  .................................................l-PIHGNQTTYNFNTLLYDNVMNS.DYFR-KLYELA.......................................T........YHEVVDEIYYR..VDHAEP..............WAAG.TSR...........................................IP.STCFCLLMKF.CTMR.LTVN..........QMQG.LLK...............................................HVDSPFIRC............V....GFLY...L.....RYTCD........................PELL....WEWY.E.....PFLDDEE.---------...................EFNASs..nDAILTTMGAWIRS.LL.......EDLNYFN..T..ILPRIPKKIQ-----dgik................................................................
Q4WUN3_ASPFU/33-222                  ................................................pl--VRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTSIGG..............-TYG.VAE...........................................KP.TPFLCLAFKL.LQLN.PERE..........IILE.YLNytdpgsdeetea......................taeeqarngvlgqRGDFKYLRA............L....AAFY...V.....RLTFD........................PVDV....YKTL.E.....PLLLDYR.KLKRRVRDT...................-----....-FVLTYMDQFVDD.LL.......TKDRVCG..T..SLWKLPARQQLEDL-d...................................................................
Q4N1F1_THEPA/128-239                 ...............................................ipm----TNSVTYNMNDLLRSNILSS.EYYK-SL-SVK.......................................N........FYQVFDELVQF..ATHSEP..............YCST.ATR...........................................AP.STIFCCLYRF.LVLK.LTEK..........QMNF.LLE...............................................NVKSPYARC............C....GFLY...L.....RYVLP........................PDKL....WNCI.-.....-------.---------...................-----....-------------.--.......-------..-..---------------s...................................................................
C1LIZ4_SCHJA/10-175                  .................................................h-TVHGTNPQYLLEKIVRSRIYES.KFWKEHCFALT.......................................A........-ELLVDKAVE-..LRYVGG..............VFS-.GSV...........................................KP.TPFLCLTLKM.LQIQ.PDKD..........IVIE.FIK...............................................QEPYKYARA............L....GAFY...L.....RLVGD........................SVEI....YKYL.E.....TLYNDFR.RLKFQDKMG...................-----....NFSLVYMDDFIDQ.LL.......TEERVCD..V..ILPRLQKREVLEEL-n...................................................................
PR38A_BOVIN/10-175                   .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
L0B1D3_BABEQ/121-233                 ...............................................iqm----TNSTTYNLNNLLRNNILAS.EYYK-SLFSMQ.......................................T........FQDVVNELIQY..GTHAEP..............YCST.ATR...........................................AP.STLFCCLYKF.FTMK.LTEK..........QMYS.LLD...............................................NSKSPYPRC............C....GLLY...L.....RYVLP........................PDKL....WNC-.-.....-------.---------...................-----....-------------.--.......-------..-..---------------qc..................................................................
C1C1J0_9MAXI/10-175                  .................................................t-TIKGTNPQYLIEKVIRTRIYDS.KYWKEQCFALT.......................................A........-ELLVDKAME-..LRYIGG..............-TFA.GNI...........................................KP.TPFLCLVLKM.LQIQ.PEKD..........IVVE.FIK...............................................NEDFKYVRA............L....GAFY...L.....RLVGT........................SLDC....YKYL.E.....PLLNDYR.KIRFQDKQG...................-----....KFVLSHMDEFIDS.LL.......REERFCD..T..ILPRIQIRSILEE--th..................................................................
S4PMT8_9NEOP/22-206                  .................................................l-PIWGNEQTMNLNPLILANIQGS.SYFKVHLFKLK.......................................T........YHEVVDEIYYQ..VKHLEP..............WERG.SRKtagqtgmcg.........................gvrgvgaggIV.STAFCLLYKL.YTLR.LTRK..........QVNG.LLQ...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PADL....FDWY.A.....DYLDDEE.---------...................EVDPRa..gGGGPTTMGALVRQ.ML.......IKLDWFS..T..LFPRIPVPIQKQIE-q...................................................................
K9II45_DESRO/10-175                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
D8TKN7_VOLCA/1-167                   ................................................me--LYGSSTTYNLENVLRQNILGS.DYYRQTCTSLN.......................................N........WSDIVDEIYEN..VDHVEP..............WMSG.NAR...........................................GA.SSAFCLLHRL.FTLK.LNPK..........QIKD.MLD...............................................HRDSPYIRA............V....GFLY...L.....RYVAD........................PKTL....WSWC.G.....PYVKDQE.---------...................MLAPSg..pEQKEVTMGDYVRD.LL.......LSQYYFE..T..IFPRIPKPVQDV---ine.................................................................
B6TSE1_MAIZE/3-166                   ..............................................iqss----GRSIEGLMEKVLSVNILSS.DYFK-ELFKYK.......................................T........YHEVVDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.SSAFCLLYKL.FTMK.LTVK..........QMHG.LLK...............................................HQDSPYIRA............I....GFLY...L.....RYVAE........................PKTL....WTWY.E.....PYIKDDE.---------...................EFAPG...sNRKVTTMGVYVRD.LL.......LGQYYFD..S..LLPRVPLPI------lrqvt...............................................................
I1LB75_SOYBN/10-175                  ..................................................KSIRGTNPQNLVEKILRSKIYQN.TYWKEQCFGLT.......................................A........-ETLVDKAME-..LDHLGG..............-TYG.GNR...........................................KP.TPFMCLVMKM.LQIQ.PEKE..........IIIE.FIK...............................................NEDYKYVRI............L....GAFY...L.....RITGS........................DIDV....YRYL.E.....PLYNDYR.KLRRKLADG...................-----....QFALTHVDEVIDE.LL.......TKDYSCD..I..AMPRVKKRWTLES--lg..................................................................
A5DTV1_LODEL/38-215                  ...............................................dkr---TTTNKAHLVDTIIRHRILDS.IFYKQHLYLAN.......................................E........-ATILQVITKH..VHYIGG..............--VD.SMG...........................................RP.SPFIQCLFRL.LELN.PSKE..........IVHV.YLHq............................................leFNEFKYLLA............L....SLLF...V.....RLTYP........................SEEV....YSIF.D.....EFAQDYR.KLRYKMKVP...................DFDENklaiFYKIGYMDEFLDD.LL.......TKERVVD..L..LLPRLTLRNTLVE--qa..................................................................
A8IJK3_CHLRE/10-175                  ..................................................KTVHGTNPQNLVEYIVRQKIYQT.TYWKEKCFALT.......................................A........-ESLLEVAVQ-..LKSVGG..............-TFG.GQR...........................................KP.SDFLCLLLKM.LQIQ.PDKE..........IIIE.YIK...............................................NEDFKYVRL............L....GAFY...M.....RLVGK........................PLEV....YQYL.E.....PLYNDYR.KVRLQTLEG...................-----....AYALTHVDEVVDD.ML.......RKDFLFD..I..ALPRVPSRYTLEK--lg..................................................................
U6L8R2_EIMTE/10-174                  .................................................v-AVHGKNPQLLFSRIVRRKVYES.FFWKEECFAAT.......................................A........-ATVAELAAA-..LQYVGG..............-TFG.GIR...........................................AA.SPFLCLVLKL.LQLQ.PEKE..........IILE.FIK...............................................QEDFKYLRA............V....AAFY...L.....RLVGP........................SAEV....YVHL.E.....PLLADYR.KLRLRLRDG...................-----....SFRVSFMDEFVDQ.CL.......RNNSLFD..V..DFPPLVKR-------pvfvlq..............................................................
L2GTU9_VAVCU/4-152                   ...............................................yrl-----------FSNPIKEKIFKS.PYFK-EIRTYD.......................................L........-NQTITEAQQ-..LSSIGS..............LVYG.S--...........................................-P.HQFICLLQKL.ESLN.IGDS..........IILE.KYHe............................................alKGDNSSFVM............F....FVFY...I.....RMTVR.......................mKGDF....EEIR.R.....NLCSDES.LINIIDENN...................-----....EHYTITIKEMLNM.LK.......NDRYVLG..I..FM-------------knv.................................................................
I1NJ40_SOYBN/10-175                  ..................................................KSIRGTNPQNLVEKILRSKIYQN.TYWKEQCFGLT.......................................A........-ETLVDKAME-..LDHLGG..............-TYG.GNR...........................................KP.TPFMCLVMKM.LQIQ.PEKE..........IVIE.FIK...............................................NEDYKYVRI............L....GAFY...L.....RITGS........................DIDV....YRYL.E.....PLYNDYR.KLRRKLADG...................-----....QFTLTHVDEVIDE.LL.......TKDYSCD..I..ALPRVKKRWTLES--lg..................................................................
A0A023ZMV0_YEASX/15-219              ..................................................KQLNNQSVSLVIPRLTRDKIHNS.MYYKVNLSNES.......................................Lrg....ntMVELLKVMIGA..FGTIKGqng.......hlhmMVLG.GIE...........................................--.--FKCILMKL.IEIR.PNFQ..........QLNF.LLNvk..........................................nenGFDSKYIIA............L....LLVY...A.....RLQYYylngn.............nkndddENDL....IKLF.Kvq.lyKYSQHYF.KLKSFPLQVdc...............faHSYNE....ELCIIHIDELVDW.LA.......TQDHIWG..I..PLGKCQWNKI-----ynsde...............................................................
W1NQE5_AMBTC/3-166                   ..............................................iqts----GKPIDSLLEKVLCMNILSS.DYFK-ELYRLK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HPDSPYIRA............I....GFLY...L.....RYAAE........................PKTL....WGWF.E.....PYVKDEE.---------...................EFSPG...sNGRMTTMGVYVRD.LL.......LGQYYFD..T..LFPRTPVPIMR----qiv.................................................................
E9BHN7_LEIDB/271-441                 ...fdaelwgvleskltdelveqvrssgaapnggrlftafeqheqnvkav-----------------------.-----------.......................................-........----LRYCEQN..VRYAG-..............-VFD.DNE...........................................EA.SPFLLAMGLC.WRLG.LTMD..........DVCR.HFA...............................................RHPRRVVRA............L....ALYL...A.....RYTLA........................PEDY....VYFF.I.....PSLCDEV.IIACTEDAQ...................-----....--VTFSMKDLSRQ.LL.......TKNDVVD..A..WLPILSKHWQ-----edv.................................................................
M7U0A7_BOTF1/21-188                  ...............................................lap---NGLNPATILEKPVRERIVDC.YFWKDQCFALN.......................................E........-ADIVSRVVSH..VTFIAG..............-TYG.DSQ...........................................RP.SPFLCLAFKL.LQLG.PGDD..........ILKE.YMGy.............................................gGEKFKYLRA............L....ALFY...W.....RMTRQ........................AKDV....YTML.E.....GYLEDRR.KLRRKTRTG...................-----....-TTLTFMDQFVDD.LL.......TKDRVCG..T..TLWKMPKREILEDL-e...................................................................
F0WHG9_9STRA/10-174                  .................................................q-SIHGIHAQHLIEKIMRNRIYAS.LYWKEVCFGLT.......................................C........-ETLVDKAIA-..LDHFGG..............-TFG.GNQ...........................................KP.TPFLCLLLKM.LQLQ.PDLE..........VVTE.FIQ...............................................NEEYKYVTV............L....GMVY...L.....RLVGK........................SADI....YTLL.E.....PLYCDYR.KIRKRNVIG...................-----....-WEITHIDEIVDA.LL.......HEEYYID..L..TLPHLMNRYVMEQT-q...................................................................
B4ME55_DROVI/10-175                  ..................................................KNVHGTNPQYLIEKIIRSRIYDS.KYWKEQCFALT.......................................A........-ELLVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TQFLCLTLKM.LQIQ.PEKD..........IVVE.FIK...............................................NEEFKYVRA............L....GAFY...L.....RLTGA........................AIDC....YKYL.E.....PLYIDNR.KLRRQNRAG...................-----....QFEIVYMDEYIDE.LL.......RNDRVCD..I..ILPRIQKRSILEEN-n...................................................................
Q0CIC3_ASPTN/20-209                  ................................................pl--VRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAAE-..LTALGG..............-TYG.VAE...........................................KP.TPFLCLAFKL.LQLN.PERE..........IILE.YLNftdpgsddedeq......................taeeqaqngvvkqRGDFKYLRA............L....AAFY...V.....RLTFD........................AVDV....YKTL.E.....PLLLDYR.KLRRRVRDS...................-----....-VVLTYMDQFVDD.LL.......TKDRVCG..T..SLWKLPPRQQLEDL-d...................................................................
D8T1B4_SELML/10-168                  ..................................................KSVHGTNPQNLVEKILREKIHQS.SFWKEQCFALT.......................................A........-ETLVDKAME-..LDHIGG..............-TYG.GNR...........................................KA.TPFMCLTLKM.LQIQ.PEKE..........IVVE.FIK...............................................NQDYKYVRV............L....GAFY...L.....RLVGK........................ATDV....YQYL.E.....PLYNDYR.KIRQRSADG...................-----....SFFLSHVDEFIDQ.LL.......TTDYCCD..I..TLPRVPKR-------....................................................................
A5DGC7_PICGU/7-183                   ..............................................dkrh----VLNGAKLVEHIVRHRIHDS.LFYKQHLYLTN.......................................E........-QTILPVIVDN..VTYIGG..............--TD.ANG...........................................RP.SPFICCLLRL.LEVE.PEER..........ILAM.YETq............................................lgYNRFKYLTC............L....VMIY...Y.....RLTKT........................GAEI....YKRL.E.....PYYKDYR.KVRLQLKVP...................EFENGs.arHYKVYTIDQWADD.LL.......QHERVVD..I..ILPRILPRHILMQ--rg..................................................................
W0VPU5_ZYGBA/14-209                  ..................................................KQLNHQSVSLVIPRIARDRIHNA.MYYRVNLNTVS.......................................Lrg....dtMECLSKVIVRD..LGSLADgtf........qqvHVLG.GIE...........................................--.--FHCLLMKL.IEIR.PTWD..........QLEV.MLQed...........................................daGFNNKYIVG............L....TLAY...I.....RIQYYflqv................edslAQRF....RALF.K.....HYYNDYR.KMKSVLFDQdc...............wsKSQTV....SVNILHMDELVEW.LL.......EREEIWG..I..PLGRCQWKELEE---sss.................................................................
U6KXF4_EIMTE/120-282                 ...............................................vqm----TDSTTYNVNQLLRGNIMSS.EYFK-SLHQFK.......................................S........FNEVVDELAAF..ADHAEP..............YCSG.STR...........................................AP.STLFCCLYKL.FTLK.LTEK..........QMHM.LLN...............................................HRESPYVRC............T....GFLY...L.....RYVHP........................ADQL....WKWY.E.....PYFLDDE.---------...................QFTPGa..dPNRVISMGEYVQS.LL.......TEDKYFS..T..VLPRLPVLV------knvy................................................................
E0VES7_PEDHC/10-175                  ..................................................KSVRGSNPQYLIEKIIRARIYDS.KYWKEECFALS.......................................A........-ELLVDKAME-..LKYVGG..............-VFG.GNI...........................................KP.TPFLCLILKM.LQIQ.PEKD..........IIVE.FIK...............................................NEEFKYVRA............L....GAFY...M.....RLVGN........................PLEC....YKYL.E.....PLLIDCR.KLRKQNRQG...................-----....HFELLHMDEFVDD.LL.......REERMFD..I..ILPRIQKRHVLEEN-n...................................................................
J9NZD6_CANFA/48-232                  .................................................l-PLWGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKNID-q...................................................................
I1RQR3_GIBZE/25-192                  ...............................................vap---NGLNPATIMEKAVRDRIVDS.IYYKMQCFACN.......................................E........-ADIVDRVVED..VKFIGG..............-TYG.TTQ...........................................VP.SPFLCLAFKL.LELS.PSDA..........VLLE.YLKf.............................................gGEAFKYLRA............L....ACFY...F.....RLTRQ........................AKNV....YEML.E.....PFLEDRR.KLRRRGREG...................-----....-VKLSYMDEFVDD.LL.......TKERVCG..T..SLWKMPKREVLEDL-e...................................................................
V9ES07_PHYPR/9-173                   .................................................q-SVHGVNPQTLVEKIMRNRIYAS.IYWKEQCFGLT.......................................A........-ETLVDKAVE-..LQEFGG..............-TFG.GNQ...........................................QP.THFLCLLLKM.LQLQ.PELE..........VVKQ.FIE...............................................NEDYKYVTV............L....GAVY...L.....RLVGK........................PLEV....YTLL.E.....PLLSDYR.KIRKRNVIG...................-----....-WEITHVDEIADA.LL.......HEEYYID..L..ALPRLADRELLEKN-e...................................................................
A7RN21_NEMVE/18-202                  .................................................l-PLWGSERTMNMNNMILTNILQS.PYFKNELYQLK.......................................T........YHEVVDEIYYK..VDHLEP..............WEKG.SRKtsgqvgmcg.........................gvrgvgaggIV.STAYCLLYKL.FTLR.LTRK..........QLNG.LLT...............................................HTDSPYIRA............L....GFMY...I.....RYCQP........................PADL....WEWY.E.....PYLEDEE.---------...................EVDPKa..gTGCTMTMGQLVRS.FL.......LKLEWYG..T..LFPRIPVPIQKD---lek.................................................................
Q4SZ28_TETNG/10-175                  .................................................n-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LKFVGG..............-VFG.GNI...........................................KP.TPFICLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRL............L....GAMY...M.....RLTGT........................AVDC....YKYL.E.....PLYNDYR.KVKTQNRNG...................-----....EFELMHVDEFIDQ.LL.......HSERICD..I..ILPRLQKRHVLEET-e...................................................................
W7KEH1_PLAFO/11-168                  ...............................................knf----GSNPQYLISNIIRSKIYDS.PYWKEKCFALT.......................................S........--------IN-..LKYVGG..............-TYG.GNR...........................................KP.TRFLCLILKL.LQIQ.PDKD..........IIYE.YIK...............................................NEDFVYLRA............L....GIFY...L.....RLIGK........................SLEV....YNHL.E.....PILFDYR.KIRMRLQNG...................-----....TFEKIYMDVFVDN.CL.......ILNNFLD..V..DFPTLTKRQVLEEN-n...................................................................
Q5KIE6_CRYNJ/9-170                   .................................................t-AVHGSNPQYLIEKVIRARIYDS.LYWKEHCFALT.......................................A........-ESIIDKAID-..LRAIGG..............-VT-.DRQ...........................................TP.TPFICLVLKL.LQLQ.PEKE..........ILIE.YLL...............................................AEEFKYLRA............L....AAFY...V.....RLTFR........................SLEV....YEIL.E.....PLMKDYR.KLRVVHAGG...................-----....-YSLTHFDEFIDE.LL.......TQERVCD..I..ILPRRIK--------slneka..............................................................
A8X281_CAEBR/57-204                  .................................................l-PIWGNQVTMNLNTLVLENIRES.YYYKNNLVEID.......................................S........FQTLVEQIFYQ..VKHLEP..............WEKG.TRRlqgmtgmcg.........................gvrgvgaggVV.SSAYCLLYRL.FNLR.ITRK..........QLIS.MLN...............................................SRQSVYIRG............I....GFMY...I.....RYTQP........................PADL....WYWL.E.....PYLDDDS.E--------...................-----....-------------.--.......-------..-..---------------idprsgg.............................................................
H3DCW8_TETNG/25-209                  .................................................l-PLWGNEKTMNLNPMILTNVLSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QLMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PPDL....LEWY.D.....GFLDDDE.---------...................ELDVKa..gGGCVMTVGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKSID-q...................................................................
G1S8M8_NOMLE/1-148                   ..................................................------------------RIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
A9TDL8_PHYPA/6-170                   ............................................vqtcgk------PLDTLIERVLCTNILSS.DYFK-ELFSLK.......................................T........YLEIVDEIYNH..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKL.FTMK.FTVK..........QMQD.ILD...............................................HPDSPYIRA............L....GFLY...L.....RYVGD........................PKTL....WDWF.E.....PYVEDTE.---------...................EFSPG...sNGKMTTMGVYVRD.II.......LNQYYFD..T..LFPRIPVPILR----qita................................................................
Q59WJ8_CANAL/17-194                  ..............................................dkry----TINKSNLIEPIIRHRIQDS.LFYKQHLYLSN.......................................E........-ATILPIIIEH..VHYIGG..............--TD.SSN...........................................RP.STFISCLFRL.LELE.PSKE..........IIKT.YLTq............................................ldFNEFKYLTA............L....TLIY...I.....RLTYP........................SQEV....YSIF.D.....QYFQDFR.KLRIKLKTP...................VFDSQklpiHYKITFIDEWVDT.LL.......VNERVID..L..MLPRLIPRTTLVE--rg..................................................................
G5DX07_SILLA/4-168                   ..............................................lqts----GKPIDSLVEKVLCMNILSS.DYFR-DLFRLK.......................................T........YHEVVDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HPDSPYIRA............I....GFLY...L.....RYAGD........................AKTL....WNWF.E.....PYVNDDE.---------...................EFSPG...sNGKMTTMGVYVRD.LL.......LGQYYFD..T..LFPRVPVPVLR----qits................................................................
L7JCZ4_MAGOP/23-190                  ...............................................lap---NGLNRARIMEKAVVDRITES.YFWKEQCFGVN.......................................E........-ADIVDRVVDH..VTYIGG..............-VVG.QSQ...........................................KP.TPFLCLAFKL.LQLG.PDDS..........ILAE.YLKf.............................................gGEKFKYLRA............L....AIFY...V.....RLTRT........................SADV....FRTL.E.....PFLEDRR.KLRRKGRAG...................-----....-TSLTYMDEFADD.LL.......TKDRVCA..T..SLFKLTRRDVLEDL-d...................................................................
E5A0N9_LEPMJ/24-234                  ................................................al--IRGQNPALLFEKGVRERITES.YYWKEQCFGLN.......................................A........-ATLCDRAAE-..LKFIGG..............-ITG.ITG...........................................KP.TPFLCLAFKL.LQLV.PEKA..........IILE.YLNfrsddgeedeatngqnghangee.eegnvdegdkqvhkpqdlnaagkLGDFKYLRC............L....AAFY...I.....RLAWQ........................PVEI....YKTL.E.....PLLTDYR.KIKRRLKDG...................-----....-YTLTYIDQFIDD.LL.......TKDRICA..T..SLWKLPSRANLEDL-d...................................................................
S7MJI8_MYOBR/1-34                    ..................................................-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....----...-.....-----........................----....----.-.....-------.---------...................-----....----MHVDEFIDE.LL.......HSERVCD..I..ILPWLQKRYVLEEA-e...................................................................
C0PU75_SALSA/1-45                    .............................................eldvk-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.----------.----.----..........----.---...............................................---------............-....----...-.....-----........................----....----.-.....-------.---------...................---AG....GGCVMTIGEMVRS.FL.......TKLEWFS..T..LFPRIPVPVQKMI--dt..................................................................
F6HI04_VITVI/3-166                   ..............................................iqts----GKPIDSLLEKVLCMNILSS.DYFK-ELYRLK.......................................T........YHEVVDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HPDSPYIRA............V....GFLY...L.....RYAGD........................PKTL....WNWF.E.....PYVKDEE.---------...................EFSPG...sTGRMTTMGAYVRD.LL.......LGQYYFD..T..LFPRIPVPIMR----qiv.................................................................
A0A059LRU5_9CHLO/10-175              .................................................a-SVHGTNPQNLIEYIVRQKVYDS.LYWKQECFGLT.......................................A........-EGVVAKAAE-..LKYVGG..............-MHG.QPQ...........................................KP.SEFLCLALKL.LQIA.PERG..........VVLE.FVR...............................................NEDFKYLRL............L....GAFY...L.....RLVAR........................PAEI....YATL.E.....PLLLDSR.RVRRRDLAG...................-----....RFSLWHVDEAVDA.LL.......SKERVYD..V..ALPRLTPRHVLEE--tg..................................................................
A0A059J1T7_9EURO/20-222              ................................................pl--IRGVNPATLFEKAVRDRITDS.YYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTYIGG..............-TYG.VGQ...........................................KP.TPFLCLAFKL.LQLA.PEKE..........VILE.YLNfhdpeadeedsntrgdsad.........adggaddaqdradaailkaTGDFKYLRA............L....AAFY...I.....RLTFE........................PVEI....YKTL.E.....PLLTDYR.KLKRRTKEG...................-----....-FLLTYMDQFVDD.LL.......TKDRVCG..T..SLWKIPTRTMLEDL-d...................................................................
U5CUR3_AMBTC/1-70                    ..................................................-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.----------.----.----..........----.---...............................................-----YVRI............L....GAFY...L.....RLVGK........................PTDV....YQYL.E.....PLYNDYR.KLRRKSADG...................-----....SFVLIRVDEFIDE.LL.......TKEHSCD..I..ALPRVPK--------....................................................................
G3BAA6_CANTC/7-180                   ..........................................dkrrvsgy--------AHILETIVRNRIKDS.LFYKQHLYLTN.......................................E........-QTILQVIVDN..VKYVGG..............--LD.SSN...........................................RP.SPFLCCLLRL.LEIG.PSAA..........VVGL.YLK...............................................QPEFKYLTI............L....TLIY...I.....RLTQP........................PTEV....YQVL.D.....TYRSNYT.KVRVLLSSP...................EMVDGv.pvNYGIIHIDEFVDE.LE.......RSDRVVG..V..VMPRLESRRRLV---arg.................................................................
D5GP15_TUBMM/20-183                  .................................................q-TFHGVNPLLLVEKIIRERIFES.LYWKEQAFGLN.......................................A........-ATLLDRAVE-..LTYIGG..............-QY-.SNQ...........................................RP.TPFLCLTFKL.LQLQ.PSRE..........IILV.YLN...............................................DPDFKYLRS............L....AAFY...I.....RLTWS........................AVDI....YRTL.E.....PLMGDYR.KLRVRGMGG...................-----....-WRMTYVDEFIDE.LL.......TKERVCD..I..ALPHIKTRAMLEDA-d...................................................................
J7RRK2_KAZNA/15-210                  ..................................................KQLNHQSVSLVIPRLTRDKVHHV.LYYKVNLEVGS.......................................Lrg....dtMLQLSKVLIRD..LGTIKAntl........nqtHILG.G--...........................................--.VEFKCLLMKL.VEIR.PTRE..........QLVY.ILEtq...........................................nkTFDDKYIVA............L....ILTY...I.....RIQYFyvtl................hdelARKW....RELF.K.....TYMKDFR.KLKAVDFEQdc...............wsQSQKI....NVKVTHLDELIDW.LV.......TETQIWG..I..PLGMCQWCNIY----ndsd................................................................
M1KAQ1_ENCCN/2-164                   ..............................................qykg-----------INRMTREKILGS.EEFK-RMRSFT.......................................H........-ADVIQSICS-..LDSIGG..............LIRG.---...........................................TP.HKFLCLVQKM.GATS.LSED..........AVAV.DLAnlkplepk...............................plgspaemFHGNVYFIA............A....SLFY...L.....RLSKR........................FHKY....RPLI.G.....LFLADFR.KIPVVDGQN...................-----....NRTFMYLDVLADD.LL.......NKSRIFN..V..HLSR-----------ad..................................................................
S8ESL2_FOMPI/10-173                  .................................................e-AIHGQNPQYLVETVIRNRIYES.PYWKEHCFALT.......................................A........-ETLIDKSIE-..LKCIGG..............-VYG.-NQ...........................................KP.TEFLCLLLKL.LQLQ.PQKE..........ILLE.YLQ...............................................ADEFKYLRA............L....AIMY...I.....RMTFR........................SVEV....YEIL.E.....PLLKDYR.KIRYRGMNG...................-----....-YSLTYIDEFVDN.LL.......VEERVCD..I..ILPRLTKRDVLEDN-g...................................................................
A9UQL8_MONBE/10-172                  ................................................gt--VHGANPQFLVEKIIRTRIYDT.LYWKEHCFALT.......................................A........-ETVIDKAVQ-..LDHIGG..............-VYG.GSI...........................................KP.TPFLCLTLKL.LQLA.PDKD..........IIYA.YIA...............................................AKDFKYLQA............L....GVFY...L.....RLVGT........................AKEC....YSYL.E.....PFLEDFR.KLRHMKRDG...................-----....QYELMHMDEFVDQ.LL.......REDRVCD..I..ILPRLMVRMQ-----pt..................................................................
A0A024VK41_PLAFA/10-82               ..............................................iknf----GSNPQYLISNIIRSKIYDS.PYWKEKCFALT.......................................S........-ESIIDQAIN-..LKYVGG..............-TYG.GNR...........................................KP.TRFLCLIY--.----.----..........----.---...............................................---------............-....----...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------iyiyiym.............................................................
J4DQ33_THEOR/128-289                 ..............................................qlpm----TNSMTYNMNDLLRNNILTS.EYYK-SL-SVK.......................................T........FYDVVNELVQF..GSHCEP..............YCST.STR...........................................AP.STMFCCLYKF.FTLK.LTEK..........QMVT.LLD...............................................HNKSPYPRC............C....GFLY...L.....RYVLP........................PDKL....WSWY.E.....PYFLDEE.---------...................EFTVSs..dGNKKTTVGEFAES.LI.......MDDKYYN..T..VLPRLPVRVK-----nl..................................................................
I3LP32_PIG/10-97                     .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFK----............-....----...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------....................................................................
A0A059LNV7_9CHLO/42-209              ...............................................leq---YGNSSTFNFENVIRQNVLIS.SYYHKSAAVLD.......................................N........WQALVDEIYYS..VDNVEP..............WMSG.NAR...........................................GP.TTAFNLLYRL.CQLR.PTHG..........EIRM.MLD...............................................HKDSPYIRA............I....GFLY...L.....RYVCN........................PRQL....WQWM.Q.....PYIEDSE.---------...................EFSPSp.egLGKTVSMGDFVRD.IL.......LDQYYFE..T..IFPRIPKAVEDEI--ka..................................................................
M2SAU0_ENTHI/7-169                   .................................................l-PTQGNTRTMNIDSILFTNITHS.DYMFKTLGSIH.......................................S........ISDLIDIIIND..VHYISP..............YIQK.SSS...........................................SP.STAFCVLLRL.FQLN.PTPD..........DIRM.MST...............................................H-SNKYVRC............I....AALI...I.....RYSIQ........................FNLL....LSYL.K.....PFVDDRA.-VVNISLHG...................-----....-EKTKQIKCLVKD.LI.......LEPKFEG..C..ILPRIPQ--------vyykp...............................................................
M0X6G8_HORVD/3-153                   ...............................................iqt---SGKPIDMLMEKVLCMNILSS.DYFK-ELYRMK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HPDSPYIRA............I....GFLY...L.....RYVAD........................PKIL....WTWY.E.....PYLKDDE.---------...................EFSPG...sNGRMTTMGVFVRD.LI.......LGQKLCQ..-..---------------la..................................................................
S7PSV6_MYOBR/10-175                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
W5P5R7_SHEEP/10-175                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
Q69K06_ORYSJ/10-175                  ..................................................KSIHGTNPQNLVEKIVRSKIYQS.TYWKEQCFGLT.......................................A........-ETLVDKAME-..LDHTGG..............-TYG.GNR...........................................KP.TPFLCLALKM.LQIQ.PDKD..........IVVE.FIK...............................................NEDYKYVRV............L....GAFY...L.....RLTAT........................VADV....YQYL.E.....PLYNDYR.KIRHKLSDG...................-----....KFTLTHVDEFIDD.LL.......TKDYSCD..T..ALPRIQKRWVLET--sg..................................................................
Q8IM21_PLAF7/173-335                 ...............................................lem----TNTTTYNVNTLLRNNILSS.EYFK-SLIPIK.......................................T........FKEVVDEIHSY..ADHVEP..............YCIG.SNR...........................................AP.STLFCCLYKF.FTMQ.LSEK..........QLKS.LIE...............................................NKDSCYIRA............C....GFLY...L.....RYVHS........................PANL....WMWF.E.....PYLLEED.---------...................EFSISc..dKRRKVTIGEYVQS.LL.......SDDKYFN..T..VLPRLPIKIK-----nvy.................................................................
D7FPC2_ECTSI/52-172                  .................................................l-PIHGNDRTFNLNTLLAQTILAS.EYFK-SLAGITtylegvkivglaagdc......htmtydvsgkaygwgsyR........-EKVVDEIYSY..CDHVAP..............WAPG.TSR...........................................VP.SSAFCLLMKL.FVIK.LTRP..........QMNE.ILV...............................................HEE------............-....----...-.....-----........................----....----.-.....-------.---------...................-----....-------------.--.......-------..-..---------------l...................................................................
C4JLP1_UNCRE/20-208                  ................................................pl--IRGVNPATLFEKAVRDRITDS.YYWKEQCFALN.......................................A........-ATLCDRAVE-..LSYIGG..............-TYG.ANQ...........................................KP.TPFLCLAFKL.LQLA.PEKE..........VVLE.YLNfhdpaaddddvd.......................eeggdgaavlkaVGDFKYLRA............L....AAFY...I.....RLTFD........................PVEA....YTVL.E.....PLLSDYR.KLKRRTKDG...................-----....-FVLTYMDQFVDD.LL.......TKDRVCG..T..SLWKLPARRVLEDL-d...................................................................
B4IGQ6_DROSE/1-166                   ..................................................-----------------------.----------K.......................................T........YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg.........................gvrgvgaggIV.STAYCLLYKL.YTLR.LTRK..........QING.LLN...............................................HTDSAYIRA............L....VVAF...A.....RRGPSislhlpa..........klrytqpPSDL....YDWY.E.....DYLQDEE.---------...................EIDVKa..gGGQVLTIGQMVYQ.FM.......TKLDWFS..T..LFPRIPVPIQKQIE-k...................................................................
F0WLM7_9STRA/1-110                   ..................................................-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.----------.--MR.LTMR..........QMQG.LLK...............................................HTDSPYIRV............V....GFLY...I.....RYACD........................PEKL....WSWF.E.....PYLDDPE.EFNASANVNlqty..........etlfsK--SEr.lpLVFCSTIGAWLKS.IL.......EENNYFG..T..ILPRIPKKIQD----sik.................................................................
A8BAJ9_GIAIC/1-144                   ..................................................-----------MEHATRRAILNS.PLYLMEFKHLG.......................................V........IGLLKDVLVT-..-RNIDL..............-EYG.--Q...........................................EP.SRLLCSLVRL.YMLR.PDRS..........IVHE.ILS...............................................ARGFAYATA............F....AAIH...V.....RSYWS........................SLDI....HKAL.T.....PLLNNYT.KIRVSGLKT...................---LG....LQGHVPLDVFVEA.LL.......HQPSTLS..-..---------------tcsgt...............................................................
G3AGB8_SPAPN/17-194                  ...............................................dkr---NVLNKAYLIEPIIRHRIQDS.IFYKQHLYLTN.......................................E........-ATILPIIVEH..VKYVSG..............--TD.SSG...........................................RP.SPFICCLLRM.LELE.PSKD..........MIDT.YLTq............................................lgFNEFKYLTA............L....ALIY...V.....RLVYS........................SDVV....YKTF.D.....PYFQDAR.KLRVKLKSPi................fnEVKLP...iGYSLTYIDAWVDE.LL.......TRERVVD..I..ILPRLVPRIKF----vesg................................................................
I1GG42_AMPQE/33-217                  .................................................l-PLFGNKETMNINNMIITNILQS.RYFKIELYEKK.......................................T........FHEVVDEIFYR..VEHLEP..............WEKN.SRKlsgqvgmca.........................gvrgvaaggIV.STPFCLLYKL.FTLK.LTRK..........QVKV.MLN...............................................HVDSPYIRG............L....GFMY...I.....RYCQP........................PNNF....LDWF.S.....PYLEDEE.---------...................EIDLKa..gGGYPVTIGVMCHM.ML.......TKMEWFG..T..MFPRISVNVQKDIH-d...................................................................
I1EKT3_AMPQE/1-78                    ..................................................-----------------------.-----------.......................................-........-----------..------..............----.---...........................................--.----------.----.----..........----.---...............................................-----YVRA............L....GALY...L.....RIVGT........................SVEC....YKYL.E.....PLYNDYR.KIKYKNRQG...................-----....KFELSHVDEFVDS.LL.......REDRVCD..V..ILPRIQKRHILEET-e...................................................................
A0DJV2_PARTE/10-175                  ............................................hlandg------RQMTLIDQIIRNKVFNC.RYWKEDCFGLT.......................................A........-VTLVDKACK-..LDCVGA..............-TYS.GTG...........................................KP.VPFLCLLMKL.LQIN.PDKE..........IIIE.FLK...............................................SKDYKYISA............L....AMFY...I.....RLTSK........................PKEA....YPTI.E.....QFYADFR.KIRIRNLDG...................-----....TFAIWHMDELAEK.LL.......SEEIIFG..I..SLPRFQKRWILEE--lg..................................................................
G1N3A5_MELGA/1-182                   ..................................................---WGNEKTMNLNPMILTNILSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QVMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PTDL....WDWF.E.....SFLDDEE.-----DLDV...................--KAG....GGCVMTIGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKTID-q...................................................................
H2TYE2_TAKRU/22-164                  .................................................l-PLWGNEKTMNLNPMILTNVLSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QLMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PPDL....LEWY.D.....GFLDDDE.---------...................-----....-------------.--.......-------..-..---------------iyt.................................................................
R1EUR9_EMIHU/44-217                  .............................................dpvhg------APAFNINPMLLEGIRMGdRFWE--LAKLT.......................................T........FGEVVDAIFYE..VKYVTP..............WVPG.THGkrssgmqs..........................avrgvsnagTP.GIAYTMLLKL.FLLR.LTRD..........QVRS.LLR...............................................HPDSPYIRA............I....GFLY...L.....RLGLY.......................dFKEL....WAWF.Q.....PYLGDDD.QF-------...................FIDGT....PATATTIGE----.--.......-------..-..---------------fdffgdrlprlpvlvsrqie................................................
B4KQL3_DROMO/10-175                  ..................................................KNVHGTNPQYLIEKIIRSRIYDS.KYWKEQCFALT.......................................A........-ELLVDKAME-..LRFIGG..............-VYG.GNI...........................................KP.TQFLCLTLKM.LQIQ.PEKD..........IVVE.FIK...............................................NEEFKYVRA............L....GAFY...L.....RLTGA........................AIDC....YKYL.E.....PLYIDNR.KLRRQNRAG...................-----....QFEIVYMDEYIDE.LL.......RNDRVCD..I..ILPRIQKRSILEEN-n...................................................................
C4M949_ENTHI/7-169                   .................................................l-PTQGNTRTMNIDSILFTNITHS.DYMFKTLGSIH.......................................S........ISDLIDIIIND..VHYISP..............YIQK.SSS...........................................SP.STAFCVLLRL.FQLN.PTPD..........DIRM.MST...............................................H-SNKYVRC............I....AALI...I.....RYSIQ........................FNLL....LSYL.K.....PFVDDRA.-VVNISLHG...................-----....-EKTKQIKCLVKD.LI.......LEPKFEG..C..ILPRIPQ--------vyykp...............................................................
Q4RV73_TETNG/22-206                  .................................................l-PLWGNEKTMNLNPMILTNVLSS.PYFKVQLYELK.......................................T........YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg.........................gvrgvgtggIV.STAFCLLYKL.FTLK.LTRK..........QLMG.LIT...............................................HTDSPYIRA............L....GFMY...I.....RYTQP........................PPDL....LEWY.D.....GFLDDDE.---------...................ELDVKa..gGGCVMTVGEMLRS.FL.......TKLEWFS..T..LFPRIPVPVQKSID-q...................................................................
I1JHT5_SOYBN/4-166                   ..........................................qtcgrpid---------SLLEKVLCMNILSS.DYFK-ELYRLK.......................................T........YHEVIDEIYNQ..VDHVEP..............WMTG.NCR...........................................GP.STAFCLLYKF.FTMK.LTVK..........QMHG.LLK...............................................HLDSPYIRA............V....GFLY...L.....RYCAD........................PKTL....WNWF.E.....PYVKDDE.---------...................EFSPG...sNGRMTTMGVYVRD.LL.......LGQYYFD..T..LFPRIPVPV------lrqvv...............................................................
D3TRD8_GLOMM/10-175                  ..................................................KNIHGTNPQYLVEKIIRSRIYDS.KYWKEQCFALT.......................................A........-ELLVDKAME-..LRFIGG..............-VYG.GNI...........................................KP.TQFLCLTLKM.LQIQ.PEKD..........IVVE.FIK...............................................NEEFKYVRA............L....GAFY...L.....RLTGS........................ALDC....YKYL.E.....PLYIDNR.KLRRQNRVG...................-----....HFEIVYMDEFIDE.LL.......RSDRVCD..I..ILPRIQKRSILEEN-n...................................................................
J4C3Z9_THEOR/10-175                  .................................................h-LIHGTNPQFLFSKILRDKVYNS.FYWKESCFGLT.......................................A........-ESLIDKAVQ-..LKYVGG..............-TFG.GNR...........................................QP.SPFLCLVLKM.LQIQ.PDME..........IVHE.YIK...............................................NEDFKYLRA............L....GVYY...M.....RLVGG........................AAEV....YGTL.E.....PILGDYR.KLRFRNTDG...................-----....SYSIKYMDEFVDE.CL.......TSSTYLD..V..DFPPLAKRMSLEA--tr..................................................................
L5K6N9_PTEAL/10-175                  .................................................h-SIHGTNPQYLVEKIIRTRIYES.KYWKEECFGLT.......................................A........-ELVVDKAME-..LRFVGG..............-VYG.GNI...........................................KP.TPFLCLTLKM.LQIQ.PEKD..........IIVE.FIK...............................................NEDFKYVRM............L....GALY...M.....RLTGT........................AIDC....YKYL.E.....PLYNDYR.KIKSQNRNG...................-----....EFELMHVDEFIDE.LL.......HSERVCD..I..ILPRLQKRYVLEEA-e...................................................................
D0NNV1_PHYIT/37-201                  .................................................l-PIYGNDTTYNLNTLLHQNILQS.AYFH-DLYKFR.......................................T........YHEVVDEIYYR..VDHAEP..............WSPG.TAR...........................................IP.SSCFCLLHKF.FLMR.LTRK..........QMQG.LLR...............................................HSDSPYIRV............V....GFLY...L.....RFTCD........................PEEL....WTWF.E.....PYLEDSE.---------...................EFNASa..nPSLKTTIGEWLIS.LL.......EENNYFG..T..ILPRIPKKIE-----dgik................................................................
A7ARD6_BABBO/10-175                  ................................................vm--VHGTNPQNLFSKILRDKVYNS.MYWKESCFGLT.......................................A........-ESIIDKAID-..LQYIGG..............-TFG.GNR...........................................QP.SPFLCLVLKL.LQIQ.PEIE..........IIQE.YIR...............................................NEEFKYLRA............L....GIYY...M.....RLVGN........................AVQI....YQNL.E.....PVYADYR.KLRFRNNDG...................-----....SYDIRHMDEFVDD.CL.......RLSSYLD..V..DLPILPKRMILEET-k...................................................................
G0QNS3_ICHMG/118-285                 .................................................f-QIWGDETSGNINPKLRTNIMNC.SYFRIDLFSLK.......................................T........YHEVIEEIQKN..VNHAEP..............WARG.ATG...........................................VP.SSMFCCLYKF.MLMK.LTVK..........QVRG.LVE...............................................YKFSPMVRA............A....GFLY...I.....RFCCD........................PKYM....FAWF.K.....KYLLDDE.DFKPGAD--...................----K....NSPSMTIGDYVEG.LL.......NNQEYYN..T..RLPRIPTKYET----klka................................................................
G4VNB2_SCHMA/10-175                  .................................................h-TVHGTNPQYLLEKIVRSRIYES.KFWKEHCFALT.......................................A........-ELLVDKAVE-..LRYVGG..............-VYS.GSV...........................................KP.TPFLCLTLKM.LQIQ.PDKD..........IVIE.FIK...............................................QEPYKYARA............L....GAFY...L.....RLVGD........................SVEI....YKYL.E.....TLYNDFR.RLKFQDKMG...................-----....NFSLIYMDDFIDQ.LL.......TEERVCD..V..ILPRLQKREVLEEL-n...................................................................
H6BS57_EXODN/19-185                  ................................................pl--IRGQNPALLFETPMRDRITDS.LYWKEQCFGLN.......................................A........-ATLCDRAVE-..LTYIGG..............-TYG.VAM...........................................KP.TPFICLAFKL.LTLV.PDKE..........IVLE.YLKn.............................................gGEEWKYLRA............L....AAFY...I.....RLTFD........................PADV....YKTL.E.....PLLEDYR.KLRYRRKET...................-----....-YELIHMDEFVDN.LL.......TKERVCG..T..SLWKLPARQLLEDL-d...................................................................
W7X5L5_TETTS/175-341                 ................................................si---WEYDSSGTLNPKLKTNIMNS.SYFKIDLFSLK.......................................T........YHEVIDEIQKH..VNHAEP..............YAIG.PTG...........................................VP.STLFCCLYKF.MLMK.LTVK..........QVKG.LVE...............................................YKQSPMVRA............I....GFLY...I.....RFCCD........................PKYM....FAWF.K.....KHLLDDE.EFKPGADK-...................-----....NSPNMTIGDYVEK.LL.......SDQEYYG..T..RLPRIPIKIETKI--ka..................................................................
#=GC seq_cons                        .................................................h..lhGsssphllppll+spIhsS..YaK.phasLs.......................................s.........cpllDchhp...lpalts...............hhG.ssp...........................................tP.osFhCLlhKh.hplp.Pscc...........lht.hlp...............................................pp-.pYlRA............L....GhhY...l.....Rhsts........................st-l....apah.E.....PhhpD.c.cl+....ts............................thplhphccalcp.LL.......pcpchhs..h..hLPRl.hph.hp...p...................................................................
//
DBGET integrated database retrieval system