GenomeNet

Database: Pfam
Entry: PRP38
LinkDB: PRP38
Original site: PRP38 
#=GF ID   PRP38
#=GF AC   PF03371.13
#=GF DE   PRP38 family
#=GF AU   Bateman A, Winge P
#=GF SE   Winge P
#=GF GA   22.40 22.40;
#=GF TC   23.00 22.50;
#=GF NC   22.00 21.50;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   1508195
#=GF RT   PRP38 encodes a yeast protein required for pre-mRNA splicing and
#=GF RT   maintenance of stable U6 small nuclear RNA levels. 
#=GF RA   Blanton S, Srinivasan A, Rymond BC; 
#=GF RL   Mol Cell Biol 1992;12:3939-3947.
#=GF RN   [2]
#=GF RM   9582287
#=GF RT   Progression through the spliceosome cycle requires Prp38p
#=GF RT   function for U4/U6 snRNA dissociation. 
#=GF RA   Xie J, Beickman K, Otte E, Rymond BC; 
#=GF RL   EMBO J 1998;17:2938-2946.
#=GF DR   INTERPRO; IPR005037;
#=GF CC   Members of this family are related to the pre mRNA splicing 
#=GF CC   factor PRP38 from yeast [1].  Therefore all the members of this
#=GF CC   family could be involved in splicing.  This conserved region
#=GF CC   could be involved in RNA binding. The putative domain is about
#=GF CC   180 amino acids in length. PRP38 is a unique component of the
#=GF CC   U4/U6.U5 tri-small nuclear ribonucleoprotein (snRNP) particle
#=GF CC   and is necessary for an essential step late in spliceosome
#=GF CC   maturation [2]. 
#=GF SQ   975
#=GS E9AIG4_LEIBR/4-153        AC E9AIG4.1
#=GS A0A0G2JGW4_MOUSE/48-93    AC A0A0G2JGW4.1
#=GS B0WBK2_CULQU/28-212       AC B0WBK2.1
#=GS B9H3J6_POPTR/3-167        AC B9H3J6.1
#=GS A0A074XVB6_AURPU/19-183   AC A0A074XVB6.1
#=GS A0A067DF16_CITSI/4-97     AC A0A067DF16.1
#=GS I0Z2X4_9CHLO/2-166        AC I0Z2X4.1
#=GS K7JAP2_NASVI/32-188       AC K7JAP2.1
#=GS PR38A_DANRE/10-175        AC Q6DHU4.1
#=GS G0W4U6_NAUDC/16-222       AC G0W4U6.1
#=GS C5FIK5_ARTOC/25-209       AC C5FIK5.1
#=GS A5K1F2_PLAVS/159-321      AC A5K1F2.1
#=GS C5K6I2_PERM5/108-276      AC C5K6I2.1
#=GS PRP38_ARATH/10-175        AC Q8LB54.1
#=GS A0A0F7TUV8_9EURO/21-204   AC A0A0F7TUV8.1
#=GS K7H0X6_CAEJA/52-236       AC K7H0X6.1
#=GS D3BAL0_POLPA/154-210      AC D3BAL0.1
#=GS A0A067RRD2_ZOONE/10-175   AC A0A067RRD2.1
#=GS S6EYV6_ZYGB2/14-210       AC S6EYV6.1
#=GS M2MPP1_BAUCO/19-184       AC M2MPP1.1
#=GS K1W8G5_TRIAC/59-194       AC K1W8G5.1
#=GS S0DNK7_GIBF5/26-192       AC S0DNK7.1
#=GS A0A0N1NXL0_9EURO/19-185   AC A0A0N1NXL0.1
#=GS W6Q0P6_PENRO/21-204       AC W6Q0P6.1
#=GS J9I2Y7_9SPIT/195-356      AC J9I2Y7.1
#=GS A0A093XH37_9PEZI/1-164    AC A0A093XH37.1
#=GS G3I797_CRIGR/6-94         AC G3I797.1
#=GS A0A0E0PTE6_ORYRU/4-166    AC A0A0E0PTE6.1
#=GS A0A0N5AFH1_9BILA/10-174   AC A0A0N5AFH1.1
#=GS H2MEA7_ORYLA/10-179       AC H2MEA7.1
#=GS A0A0D9WDE8_9ORYZ/3-166    AC A0A0D9WDE8.1
#=GS Q756P8_ASHGO/14-224       AC Q756P8.1
#=GS A0A0N0DUZ1_9TRYP/258-435  AC A0A0N0DUZ1.1
#=GS C5Z3V3_SORBI/3-166        AC C5Z3V3.1
#=GS G4TPS2_PIRID/10-173       AC G4TPS2.1
#=GS R8BK18_TOGMI/23-190       AC R8BK18.1
#=GS M7NMD2_PNEMU/15-179       AC M7NMD2.1
#=GS A0A0L0N1A5_9HYPO/24-191   AC A0A0L0N1A5.1
#=GS W6MI80_9ASCO/16-181       AC W6MI80.1
#=GS L2G882_COLGN/24-191       AC L2G882.1
#=GS G2XP06_BOTF4/21-188       AC G2XP06.1
#=GS C4Y6R0_CLAL4/3-178        AC C4Y6R0.1
#=GS C6HES4_AJECH/21-214       AC C6HES4.1
#=GS Q4Z0V3_PLABA/10-175       AC Q4Z0V3.1
#=GS U9TVS5_RHIID/10-166       AC U9TVS5.1
#=GS A0A0D3G3V7_9ORYZ/3-166    AC A0A0D3G3V7.1
#=GS B6K0B4_SCHJY/16-179       AC B6K0B4.1
#=GS G8ZTX6_TORDC/14-208       AC G8ZTX6.1
#=GS A9V7J1_MONBE/525-692      AC A9V7J1.1
#=GS U3JLV7_FICAL/10-175       AC U3JLV7.1
#=GS A0A058Z0D6_9EUKA/4-170    AC A0A058Z0D6.1
#=GS A4HYV7_LEIIN/4-146        AC A4HYV7.1
#=GS F2PU74_TRIEC/21-222       AC F2PU74.1
#=GS H3H0K3_PHYRM/37-201       AC H3H0K3.1
#=GS A0A0N4YCI5_NIPBR/1-176    AC A0A0N4YCI5.1
#=GS N1R8N2_FUSC4/26-192       AC N1R8N2.1
#=GS K3WW49_PYTUL/39-203       AC K3WW49.1
#=GS I2FP71_USTH4/10-174       AC I2FP71.1
#=GS G5AIQ4_PHYSP/37-201       AC G5AIQ4.1
#=GS Q6FNB5_CANGA/14-216       AC Q6FNB5.1
#=GS G1KHK2_ANOCA/10-175       AC G1KHK2.2
#=GS G8YPM8_PICSO/12-188       AC G8YPM8.1
#=GS W5KVG4_ASTMX/10-175       AC W5KVG4.1
#=GS K3XXF9_SETIT/3-166        AC K3XXF9.1
#=GS T5ACD4_OPHSC/26-193       AC T5ACD4.1
#=GS H2S675_TAKRU/10-175       AC H2S675.1
#=GS W5FCD2_WHEAT/10-175       AC W5FCD2.1
#=GS H0Z2D2_TAEGU/48-232       AC H0Z2D2.1
#=GS A0A0D3H3F9_9ORYZ/10-175   AC A0A0D3H3F9.1
#=GS D2VCT3_NAEGR/48-213       AC D2VCT3.1
#=GS F4PA36_BATDJ/1-156        AC F4PA36.1
#=GS A0A096UWA6_WHEAT/3-165    AC A0A096UWA6.1
#=GS G3N4L7_GASAC/1-34         AC G3N4L7.1
#=GS A0A091DJ53_FUKDA/1-176    AC A0A091DJ53.1
#=GS V5G3J8_BYSSN/21-207       AC V5G3J8.1
#=GS A0A0L0P213_9ASCO/2-178    AC A0A0L0P213.1
#=GS H0ZFB3_TAEGU/10-175       AC H0ZFB3.1
#=GS A8BAJ9_GIAIC/1-145        AC A8BAJ9.1
#=GS H2KVI1_CLOSI/10-175       AC H2KVI1.1
#=GS A0A074W0U8_9PEZI/19-183   AC A0A074W0U8.1
#=GS W7HV93_9PEZI/23-186       AC W7HV93.1
#=GS T1H306_MEGSC/10-175       AC T1H306.1
#=GS A0A0N5CXD3_THECL/10-175   AC A0A0N5CXD3.1
#=GS M2RIP2_CERS8/10-173       AC M2RIP2.1
#=GS W5MGQ8_LEPOC/10-175       AC W5MGQ8.1
#=GS I1CST4_RHIO9/3-153        AC I1CST4.1
#=GS W5L4F4_ASTMX/24-208       AC W5L4F4.1
#=GS A0A0J8C706_BETVU/4-167    AC A0A0J8C706.1
#=GS I1MBS7_SOYBN/4-166        AC I1MBS7.1
#=GS A0A0D2QSW4_GOSRA/3-162    AC A0A0D2QSW4.1
#=GS A0A085M8W0_9BILA/10-175   AC A0A085M8W0.1
#=GS W9XE09_9EURO/20-185       AC W9XE09.1
#=GS A0A066VG41_9BASI/10-174   AC A0A066VG41.1
#=GS S7QHR4_GLOTA/10-173       AC S7QHR4.1
#=GS A0A0N4VGU5_ENTVE/46-253   AC A0A0N4VGU5.1
#=GS A0A024VKM8_PLAFA/173-301  AC A0A024VKM8.1
#=GS I3MZU9_ICTTR/10-159       AC I3MZU9.1
#=GS F6UQW2_HORSE/10-175       AC F6UQW2.1
#=GS I1QLT6_ORYGL/10-175       AC I1QLT6.1
#=GS A0A0A1T126_9HYPO/24-191   AC A0A0A1T126.1
#=GS I1F011_AMPQE/7-103        AC I1F011.1
#=GS B6AGF3_CRYMR/3-168        AC B6AGF3.1
#=GS A0A061DC29_BABBI/10-175   AC A0A061DC29.1
#=GS Q4Q9W3_LEIMA/270-441      AC Q4Q9W3.1
#=GS W9QIC3_9ROSA/10-174       AC W9QIC3.1
#=GS V3ZLZ8_LOTGI/10-175       AC V3ZLZ8.1
#=GS F7A5D9_CALJA/47-231       AC F7A5D9.1
#=GS M4A2I4_XIPMA/25-209       AC M4A2I4.1
#=GS M3K4S3_CANMX/17-194       AC M3K4S3.1
#=GS E9IFJ0_SOLIN/10-175       AC E9IFJ0.1
#=GS F2TEA8_AJEDA/21-214       AC F2TEA8.2
#=GS A0A0A1NZE8_9FUNG/11-174   AC A0A0A1NZE8.1
#=GS S8BH21_PENO1/21-204       AC S8BH21.1
#=GS M0SG80_MUSAM/10-174       AC M0SG80.1
#=GS A1CAF4_ASPCL/21-209       AC A1CAF4.1
#=GS Q4YH72_PLABA/10-175       AC Q4YH72.1
#=GS I1PSX7_ORYGL/3-166        AC I1PSX7.1
#=GS L8FWG2_PSED2/22-189       AC L8FWG2.1
#=GS D8LWY4_BLAHO/35-198       AC D8LWY4.1
#=GS E2A1P6_CAMFO/10-175       AC E2A1P6.1
#=GS A0A0K0EJ62_STRER/6-171    AC A0A0K0EJ62.1
#=GS B3S4R2_TRIAD/10-175       AC B3S4R2.1
#=GS G0QNS3_ICHMG/118-284      AC G0QNS3.1
#=GS A0A0L9SRI6_9HYPO/24-191   AC A0A0L9SRI6.1
#=GS Q2H4I5_CHAGB/105-167      AC Q2H4I5.1
#=GS F6SY19_ORNAN/10-56        AC F6SY19.1
#=GS D6X552_TRICA/24-208       AC D6X552.1
#=GS A0A0C4E3X3_MAGP6/24-191   AC A0A0C4E3X3.1
#=GS A0A0K6G8X0_9HOMO/10-173   AC A0A0K6G8X0.1
#=GS A0A095C2R6_CRYGA/9-163    AC A0A095C2R6.1
#=GS A0A074T919_HAMHA/142-303  AC A0A074T919.1
#=GS G7XH18_ASPKW/21-207       AC G7XH18.1
#=GS A0A0N4UBE6_DRAME/47-98    AC A0A0N4UBE6.1
#=GS L5LMJ2_MYODS/10-175       AC L5LMJ2.1
#=GS M7XZP0_RHOT1/10-174       AC M7XZP0.1
#=GS Q4E0F0_TRYCC/9-176        AC Q4E0F0.1
#=GS A0A0G4IQ99_PLABS/427-592  AC A0A0G4IQ99.1
#=GS Q4QCT1_LEIMA/4-144        AC Q4QCT1.1
#=GS F6SUR6_MONDO/10-175       AC F6SUR6.2
#=GS W4FTM1_9STRA/9-142        AC W4FTM1.1
#=GS E1ZPB8_CHLVA/2-179        AC E1ZPB8.1
#=GS Q4N1F2_THEPA/1-29         AC Q4N1F2.1
#=GS T1K3B4_TETUR/10-175       AC T1K3B4.1
#=GS A0A0M3ILB4_ASCLU/10-168   AC A0A0M3ILB4.1
#=GS W2S0L2_9EURO/19-185       AC W2S0L2.1
#=GS A0A0L1KXD1_9EUGL/17-211   AC A0A0L1KXD1.1
#=GS J3MVI2_ORYBR/10-175       AC J3MVI2.1
#=GS H2WNF1_CAEJA/10-112       AC H2WNF1.2
#=GS W4GRF9_9STRA/57-221       AC W4GRF9.1
#=GS F0XUL2_GROCL/26-192       AC F0XUL2.1
#=GS A0A075AYX0_9FUNG/10-174   AC A0A075AYX0.1
#=GS M7YQW6_TRIUA/1-102        AC M7YQW6.1
#=GS A0A0A2VHG9_BEABA/24-191   AC A0A0A2VHG9.1
#=GS F0XVG8_AURAN/1-161        AC F0XVG8.1
#=GS U6Q036_HAECO/10-175       AC U6Q036.1
#=GS A0A074XMF4_9PEZI/19-183   AC A0A074XMF4.1
#=GS A4HE72_LEIBR/304-441      AC A4HE72.1
#=GS H2KT99_CLOSI/29-213       AC H2KT99.1
#=GS PR38A_HUMAN/10-175        AC Q8NAV1.1
#=GS PR38A_HUMAN/10-175        DR PDB; 4RZ9 A; 10-175;
#=GS PR38A_HUMAN/10-175        DR PDB; 4RZA A; 10-175;
#=GS A0A0D3B635_BRAOL/10-175   AC A0A0D3B635.1
#=GS A4RRH8_OSTLU/10-175       AC A4RRH8.1
#=GS C1E4N5_MICSR/10-173       AC C1E4N5.1
#=GS A0A0D2WQ43_CAPO3/10-175   AC A0A0D2WQ43.1
#=GS F7GLK3_MONDO/52-236       AC F7GLK3.1
#=GS F2EBP1_HORVD/3-150        AC F2EBP1.1
#=GS A0A0J7LB91_LASNI/37-224   AC A0A0J7LB91.1
#=GS G8F4J3_MACFA/47-231       AC G8F4J3.1
#=GS A2QN12_ASPNC/21-209       AC A2QN12.1
#=GS H2R123_PANTR/10-175       AC H2R123.1
#=GS B8AYN3_ORYSI/3-166        AC B8AYN3.1
#=GS G3VUT2_SARHA/10-175       AC G3VUT2.1
#=GS E2QU96_CANLF/10-175       AC E2QU96.2
#=GS A3GFM9_PICST/15-192       AC A3GFM9.2
#=GS A0A0A2KNT9_PENIT/21-204   AC A0A0A2KNT9.1
#=GS A0A078A0F3_STYLE/218-371  AC A0A078A0F3.1
#=GS F7ISR6_CALJA/47-92        AC F7ISR6.1
#=GS A0A0E0QYC5_ORYRU/23-76    AC A0A0E0QYC5.1
#=GS C5LME5_PERM5/21-137       AC C5LME5.1
#=GS G3NPB2_GASAC/10-174       AC G3NPB2.1
#=GS A0A0D3BZE4_BRAOL/4-168    AC A0A0D3BZE4.1
#=GS PR38B_RAT/47-231          AC Q6AXY7.1
#=GS W5QC53_SHEEP/39-223       AC W5QC53.1
#=GS G3TY10_LOXAF/47-231       AC G3TY10.1
#=GS F7VQJ3_SORMK/24-191       AC F7VQJ3.1
#=GS L9KRQ0_TUPCH/10-175       AC L9KRQ0.1
#=GS C4JLP1_UNCRE/21-208       AC C4JLP1.1
#=GS H2N6K2_PONAB/47-231       AC H2N6K2.1
#=GS B4NCI0_DROWI/29-213       AC B4NCI0.2
#=GS A0A078A1R7_STYLE/10-175   AC A0A078A1R7.1
#=GS Q4GZ20_TRYB2/36-209       AC Q4GZ20.1
#=GS D7MIA4_ARALL/4-168        AC D7MIA4.1
#=GS L1LC98_THEEQ/10-175       AC L1LC98.1
#=GS A0A0D9S7A0_CHLSB/1-34     AC A0A0D9S7A0.1
#=GS U3IFV6_ANAPL/4-188        AC U3IFV6.1
#=GS F4P219_BATDJ/9-173        AC F4P219.1
#=GS G2PZZ7_MYCTT/24-191       AC G2PZZ7.1
#=GS G5B2Y6_HETGA/1-99         AC G5B2Y6.1
#=GS A0A0D2R045_GOSRA/3-166    AC A0A0D2R045.1
#=GS U5FR78_POPTR/10-175       AC U5FR78.1
#=GS A0A067TR38_9AGAR/10-173   AC A0A067TR38.1
#=GS A0A094GDZ7_9PEZI/22-189   AC A0A094GDZ7.1
#=GS A0A044QM65_ONCVO/10-175   AC A0A044QM65.1
#=GS K3VWG0_FUSPC/26-192       AC K3VWG0.1
#=GS E9EAI6_METAQ/24-191       AC E9EAI6.1
#=GS W9QWY7_9ROSA/10-174       AC W9QWY7.1
#=GS S9VFC1_9TRYP/46-244       AC S9VFC1.1
#=GS H0WS15_OTOGA/10-175       AC H0WS15.1
#=GS Q8II38_PLAF7/11-175       AC Q8II38.1
#=GS E3RUL4_PYRTT/23-233       AC E3RUL4.1
#=GS V9FB38_PHYPR/37-201       AC V9FB38.1
#=GS G1LCH7_AILME/47-231       AC G1LCH7.1
#=GS A0A067D0W8_SAPPC/50-213   AC A0A067D0W8.1
#=GS A0A0G4F474_9ALVE/149-314  AC A0A0G4F474.1
#=GS B4NNL6_DROWI/10-175       AC B4NNL6.1
#=GS A0A059ADM4_EUCGR/1-112    AC A0A059ADM4.1
#=GS K7IUN1_NASVI/10-175       AC K7IUN1.1
#=GS Q6CS55_KLULA/14-213       AC Q6CS55.1
#=GS V2XVC5_MONRO/10-173       AC V2XVC5.1
#=GS E6NU38_JATCU/10-175       AC E6NU38.1
#=GS C3ZRP3_BRAFL/7-191        AC C3ZRP3.1
#=GS A0A0K9PSL8_ZOSMR/10-175   AC A0A0K9PSL8.1
#=GS G8YR38_PICSO/12-187       AC G8YR38.1
#=GS I3ND88_ICTTR/50-234       AC I3ND88.1
#=GS G1Q147_MYOLU/28-211       AC G1Q147.1
#=GS Q7PX02_ANOGA/10-175       AC Q7PX02.4
#=GS A0A096MX21_PAPAN/48-232   AC A0A096MX21.1
#=GS D0NHN2_PHYIT/9-173        AC D0NHN2.1
#=GS W7TLT3_9STRA/33-198       AC W7TLT3.1
#=GS A8PRE0_MALGO/10-174       AC A8PRE0.1
#=GS PRP38_SCHPO/14-177        AC Q9UUD2.1
#=GS W7AJL3_PLAVN/162-324      AC W7AJL3.1
#=GS F2TX53_SALR5/105-247      AC F2TX53.1
#=GS A0A063BZU8_9HYPO/25-192   AC A0A063BZU8.1
#=GS G4V8E6_SCHMA/26-210       AC G4V8E6.1
#=GS A0A066XD06_COLSU/24-191   AC A0A066XD06.1
#=GS PR38B_HUMAN/47-231        AC Q5VTL8.1
#=GS A0A0E0QMP1_ORYRU/10-175   AC A0A0E0QMP1.1
#=GS Q5CUQ1_CRYPI/3-168        AC Q5CUQ1.1
#=GS C1MPU3_MICPC/21-182       AC C1MPU3.1
#=GS F7HY13_CALJA/10-175       AC F7HY13.1
#=GS A6QTF5_AJECN/41-234       AC A6QTF5.1
#=GS A0A0K0JRM4_BRUMA/47-231   AC A0A0K0JRM4.1
#=GS C1GJF7_PARBD/21-214       AC C1GJF7.1
#=GS C7YSE8_NECH7/25-192       AC C7YSE8.1
#=GS G3QMW7_GORGO/10-175       AC G3QMW7.1
#=GS F9F8Y6_FUSOF/26-192       AC F9F8Y6.1
#=GS A0A0F4GLW9_9PEZI/19-186   AC A0A0F4GLW9.1
#=GS Q9FHS8_ARATH/4-159        AC Q9FHS8.1
#=GS N4VSA6_COLOR/24-191       AC N4VSA6.1
#=GS W9YRJ2_9EURO/20-185       AC W9YRJ2.1
#=GS W4ZDU0_STRPU/160-344      AC W4ZDU0.1
#=GS A0A0E0A4V7_9ORYZ/4-166    AC A0A0E0A4V7.1
#=GS S3DD72_GLAL2/21-188       AC S3DD72.1
#=GS A9P852_POPTR/3-167        AC A9P852.1
#=GS A0A0D3H3F8_9ORYZ/10-175   AC A0A0D3H3F8.1
#=GS A0C3P9_PARTE/86-247       AC A0C3P9.1
#=GS A0A024TF87_9STRA/1-98     AC A0A024TF87.1
#=GS J3K8Q1_COCIM/21-209       AC J3K8Q1.2
#=GS G0S1D3_CHATD/24-191       AC G0S1D3.1
#=GS H9JEJ8_BOMMO/23-207       AC H9JEJ8.1
#=GS J6E9Q7_SACK1/15-219       AC J6E9Q7.1
#=GS E3QPI7_COLGM/24-191       AC E3QPI7.1
#=GS R1EHA8_BOTPV/20-176       AC R1EHA8.1
#=GS G0VC19_NAUCC/15-211       AC G0VC19.1
#=GS A0A024W143_PLAFA/173-335  AC A0A024W143.1
#=GS W6UMV2_ECHGR/10-175       AC W6UMV2.1
#=GS Q0DKA8_ORYSJ/3-101        AC Q0DKA8.2
#=GS J9EVG5_WUCBA/10-175       AC J9EVG5.1
#=GS A0A096LYD0_POEFO/28-178   AC A0A096LYD0.1
#=GS V4ZI95_TOXGO/10-175       AC V4ZI95.1
#=GS A0A044STF6_ONCVO/47-231   AC A0A044STF6.1
#=GS A0A0L0CFU8_LUCCU/10-175   AC A0A0L0CFU8.1
#=GS M0W6M8_HORVD/1-69         AC M0W6M8.1
#=GS PR38A_PONAB/10-175        AC Q5RDD2.1
#=GS G0NBD0_CAEBE/55-239       AC G0NBD0.1
#=GS PR38B_DANRE/25-209        AC Q6P7Y3.1
#=GS A0A085NTX6_9BILA/422-604  AC A0A085NTX6.1
#=GS Q6C616_YARLI/15-178       AC Q6C616.1
#=GS H2ZEL3_CIOSA/29-213       AC H2ZEL3.1
#=GS U6L8R2_EIMTE/10-173       AC U6L8R2.1
#=GS A0A0B1P5C4_UNCNE/21-188   AC A0A0B1P5C4.1
#=GS Q5KIE6_CRYNJ/9-172        AC Q5KIE6.2
#=GS M4C7M0_BRARP/10-175       AC M4C7M0.1
#=GS A0A0N4VL93_ENTVE/10-174   AC A0A0N4VL93.1
#=GS M7YZV4_TRIUA/3-103        AC M7YZV4.1
#=GS B8B2Q7_ORYSI/4-173        AC B8B2Q7.1
#=GS A0A094HRU1_9PEZI/22-189   AC A0A094HRU1.1
#=GS E1GES1_LOALO/47-231       AC E1GES1.2
#=GS A0A0C2MT08_THEKT/43-227   AC A0A0C2MT08.1
#=GS R1EST0_EMIHU/1-175        AC R1EST0.1
#=GS A0A060SR90_PYCCI/10-173   AC A0A060SR90.1
#=GS B3MXQ1_DROAN/35-219       AC B3MXQ1.1
#=GS A0A0J7L2G9_LASNI/10-175   AC A0A0J7L2G9.1
#=GS A0A0D1CL78_USTMA/10-174   AC A0A0D1CL78.1
#=GS W4KIC8_9HOMO/10-173       AC W4KIC8.1
#=GS A0A087STH6_AUXPR/10-175   AC A0A087STH6.1
#=GS A0A0N5DGF6_TRIMR/10-175   AC A0A0N5DGF6.1
#=GS H2S676_TAKRU/10-175       AC H2S676.1
#=GS A0A059B3E7_EUCGR/58-223   AC A0A059B3E7.1
#=GS G1NFA1_MELGA/10-175       AC G1NFA1.2
#=GS F4WXJ8_ACREC/37-220       AC F4WXJ8.1
#=GS A7F153_SCLS1/21-188       AC A7F153.1
#=GS M2T688_COCH5/23-228       AC M2T688.1
#=GS G3R6P3_GORGO/47-231       AC G3R6P3.1
#=GS L8X0R2_THACA/10-163       AC L8X0R2.1
#=GS A0A067P368_PLEOS/10-173   AC A0A067P368.1
#=GS K3W962_PYTUL/10-174       AC K3W962.1
#=GS M3Y690_MUSPF/10-175       AC M3Y690.1
#=GS B7QBZ1_IXOSC/10-175       AC B7QBZ1.1
#=GS A0A087SCL4_AUXPR/45-210   AC A0A087SCL4.1
#=GS A0A0E0LY62_ORYPU/10-175   AC A0A0E0LY62.1
#=GS A2G7A6_TRIVA/40-204       AC A2G7A6.1
#=GS K4B140_SOLLC/10-175       AC K4B140.1
#=GS A0A0K9PM83_ZOSMR/3-167    AC A0A0K9PM83.1
#=GS T1I5E1_RHOPR/4-188        AC T1I5E1.1
#=GS A0A0B2X748_9HYPO/24-191   AC A0A0B2X748.1
#=GS E9QD55_DANRE/25-170       AC E9QD55.1
#=GS A0A084W1A0_ANOSI/53-237   AC A0A084W1A0.1
#=GS Q8RUP2_ORYSJ/23-76        AC Q8RUP2.1
#=GS A0A061J015_TRYRA/27-195   AC A0A061J015.1
#=GS G3UEL4_LOXAF/10-175       AC G3UEL4.1
#=GS W9RQ05_9ROSA/3-101        AC W9RQ05.1
#=GS F4K753_ARATH/1-113        AC F4K753.1
#=GS A5K4Y5_PLAVS/10-175       AC A5K4Y5.1
#=GS M8A466_TRIUA/3-166        AC M8A466.1
#=GS A0A0E9NPH2_9ASCO/27-194   AC A0A0E9NPH2.1
#=GS A0A0D9ZUW6_9ORYZ/3-166    AC A0A0D9ZUW6.1
#=GS A0A061GA69_THECC/5-76     AC A0A061GA69.1
#=GS V5EEC2_PSEBG/10-174       AC V5EEC2.1
#=GS A0A0E0PTE3_ORYRU/4-158    AC A0A0E0PTE3.1
#=GS A0A0B2V767_TOXCA/180-345  AC A0A0B2V767.1
#=GS N1JK20_BLUG1/21-188       AC N1JK20.1
#=GS S9XEH7_SCHCR/14-177       AC S9XEH7.1
#=GS W4ZVL3_WHEAT/3-166        AC W4ZVL3.1
#=GS E7KNP5_YEASL/15-219       AC E7KNP5.1
#=GS E9IDC1_SOLIN/82-265       AC E9IDC1.1
#=GS A0A0N0P7I3_LEPSE/4-150    AC A0A0N0P7I3.1
#=GS W7A7D1_9APIC/10-175       AC W7A7D1.1
#=GS A0A010R8A1_9PEZI/24-191   AC A0A010R8A1.1
#=GS G0N8A9_CAEBE/10-175       AC G0N8A9.1
#=GS A0A0N0DS04_9TRYP/4-156    AC A0A0N0DS04.1
#=GS A0A0K0FA69_9BILA/6-171    AC A0A0K0FA69.1
#=GS F7CZ30_MACMU/10-176       AC F7CZ30.1
#=GS A0A067MDA3_9HOMO/10-173   AC A0A067MDA3.1
#=GS C9S9P5_VERA1/26-193       AC C9S9P5.1
#=GS W9YWJ5_9EURO/19-185       AC W9YWJ5.1
#=GS B6QEC1_TALMQ/21-208       AC B6QEC1.1
#=GS F4PZZ0_DICFS/118-283      AC F4PZZ0.1
#=GS B0D223_LACBS/10-173       AC B0D223.1
#=GS H3FY63_PRIPA/61-245       AC H3FY63.1
#=GS W1QC60_OGAPD/14-179       AC W1QC60.1
#=GS A0A0A0MRN0_HUMAN/2-120    AC A0A0A0MRN0.1
#=GS Q8SUF7_ENCCU/2-164        AC Q8SUF7.1
#=GS D8SIA1_SELML/5-138        AC D8SIA1.1
#=GS M9LTE5_PSEA3/10-174       AC M9LTE5.1
#=GS A0A0K8L2H4_9EURO/21-209   AC A0A0K8L2H4.1
#=GS I1HL97_BRADI/3-166        AC I1HL97.1
#=GS S9YKY6_9CETA/13-80        AC S9YKY6.1
#=GS G3WWZ2_SARHA/30-174       AC G3WWZ2.1
#=GS D4AX30_ARTBC/21-222       AC D4AX30.1
#=GS A0A0N4UD64_DRAME/10-175   AC A0A0N4UD64.1
#=GS M3XUF9_MUSPF/49-233       AC M3XUF9.1
#=GS R4X9K4_TAPDE/21-184       AC R4X9K4.1
#=GS U6JTB6_EIMAC/135-297      AC U6JTB6.1
#=GS C3ZFR3_BRAFL/10-175       AC C3ZFR3.1
#=GS E2BCA0_HARSA/10-175       AC E2BCA0.1
#=GS E4XHG4_OIKDI/82-282       AC E4XHG4.1
#=GS K3YT29_SETIT/10-175       AC K3YT29.1
#=GS H3B6U1_LATCH/36-219       AC H3B6U1.1
#=GS D8QUJ9_SELML/10-175       AC D8QUJ9.1
#=GS M4BZA9_HYAAE/9-147        AC M4BZA9.1
#=GS A0A0L7LKK1_9NEOP/22-89    AC A0A0L7LKK1.1
#=GS H3ATS7_LATCH/10-175       AC H3ATS7.1
#=GS PRP38_YEAST/15-219        AC Q00723.1
#=GS G4U7T3_NEUT9/24-191       AC G4U7T3.1
#=GS I1F795_AMPQE/2-83         AC I1F795.1
#=GS A0A096MBN3_POEFO/10-175   AC A0A096MBN3.1
#=GS W6KQG9_9TRYP/3-189        AC W6KQG9.1
#=GS A0A0G4IHW0_PLABS/154-314  AC A0A0G4IHW0.1
#=GS Q4Y906_PLACH/157-319      AC Q4Y906.1
#=GS M0U4G2_MUSAM/3-166        AC M0U4G2.1
#=GS K4DTH9_TRYCR/9-176        AC K4DTH9.1
#=GS A0A0N5CN93_THECL/1-176    AC A0A0N5CN93.1
#=GS M5XCM3_PRUPE/1-41         AC M5XCM3.1
#=GS R4GD49_ANOCA/32-216       AC R4GD49.1
#=GS W5JA90_ANODA/10-175       AC W5JA90.1
#=GS B4GH52_DROPE/10-175       AC B4GH52.1
#=GS A4RVT9_OSTLU/18-191       AC A4RVT9.1
#=GS D3ZGL5_RAT/10-175         AC D3ZGL5.1
#=GS E3LKU1_CAERE/55-239       AC E3LKU1.1
#=GS A0A0E0PTE4_ORYRU/4-157    AC A0A0E0PTE4.1
#=GS A0A074SWX5_HAMHA/10-175   AC A0A074SWX5.1
#=GS M4BIY1_HYAAE/37-168       AC M4BIY1.1
#=GS G3PQV1_GASAC/24-208       AC G3PQV1.1
#=GS A0A078JU74_BRANA/10-175   AC A0A078JU74.1
#=GS H2TYE1_TAKRU/22-206       AC H2TYE1.1
#=GS K7HSD9_CAEJA/1-166        AC K7HSD9.1
#=GS R9ACJ1_WALI9/10-173       AC R9ACJ1.1
#=GS G1XLI7_ARTOA/22-185       AC G1XLI7.1
#=GS A0A098E326_GIBZA/26-192   AC A0A098E326.1
#=GS A0A087XDU8_POEFO/25-209   AC A0A087XDU8.2
#=GS B8BCS7_ORYSI/10-175       AC B8BCS7.1
#=GS A0A0E0A4V5_9ORYZ/4-150    AC A0A0E0A4V5.1
#=GS C8VB07_EMENI/21-212       AC C8VB07.1
#=GS A0A068RMB9_9FUNG/9-173    AC A0A068RMB9.1
#=GS F4K754_ARATH/4-105        AC F4K754.1
#=GS F7H0L0_MACMU/47-189       AC F7H0L0.1
#=GS K0SGM5_THAOC/41-200       AC K0SGM5.1
#=GS F6UKW2_XENTR/35-219       AC F6UKW2.1
#=GS Q4N084_THEPA/10-175       AC Q4N084.1
#=GS L8H6U6_ACACA/87-250       AC L8H6U6.1
#=GS A0A0D9S6K8_CHLSB/47-231   AC A0A0D9S6K8.1
#=GS J3P436_GAGT3/24-191       AC J3P436.1
#=GS W5FVI4_WHEAT/10-175       AC W5FVI4.1
#=GS F2SN07_TRIRC/21-222       AC F2SN07.1
#=GS G5C765_HETGA/10-78        AC G5C765.1
#=GS W5EZF1_WHEAT/1-99         AC W5EZF1.1
#=GS H0V3G0_CAVPO/48-232       AC H0V3G0.1
#=GS S9WYR5_9TRYP/4-144        AC S9WYR5.1
#=GS A0A0L7L5T5_9NEOP/10-175   AC A0A0L7L5T5.1
#=GS E0VHT3_PEDHC/1-176        AC E0VHT3.1
#=GS T0KFN0_COLGC/1-66         AC T0KFN0.1
#=GS F6I4Q5_VITVI/10-175       AC F6I4Q5.1
#=GS A0A024WI92_PLAFA/173-335  AC A0A024WI92.1
#=GS B0WP85_CULQU/10-175       AC B0WP85.1
#=GS C0PCD4_MAIZE/3-167        AC C0PCD4.1
#=GS F0VCL2_NEOCL/132-293      AC F0VCL2.1
#=GS A0A068XDW1_HYMMI/27-211   AC A0A068XDW1.1
#=GS W9C3G0_9HELO/21-188       AC W9C3G0.1
#=GS Q4U8Q2_THEAN/128-301      AC Q4U8Q2.1
#=GS R7Z359_CONA1/20-205       AC R7Z359.1
#=GS PR38B_MOUSE/48-232        AC Q80SY5.1
#=GS B9PT26_TOXGO/142-303      AC B9PT26.1
#=GS A0A0E0PTE5_ORYRU/4-166    AC A0A0E0PTE5.1
#=GS M0Z3R7_HORVD/3-165        AC M0Z3R7.1
#=GS J4W4G8_BEAB2/24-191       AC J4W4G8.1
#=GS A0A061EDX2_THECC/3-165    AC A0A061EDX2.1
#=GS D2V594_NAEGR/1-165        AC D2V594.1
#=GS M3VYN3_FELCA/10-175       AC M3VYN3.1
#=GS H0V990_CAVPO/21-205       AC H0V990.1
#=GS A0A0D2XW34_FUSO4/26-192   AC A0A0D2XW34.1
#=GS W9S3F4_9ROSA/21-93        AC W9S3F4.1
#=GS A0A0N4UBE8_DRAME/12-155   AC A0A0N4UBE8.1
#=GS A0A090MUW1_STRRB/13-194   AC A0A090MUW1.1
#=GS PR38A_XENTR/10-175        AC Q28H87.1
#=GS A0A024W6R0_PLAFA/11-175   AC A0A024W6R0.1
#=GS V4TZ97_9ROSI/4-144        AC V4TZ97.1
#=GS A0A022RAJ0_ERYGU/10-174   AC A0A022RAJ0.1
#=GS H0V4L8_CAVPO/10-175       AC H0V4L8.1
#=GS G0RPR5_HYPJQ/26-193       AC G0RPR5.1
#=GS T0RRR2_9STRA/9-173        AC T0RRR2.1
#=GS A0A015N4G5_9GLOM/7-171    AC A0A015N4G5.1
#=GS M2Z5Y8_PSEFD/16-183       AC M2Z5Y8.1
#=GS A0A0N4Z164_PARTI/30-211   AC A0A0N4Z164.1
#=GS B3L5D4_PLAKH/10-175       AC B3L5D4.1
#=GS A0A0D9XBE9_9ORYZ/10-175   AC A0A0D9XBE9.1
#=GS W4ZSU7_WHEAT/50-203       AC W4ZSU7.1
#=GS H2ZEL4_CIOSA/4-188        AC H2ZEL4.1
#=GS F0YB92_AURAN/58-222       AC F0YB92.1
#=GS I4Y8C3_WALMC/10-173       AC I4Y8C3.1
#=GS D3BAL0_POLPA/67-160       AC D3BAL0.1
#=GS Q4UCH1_THEAN/10-175       AC Q4UCH1.1
#=GS M0X6G7_HORVD/3-166        AC M0X6G7.1
#=GS B4F7Y9_MAIZE/3-166        AC B4F7Y9.1
#=GS I3JLV3_ORENI/10-175       AC I3JLV3.1
#=GS V4AYJ2_LOTGI/4-188        AC V4AYJ2.1
#=GS G0PED8_CAEBE/1-148        AC G0PED8.1
#=GS M3D6M0_SPHMS/19-186       AC M3D6M0.1
#=GS U6MUF7_9EIME/120-282      AC U6MUF7.1
#=GS X6N3G1_RETFI/102-235      AC X6N3G1.1
#=GS A0A0F0ILI8_ASPPA/21-209   AC A0A0F0ILI8.1
#=GS G3IJU9_CRIGR/2-120        AC G3IJU9.1
#=GS H3ERC6_PRIPA/1-44         AC H3ERC6.1
#=GS U6J7B2_ECHGR/27-211       AC U6J7B2.1
#=GS M7BW90_CHEMY/1-176        AC M7BW90.1
#=GS G1NUQ8_MYOLU/10-176       AC G1NUQ8.1
#=GS C0NU08_AJECG/21-213       AC C0NU08.1
#=GS B4JL98_DROGR/29-213       AC B4JL98.1
#=GS A0A0P7UMF5_9TELE/30-214   AC A0A0P7UMF5.1
#=GS S8D204_9LAMI/10-175       AC S8D204.1
#=GS A0A0B2V767_TOXCA/10-175   AC A0A0B2V767.1
#=GS L8GYB7_ACACA/10-175       AC L8GYB7.1
#=GS F4X868_ACREC/10-175       AC F4X868.1
#=GS A0A0A1NVB9_9FUNG/9-173    AC A0A0A1NVB9.1
#=GS A9RTY4_PHYPA/10-175       AC A9RTY4.1
#=GS A0A0A8L5Y3_9SACH/14-213   AC A0A0A8L5Y3.1
#=GS Q2H4I5_CHAGB/24-112       AC Q2H4I5.1
#=GS Q9VYE9_DROME/24-208       AC Q9VYE9.1
#=GS A0A077ZK60_TRITR/10-192   AC A0A077ZK60.1
#=GS A0A0D2VQS3_CAPO3/6-173    AC A0A0D2VQS3.1
#=GS M7BDA2_CHEMY/30-111       AC M7BDA2.1
#=GS D8QIS6_SCHCM/10-173       AC D8QIS6.1
#=GS U6LVE5_9EIME/1-146        AC U6LVE5.1
#=GS A0A094HRM8_9PEZI/22-189   AC A0A094HRM8.1
#=GS A0A0M3K6D9_ANISI/10-174   AC A0A0M3K6D9.1
#=GS N4U2P3_FUSC1/26-192       AC N4U2P3.1
#=GS E7Q418_YEASB/15-219       AC E7Q418.1
#=GS N1PRZ9_DOTSN/19-186       AC N1PRZ9.1
#=GS Q4CZI2_TRYCC/9-176        AC Q4CZI2.1
#=GS B4KQL3_DROMO/10-175       AC B4KQL3.2
#=GS G1PFY0_MYOLU/28-212       AC G1PFY0.1
#=GS G0QNU7_ICHMG/10-175       AC G0QNU7.1
#=GS D8LWJ8_BLAHO/10-174       AC D8LWJ8.1
#=GS C5MCZ6_CANTT/17-194       AC C5MCZ6.1
#=GS A0A072NZS4_9EURO/19-185   AC A0A072NZS4.1
#=GS A0A090N2S3_OSTTA/10-175   AC A0A090N2S3.1
#=GS M5W7Z5_PRUPE/24-176       AC M5W7Z5.1
#=GS W7TQL1_9STRA/10-174       AC W7TQL1.1
#=GS A4I1H4_LEIIN/271-441      AC A4I1H4.1
#=GS I6ND91_ERECY/14-229       AC I6ND91.1
#=GS W4XFI6_STRPU/10-175       AC W4XFI6.1
#=GS R1CRP3_EMIHU/49-231       AC R1CRP3.1
#=GS C5DED7_LACTC/14-227       AC C5DED7.1
#=GS B8MD54_TALSN/21-183       AC B8MD54.1
#=GS A0A0N4T6E4_BRUPA/10-175   AC A0A0N4T6E4.1
#=GS M3XER9_FELCA/48-232       AC M3XER9.1
#=GS J9J8A1_9SPIT/306-471      AC J9J8A1.1
#=GS R0F627_9BRAS/1-113        AC R0F627.1
#=GS G5AUI5_HETGA/10-175       AC G5AUI5.1
#=GS A0A084W0J8_ANOSI/10-175   AC A0A084W0J8.1
#=GS A0A087H484_ARAAL/10-175   AC A0A087H484.1
#=GS E9DBR1_COCPS/21-209       AC E9DBR1.1
#=GS A0A090M5Y6_OSTTA/20-189   AC A0A090M5Y6.1
#=GS A8NG64_COPC7/10-173       AC A8NG64.2
#=GS B4J994_DROGR/10-175       AC B4J994.1
#=GS F1Q7F0_DANRE/25-209       AC F1Q7F0.1
#=GS G6CYI7_DANPL/22-206       AC G6CYI7.1
#=GS S2JQG7_MUCC1/11-174       AC S2JQG7.1
#=GS A0A067LVA7_9HOMO/10-173   AC A0A067LVA7.1
#=GS A0A0G2H3B7_9PEZI/20-207   AC A0A0G2H3B7.1
#=GS A0A0E0PI94_ORYRU/3-166    AC A0A0E0PI94.1
#=GS W4FS00_9STRA/9-173        AC W4FS00.1
#=GS G5A621_PHYSP/9-173        AC G5A621.1
#=GS T1JA16_STRMM/13-197       AC T1JA16.1
#=GS A0A094I083_9PEZI/22-189   AC A0A094I083.1
#=GS S2JJG8_MUCC1/10-170       AC S2JJG8.1
#=GS G9N2S0_HYPVG/26-193       AC G9N2S0.1
#=GS G9NT24_HYPAI/26-193       AC G9NT24.1
#=GS M9PHQ4_DROME/24-177       AC M9PHQ4.1
#=GS M2S990_COCSN/23-231       AC M2S990.1
#=GS M5XBU6_PRUPE/4-166        AC M5XBU6.1
#=GS W7MMC8_GIBM7/26-192       AC W7MMC8.1
#=GS G2WYK7_VERDV/26-193       AC G2WYK7.1
#=GS Q8RWB1_ARATH/4-168        AC Q8RWB1.1
#=GS B4R4A9_DROSI/197-381      AC B4R4A9.1
#=GS J9HJD8_AEDAE/67-225       AC J9HJD8.1
#=GS Q0U5G5_PHANO/25-223       AC Q0U5G5.1
#=GS A0A067H243_CITSI/1-124    AC A0A067H243.1
#=GS L5LXA6_MYODS/1-171        AC L5LXA6.1
#=GS F8Q691_SERL3/10-173       AC F8Q691.1
#=GS G8C0B1_TETPH/14-216       AC G8C0B1.1
#=GS A0A067R513_ZOONE/39-223   AC A0A067R513.1
#=GS C5Z170_SORBI/3-167        AC C5Z170.1
#=GS S3BY96_OPHP1/26-192       AC S3BY96.1
#=GS A0A0H5S0N7_BRUMA/37-84    AC A0A0H5S0N7.1
#=GS G3GW00_CRIGR/10-175       AC G3GW00.1
#=GS I0YZI6_9CHLO/10-175       AC I0YZI6.1
#=GS M5ELW3_MALS4/10-174       AC M5ELW3.1
#=GS B8C9N6_THAPS/41-204       AC B8C9N6.1
#=GS M3ZTE6_XIPMA/10-175       AC M3ZTE6.1
#=GS V6U1Q1_GIAIN/1-137        AC V6U1Q1.1
#=GS T0QUG7_9STRA/50-213       AC T0QUG7.1
#=GS Q7RC31_PLAYO/10-175       AC Q7RC31.1
#=GS I1IIQ1_BRADI/10-175       AC I1IIQ1.1
#=GS F0VM92_NEOCL/10-175       AC F0VM92.1
#=GS K0SK04_THAOC/10-174       AC K0SK04.1
#=GS M5G439_DACSP/10-173       AC M5G439.1
#=GS A0A0G2FQ87_9PEZI/23-190   AC A0A0G2FQ87.1
#=GS A0A0G4GZA6_9ALVE/10-175   AC A0A0G4GZA6.1
#=GS A0A0D2VLI7_GOSRA/2-93     AC A0A0D2VLI7.1
#=GS M4EH49_BRARP/4-168        AC M4EH49.1
#=GS A0A0K0ER33_STRER/30-211   AC A0A0K0ER33.1
#=GS F4RZW6_MELLP/10-173       AC F4RZW6.1
#=GS F0XXJ0_AURAN/10-174       AC F0XXJ0.1
#=GS U5FGX6_POPTR/3-167        AC U5FGX6.1
#=GS A0A0G2HNQ7_9EURO/21-214   AC A0A0G2HNQ7.1
#=GS K0KUA6_WICCF/15-175       AC K0KUA6.1
#=GS I1H1P3_BRADI/3-165        AC I1H1P3.1
#=GS U5GDA8_POPTR/33-124       AC U5GDA8.1
#=GS H2N7E1_PONAB/19-176       AC H2N7E1.1
#=GS K7H0X5_CAEJA/52-236       AC K7H0X5.1
#=GS U6MKH2_9EIME/136-300      AC U6MKH2.1
#=GS F0ULM3_AJEC8/21-214       AC F0ULM3.1
#=GS A0A024VIV8_PLAFA/160-331  AC A0A024VIV8.1
#=GS A0A0N4ZGG7_PARTI/6-171    AC A0A0N4ZGG7.1
#=GS M0T4J1_MUSAM/3-166        AC M0T4J1.1
#=GS A0A084QD51_9HYPO/25-192   AC A0A084QD51.1
#=GS W9WA46_9EURO/19-185       AC W9WA46.1
#=GS A0A0E0A4V4_9ORYZ/4-150    AC A0A0E0A4V4.1
#=GS H3CJ03_TETNG/10-177       AC H3CJ03.1
#=GS A0A0A1TWQ7_ENTIV/2-162    AC A0A0A1TWQ7.1
#=GS Q18942_CAEEL/10-175       AC Q18942.1
#=GS F7GLJ8_MONDO/12-196       AC F7GLJ8.1
#=GS A0A0L1JFH0_ASPNO/21-209   AC A0A0L1JFH0.1
#=GS A0A096MRX0_PAPAN/10-175   AC A0A096MRX0.1
#=GS C5DR46_ZYGRC/14-208       AC C5DR46.1
#=GS A0A024TH67_9STRA/55-219   AC A0A024TH67.1
#=GS PR38A_MOUSE/10-175        AC Q4FK66.1
#=GS F4PGM1_DICFS/1-133        AC F4PGM1.1
#=GS A0A094CWW4_9PEZI/22-189   AC A0A094CWW4.1
#=GS M1VHD9_CYAME/26-187       AC M1VHD9.1
#=GS A0A0N5BNF5_STREA/30-211   AC A0A0N5BNF5.1
#=GS M7TF93_EUTLA/22-189       AC M7TF93.1
#=GS A0A0K0FMJ1_9BILA/30-211   AC A0A0K0FMJ1.1
#=GS W5DV57_WHEAT/3-53         AC W5DV57.1
#=GS A0A086TDT6_ACRCH/24-191   AC A0A086TDT6.1
#=GS K6VGZ7_9APIC/165-327      AC K6VGZ7.1
#=GS Q2U457_ASPOR/21-209       AC Q2U457.1
#=GS B7P4Y8_IXOSC/14-198       AC B7P4Y8.1
#=GS E9GQD3_DAPPU/32-216       AC E9GQD3.1
#=GS J4DQ33_THEOR/129-289      AC J4DQ33.1
#=GS C5L5B5_PERM5/95-139       AC C5L5B5.1
#=GS F0ZBH7_DICPU/5-166        AC F0ZBH7.1
#=GS B6TYH0_MAIZE/10-175       AC B6TYH0.1
#=GS A0A0A0LFY3_CUCSA/10-175   AC A0A0A0LFY3.1
#=GS A0A0N4TPH1_BRUPA/47-231   AC A0A0N4TPH1.1
#=GS S9XCT7_9CETA/1-124        AC S9XCT7.1
#=GS A0A017SNM0_9EURO/21-202   AC A0A017SNM0.1
#=GS G5AX24_HETGA/10-161       AC G5AX24.1
#=GS E1GF58_LOALO/10-175       AC E1GF58.2
#=GS A0A068XCD3_HYMMI/10-175   AC A0A068XCD3.1
#=GS A0A077Z5Z3_TRITR/438-620  AC A0A077Z5Z3.1
#=GS A0A0F2MLM3_SPOSC/26-192   AC A0A0F2MLM3.1
#=GS E9GW90_DAPPU/10-175       AC E9GW90.1
#=GS Q6BW00_DEBHA/13-188       AC Q6BW00.1
#=GS I1BHD0_RHIO9/11-174       AC I1BHD0.1
#=GS A0A061GG73_THECC/10-175   AC A0A061GG73.1
#=GS F6UK93_HORSE/47-231       AC F6UK93.1
#=GS M2XT21_GALSU/10-174       AC M2XT21.1
#=GS A7TN57_VANPO/14-211       AC A7TN57.1
#=GS W4WLI1_ATTCE/10-175       AC W4WLI1.1
#=GS T1EDF2_HELRO/10-175       AC T1EDF2.1
#=GS A0A0M0KXG3_9EUKA/15-172   AC A0A0M0KXG3.1
#=GS A7SXQ7_NEMVE/10-175       AC A7SXQ7.1
#=GS H1VMK2_COLHI/24-191       AC H1VMK2.1
#=GS B7S4A9_PHATC/10-166       AC B7S4A9.1
#=GS A0A0E0L7N7_ORYPU/101-262  AC A0A0E0L7N7.1
#=GS A0A067CBH5_SAPPC/9-173    AC A0A067CBH5.1
#=GS E3N791_CAERE/10-175       AC E3N791.1
#=GS A0A0L0BU41_LUCCU/26-210   AC A0A0L0BU41.1
#=GS G1LRX0_AILME/10-175       AC G1LRX0.1
#=GS E7KCV7_YEASA/15-219       AC E7KCV7.1
#=GS D8R3L1_SELML/5-169        AC D8R3L1.1
#=GS Q17D08_AEDAE/10-175       AC Q17D08.1
#=GS J3MB67_ORYBR/4-166        AC J3MB67.1
#=GS S9WUU7_9TRYP/1-95         AC S9WUU7.1
#=GS A0A0D3C5H0_BRAOL/10-175   AC A0A0D3C5H0.1
#=GS E7LUN2_YEASV/15-219       AC E7LUN2.1
#=GS A0A0M9EYH7_9HYPO/26-192   AC A0A0M9EYH7.1
#=GS A0A067QAN7_9HOMO/10-173   AC A0A067QAN7.1
#=GS B0WBK3_CULQU/28-154       AC B0WBK3.1
#=GS D7LFT1_ARALL/10-175       AC D7LFT1.1
#=GS A0A0N4XCA9_NIPBR/461-626  AC A0A0N4XCA9.1
#=GS C4R8X3_PICPG/19-184       AC C4R8X3.1
#=GS E1ZNW2_CHLVA/10-175       AC E1ZNW2.1
#=GS U6LKK7_9EIME/85-141       AC U6LKK7.1
#=GS E5S6X1_TRISP/427-610      AC E5S6X1.1
#=GS A9RSQ4_PHYPA/6-170        AC A9RSQ4.1
#=GS A0A0G4L1S5_9PEZI/26-193   AC A0A0G4L1S5.1
#=GS G3PQV2_GASAC/24-208       AC G3PQV2.1
#=GS K9FM30_PEND2/21-204       AC K9FM30.1
#=GS U7PR73_SPOS1/26-192       AC U7PR73.1
#=GS A0A067DBD0_CITSI/1-27     AC A0A067DBD0.1
#=GS D8LU65_ECTSI/4-146        AC D8LU65.1
#=GS Q4WUN3_ASPFU/34-222       AC Q4WUN3.1
#=GS H2PZJ2_PANTR/47-231       AC H2PZJ2.1
#=GS K2R9I0_MACPH/20-208       AC K2R9I0.1
#=GS A0A067GPW5_CITSI/2-84     AC A0A067GPW5.1
#=GS F1S580_PIG/50-234         AC F1S580.1
#=GS V7BIY7_PHAVU/10-175       AC V7BIY7.1
#=GS H3G9C3_PHYRM/9-173        AC H3G9C3.1
#=GS F6ZP02_CIOIN/10-175       AC F6ZP02.2
#=GS X0BDR0_FUSOX/26-192       AC X0BDR0.1
#=GS A0A091CPG3_FUKDA/10-175   AC A0A091CPG3.1
#=GS A0CFN0_PARTE/86-247       AC A0CFN0.1
#=GS V4NLP3_EUTSA/4-168        AC V4NLP3.1
#=GS L9KRH9_TUPCH/54-238       AC L9KRH9.1
#=GS A0A0M9VNM6_9BASI/10-174   AC A0A0M9VNM6.1
#=GS K4BPW0_SOLLC/5-167        AC K4BPW0.1
#=GS A0A061DDF0_BABBI/167-343  AC A0A061DDF0.1
#=GS E4UUK9_ARTGP/21-208       AC E4UUK9.1
#=GS A0A0P7UWJ7_9TELE/10-175   AC A0A0P7UWJ7.1
#=GS W4W0X9_ATTCE/37-225       AC W4W0X9.1
#=GS Q0CIC3_ASPTN/21-209       AC Q0CIC3.1
#=GS C1ML42_MICPC/10-175       AC C1ML42.1
#=GS A0A0C2IZB7_THEKT/10-175   AC A0A0C2IZB7.1
#=GS K3ZVF4_SETIT/1-99         AC K3ZVF4.1
#=GS G6DFN0_DANPL/10-175       AC G6DFN0.1
#=GS F7AMT8_CALJA/47-190       AC F7AMT8.1
#=GS A0A0D2US18_GOSRA/10-175   AC A0A0D2US18.1
#=GS B3LAT7_PLAKH/162-322      AC B3LAT7.1
#=GS A0A0F4ZI01_9PEZI/24-191   AC A0A0F4ZI01.1
#=GS E7QER7_YEASZ/15-219       AC E7QER7.1
#=GS E2B9R7_HARSA/37-220       AC E2B9R7.1
#=GS U3JJ31_FICAL/50-200       AC U3JJ31.1
#=GS U3IDW8_ANAPL/1-111        AC U3IDW8.1
#=GS S9VCB1_9TRYP/46-244       AC S9VCB1.1
#=GS H9JWH7_BOMMO/10-175       AC H9JWH7.1
#=GS A0A0L1L023_9EUGL/103-269  AC A0A0L1L023.1
#=GS M0Z3R6_HORVD/3-165        AC M0Z3R6.1
#=GS Q4YX53_PLABA/179-341      AC Q4YX53.1
#=GS A0A078JHH0_BRANA/4-168    AC A0A078JHH0.1
#=GS A0A0E0L7N6_ORYPU/101-262  AC A0A0E0L7N6.1
#=GS E6ZP67_SPORE/10-174       AC E6ZP67.1
#=GS B3SEX8_TRIAD/10-175       AC B3SEX8.1
#=GS B8NUH3_ASPFN/21-209       AC B8NUH3.1
#=GS N6TV19_DENPD/10-175       AC N6TV19.1
#=GS A0A0N5AD73_9BILA/46-230   AC A0A0N5AD73.1
#=GS A0A078F0Q5_BRANA/10-175   AC A0A078F0Q5.1
#=GS A0A067K8T2_JATCU/1-123    AC A0A067K8T2.1
#=GS D6WU66_TRICA/10-175       AC D6WU66.1
#=GS A0A093ZLY5_9PEZI/22-189   AC A0A093ZLY5.1
#=GS Q7RLR8_PLAYO/1-56         AC Q7RLR8.1
#=GS M7YZV4_TRIUA/100-177      AC M7YZV4.1
#=GS S9X1J3_9CETA/10-175       AC S9X1J3.1
#=GS X2JF51_DROME/24-141       AC X2JF51.1
#=GS E6X8B2_CELAD/97-274       AC E6X8B2.1
#=GS A0A022QWG5_ERYGU/5-166    AC A0A022QWG5.1
#=GS A0A096Q427_MAIZE/1-86     AC A0A096Q427.1
#=GS A0A078GCR5_BRANA/10-175   AC A0A078GCR5.1
#=GS Q86IV3_DICDI/48-212       AC Q86IV3.1
#=GS A0A094FSS4_9PEZI/22-189   AC A0A094FSS4.1
#=GS J9JZ53_ACYPI/30-214       AC J9JZ53.2
#=GS U4L199_PYROM/27-190       AC U4L199.1
#=GS W2R409_PHYPN/9-173        AC W2R409.1
#=GS A0A0N4X4R7_HAEPC/1-161    AC A0A0N4X4R7.1
#=GS V4T5N8_9ROSI/10-175       AC V4T5N8.1
#=GS K1Q5L4_CRAGI/7-191        AC K1Q5L4.1
#=GS A0A078CCT6_BRANA/4-168    AC A0A078CCT6.1
#=GS U3JST2_FICAL/1-134        AC U3JST2.1
#=GS M1C6B4_SOLTU/5-167        AC M1C6B4.1
#=GS X6NM44_RETFI/10-176       AC X6NM44.1
#=GS D3B1N8_POLPA/3-164        AC D3B1N8.1
#=GS G3TI91_LOXAF/47-231       AC G3TI91.1
#=GS A0A015NFA3_9GLOM/10-174   AC A0A015NFA3.1
#=GS B8C555_THAPS/10-167       AC B8C555.1
#=GS F6V7L2_ORNAN/39-223       AC F6V7L2.1
#=GS G3VXQ4_SARHA/1-133        AC G3VXQ4.1
#=GS A0A093YW19_9PEZI/22-189   AC A0A093YW19.1
#=GS A0A0M3ILB4_ASCLU/165-201  AC A0A0M3ILB4.1
#=GS F2UNQ1_SALR5/10-175       AC F2UNQ1.1
#=GS D8TND3_VOLCA/10-177       AC D8TND3.1
#=GS B9SR85_RICCO/3-167        AC B9SR85.1
#=GS A0A023BDW0_GRENI/56-217   AC A0A023BDW0.1
#=GS A0A0D3GCQ3_9ORYZ/4-150    AC A0A0D3GCQ3.1
#=GS U5HBW6_USTV1/10-174       AC U5HBW6.1
#=GS M5XQR0_PRUPE/1-124        AC M5XQR0.1
#=GS H2ARW2_KAZAF/14-209       AC H2ARW2.1
#=GS C4WV68_ACYPI/10-175       AC C4WV68.1
#=GS D8SIA0_SELML/5-72         AC D8SIA0.1
#=GS E2LWB8_MONPE/48-120       AC E2LWB8.1
#=GS M4DKE9_BRARP/10-175       AC M4DKE9.1
#=GS G4N721_MAGO7/23-190       AC G4N721.1
#=GS G1QM59_NOMLE/48-232       AC G1QM59.1
#=GS S8A531_DACHA/22-185       AC S8A531.1
#=GS G5BQU6_HETGA/49-233       AC G5BQU6.1
#=GS A0A091DHP7_FUKDA/10-70    AC A0A091DHP7.1
#=GS G7KFW5_MEDTR/3-166        AC G7KFW5.1
#=GS H0XNF3_OTOGA/49-233       AC H0XNF3.1
#=GS G3JII3_CORMM/24-191       AC G3JII3.1
#=GS A0A0G2JEW4_MOUSE/48-138   AC A0A0G2JEW4.1
#=GS B4L223_DROMO/28-212       AC B4L223.1
#=GS R0K0D1_SETT2/23-218       AC R0K0D1.1
#=GS Q29IQ7_DROPS/30-214       AC Q29IQ7.2
#=GS G7E6U1_MIXOS/10-174       AC G7E6U1.1
#=GS B7FY05_PHATC/41-205       AC B7FY05.1
#=GS Q4XAT0_PLACH/10-175       AC Q4XAT0.1
#=GS F7ALV5_CALJA/25-209       AC F7ALV5.1
#=GS A0A0K0J8G0_BRUMA/10-175   AC A0A0K0J8G0.1
#=GS A1DES8_NEOFI/21-209       AC A1DES8.1
#=GS B3MDH3_DROAN/10-175       AC B3MDH3.1
#=GS M7YUL5_TRIUA/10-175       AC M7YUL5.1
#=GS W5AB44_WHEAT/3-166        AC W5AB44.1
#=GS C1FDQ5_MICSR/10-174       AC C1FDQ5.1
#=GS A0A0E0KZ63_ORYPU/3-166    AC A0A0E0KZ63.1
#=GS A0A024UKU5_9STRA/9-173    AC A0A024UKU5.1
#=GS A8IDN7_CHLRE/1-167        AC A8IDN7.1
#=GS U1GVC6_ENDPU/20-185       AC U1GVC6.1
#=GS M2Y140_GALSU/5-87         AC M2Y140.1
#=GS G3N166_BOVIN/47-231       AC G3N166.1
#=GS A0A0B2UEZ7_9MICR/2-161    AC A0A0B2UEZ7.1
#=GS W5DUT1_WHEAT/1-85         AC W5DUT1.1
#=GS A7APG3_BABBO/171-333      AC A7APG3.1
#=GS T1HNK6_RHOPR/10-175       AC T1HNK6.1
#=GS W4GR42_9STRA/57-221       AC W4GR42.1
#=GS Q4N1F1_THEPA/128-239      AC Q4N1F1.1
#=GS PR38A_BOVIN/10-175        AC Q0P5I6.1
#=GS L0B1D3_THEEQ/121-233      AC L0B1D3.1
#=GS Q7JVL3_DROME/10-175       AC Q7JVL3.1
#=GS A0A0Q9WI28_DROVI/1-69     AC A0A0Q9WI28.1
#=GS B6HM45_PENRW/21-204       AC B6HM45.1
#=GS W7AWH2_PLAVN/10-175       AC W7AWH2.1
#=GS L5K4Z1_PTEAL/49-233       AC L5K4Z1.1
#=GS K6UDH3_9APIC/43-122       AC K6UDH3.1
#=GS T1EG64_HELRO/7-191        AC T1EG64.1
#=GS D8TKN7_VOLCA/1-167        AC D8TKN7.1
#=GS A0A0J8FEL6_BETVU/10-175   AC A0A0J8FEL6.1
#=GS A0A068Y424_ECHMU/1-99     AC A0A068Y424.1
#=GS A0A0A0KT86_CUCSA/8-91     AC A0A0A0KT86.1
#=GS I1LB75_SOYBN/10-175       AC I1LB75.1
#=GS E1C6A8_CHICK/10-175       AC E1C6A8.1
#=GS A5DTV1_LODEL/38-215       AC A5DTV1.1
#=GS A8IJK3_CHLRE/10-175       AC A8IJK3.1
#=GS L2GTU9_VAVCU/4-152        AC L2GTU9.1
#=GS I1NJ40_SOYBN/10-175       AC I1NJ40.1
#=GS K7V8Q5_MAIZE/76-246       AC K7V8Q5.1
#=GS M1CAV6_SOLTU/10-175       AC M1CAV6.1
#=GS A0A0N5C737_STREA/6-171    AC A0A0N5C737.1
#=GS W1NQE5_AMBTC/3-166        AC W1NQE5.1
#=GS W3XIF8_9PEZI/20-186       AC W3XIF8.1
#=GS A0A068SG10_9FUNG/10-173   AC A0A068SG10.1
#=GS E2AHT2_CAMFO/35-218       AC E2AHT2.1
#=GS M7U0A7_BOTF1/21-188       AC M7U0A7.1
#=GS B4ME55_DROVI/10-175       AC B4ME55.1
#=GS I3MQ15_ICTTR/10-175       AC I3MQ15.1
#=GS H2ZFB4_CIOSA/10-175       AC H2ZFB4.1
#=GS Q57XW0_TRYB2/205-343      AC Q57XW0.1
#=GS A5DGC7_PICGU/7-183        AC A5DGC7.1
#=GS D8T1B4_SELML/10-168       AC D8T1B4.1
#=GS A0A023B5L5_GRENI/10-174   AC A0A023B5L5.1
#=GS U6KXF4_EIMTE/120-282      AC U6KXF4.1
#=GS U9UJB9_RHIID/7-167        AC U9UJB9.1
#=GS W5MMD1_LEPOC/32-216       AC W5MMD1.1
#=GS A0A0A1NZQ0_9FUNG/11-122   AC A0A0A1NZQ0.1
#=GS E0VES7_PEDHC/10-175       AC E0VES7.1
#=GS J9NZD6_CANLF/48-232       AC J9NZD6.1
#=GS A0A096RF19_MAIZE/1-55     AC A0A096RF19.1
#=GS A0A067K178_JATCU/3-166    AC A0A067K178.1
#=GS K2N6A4_TRYCR/38-206       AC K2N6A4.1
#=GS A0A087XEK0_POEFO/10-175   AC A0A087XEK0.2
#=GS A0A0M0K198_9EUKA/55-233   AC A0A0M0K198.1
#=GS V9ES07_PHYPR/9-173        AC V9ES07.1
#=GS A7RN21_NEMVE/18-202       AC A7RN21.1
#=GS A0A078DXJ9_BRANA/10-198   AC A0A078DXJ9.1
#=GS L1ICQ1_GUITH/10-169       AC L1ICQ1.1
#=GS C1H036_PARBA/21-214       AC C1H036.2
#=GS A0A0P7V7J0_9TELE/41-225   AC A0A0P7V7J0.1
#=GS A0A0F8DAS5_CERFI/24-191   AC A0A0F8DAS5.1
#=GS C5K8A2_PERM5/121-216      AC C5K8A2.1
#=GS A8X281_CAEBR/57-204       AC A8X281.2
#=GS H3DCW8_TETNG/25-209       AC H3DCW8.1
#=GS G5C765_HETGA/85-176       AC G5C765.1
#=GS C4LZA0_ENTHI/2-162        AC C4LZA0.1
#=GS A2Q158_MEDTR/10-175       AC A2Q158.1
#=GS G1S8M8_NOMLE/1-148        AC G1S8M8.1
#=GS Q28XW5_DROPS/10-175       AC Q28XW5.2
#=GS F7G6K1_MONDO/12-177       AC F7G6K1.1
#=GS A9TDL8_PHYPA/6-170        AC A9TDL8.1
#=GS A0A0L6VIQ5_9BASI/10-176   AC A0A0L6VIQ5.1
#=GS G3Y0M7_ASPNA/21-209       AC G3Y0M7.1
#=GS Q59WJ8_CANAL/17-194       AC Q59WJ8.1
#=GS I1EAR9_AMPQE/1-144        AC I1EAR9.1
#=GS A8X8F6_CAEBR/10-175       AC A8X8F6.1
#=GS A0A094AGC6_9PEZI/22-189   AC A0A094AGC6.1
#=GS A0A0M3JW10_ANISI/46-229   AC A0A0M3JW10.1
#=GS F6QPW1_MACMU/47-231       AC F6QPW1.1
#=GS J3M4G7_ORYBR/3-166        AC J3M4G7.1
#=GS E5A0N9_LEPMJ/24-234       AC E5A0N9.1
#=GS U6PD84_HAECO/69-253       AC U6PD84.1
#=GS M1W229_CLAP2/24-191       AC M1W229.1
#=GS L1J4V0_GUITH/160-321      AC L1J4V0.1
#=GS W2QD97_PHYPN/37-201       AC W2QD97.1
#=GS A0A059LRU5_9CHLO/10-175   AC A0A059LRU5.1
#=GS A0A0A1N932_9FUNG/9-173    AC A0A0A1N932.1
#=GS F6HI04_VITVI/3-166        AC F6HI04.1
#=GS C5X6Q2_SORBI/10-175       AC C5X6Q2.1
#=GS A0A0B0P1S4_GOSAR/10-175   AC A0A0B0P1S4.1
#=GS A0A088A0G8_APIME/10-175   AC A0A088A0G8.1
#=GS A0A0H5C1I8_CYBJA/16-169   AC A0A0H5C1I8.1
#=GS R9P9R0_PSEHS/10-175       AC R9P9R0.1
#=GS G3BAA6_CANTC/7-180        AC G3BAA6.1
#=GS U5CUR3_AMBTC/1-70         AC U5CUR3.1
#=GS A0A0F8UXB5_9EURO/21-212   AC A0A0F8UXB5.1
#=GS E5RYR9_TRISP/10-175       AC E5RYR9.1
#=GS D7FPC2_ECTSI/167-227      AC D7FPC2.1
#=GS A0A0Q9WN88_DROMO/1-69     AC A0A0Q9WN88.1
#=GS E1BVP9_CHICK/50-234       AC E1BVP9.2
#=GS T1KXQ5_TETUR/61-245       AC T1KXQ5.1
#=GS D5GP15_TUBMM/20-183       AC D5GP15.1
#=GS A0A0L7LKK1_9NEOP/87-152   AC A0A0L7LKK1.1
#=GS W5AKT7_WHEAT/3-166        AC W5AKT7.1
#=GS J7RRK2_KAZNA/15-210       AC J7RRK2.1
#=GS K1WAK9_MARBU/21-188       AC K1WAK9.1
#=GS T1JGX1_STRMM/10-175       AC T1JGX1.1
#=GS A0A0D2T6W8_GOSRA/10-175   AC A0A0D2T6W8.1
#=GS S8ESL2_FOMPI/10-173       AC S8ESL2.1
#=GS W7X6X1_TETTS/10-175       AC W7X6X1.1
#=GS A9UQL8_MONBE/10-172       AC A9UQL8.1
#=GS E9EM03_METRA/24-191       AC E9EM03.2
#=GS A0A0B4GRE7_9HYPO/24-191   AC A0A0B4GRE7.1
#=GS A0A0N4X5Z2_HAEPC/70-254   AC A0A0N4X5Z2.1
#=GS C5K487_PERM5/83-217       AC C5K487.1
#=GS A0A024VK41_PLAFA/10-82    AC A0A024VK41.1
#=GS G1SEF5_RABIT/10-175       AC G1SEF5.1
#=GS Q54J00_DICDI/3-165        AC Q54J00.2
#=GS A0A059LNV7_9CHLO/42-209   AC A0A059LNV7.1
#=GS I3LP32_PIG/10-97          AC I3LP32.1
#=GS A0A0D9WLP6_9ORYZ/3-166    AC A0A0D9WLP6.1
#=GS X0J3G6_FUSOX/26-192       AC X0J3G6.1
#=GS A0A0M8P2W3_9EURO/73-256   AC A0A0M8P2W3.1
#=GS A0A096RF20_MAIZE/2-80     AC A0A096RF20.1
#=GS K3ZF04_SETIT/3-166        AC K3ZF04.1
#=GS I3JV42_ORENI/25-209       AC I3JV42.1
#=GS W7AKF8_9APIC/252-414      AC W7AKF8.1
#=GS M0X6G8_HORVD/3-153        AC M0X6G8.1
#=GS G1THN5_RABIT/1-139        AC G1THN5.2
#=GS B2ATX0_PODAN/63-230       AC B2ATX0.1
#=GS V8PH37_OPHHA/10-175       AC V8PH37.1
#=GS A0A0F9XUE7_TRIHA/26-193   AC A0A0F9XUE7.1
#=GS W5P5R7_SHEEP/10-175       AC W5P5R7.1
#=GS A0A0K0DK53_ANGCA/45-229   AC A0A0K0DK53.1
#=GS Q69K06_ORYSJ/10-175       AC Q69K06.1
#=GS A0A099P229_PICKU/22-191   AC A0A099P229.1
#=GS A0A0D9M0R0_9EURO/21-204   AC A0A0D9M0R0.1
#=GS Q8IM21_PLAF7/173-335      AC Q8IM21.1
#=GS H2MLH7_ORYLA/25-209       AC H2MLH7.1
#=GS W5MME7_LEPOC/32-216       AC W5MME7.1
#=GS B4QGS9_DROSI/10-175       AC B4QGS9.1
#=GS V7BAP5_PHAVU/3-165        AC V7BAP5.1
#=GS D7FPC2_ECTSI/52-172       AC D7FPC2.1
#=GS Q7PMU1_ANOGA/45-223       AC Q7PMU1.4
#=GS A0A094E0S4_9PEZI/22-189   AC A0A094E0S4.1
#=GS A0A066WLJ0_9HOMO/10-172   AC A0A066WLJ0.1
#=GS B4IGQ6_DROSE/1-166        AC B4IGQ6.1
#=GS A0A094A3V8_9PEZI/1-139    AC A0A094A3V8.1
#=GS G3AGB8_SPAPN/17-194       AC G3AGB8.1
#=GS I1EKT3_AMPQE/1-78         AC I1EKT3.1
#=GS I1GG42_AMPQE/33-217       AC I1GG42.1
#=GS K6UDH3_9APIC/10-45        AC K6UDH3.1
#=GS B8P4M7_POSPM/8-160        AC B8P4M7.1
#=GS G8BDC4_CANPC/23-200       AC G8BDC4.1
#=GS A0A0D2USY9_GOSRA/10-175   AC A0A0D2USY9.1
#=GS G1N3A5_MELGA/1-182        AC G1N3A5.2
#=GS A0DJV2_PARTE/10-175       AC A0DJV2.1
#=GS L7JXS8_TRAHO/4-152        AC L7JXS8.1
#=GS F9X714_ZYMTI/19-186       AC F9X714.1
#=GS H2TYE2_TAKRU/22-164       AC H2TYE2.1
#=GS N6U570_DENPD/23-207       AC N6U570.1
#=GS I2H5J2_TETBL/16-212       AC I2H5J2.1
#=GS B4M6P8_DROVI/28-212       AC B4M6P8.1
#=GS A0A022R4J6_ERYGU/6-166    AC A0A022R4J6.1
#=GS V9DTB5_PHYPR/11-61        AC V9DTB5.1
#=GS R1EUR9_EMIHU/44-217       AC R1EUR9.1
#=GS Q7RLR7_PLAYO/177-256      AC Q7RLR7.1
#=GS A0A0M0UHW7_9PEZI/24-191   AC A0A0M0UHW7.1
#=GS B2WHZ6_PYRTR/23-234       AC B2WHZ6.1
#=GS A0A067BPW6_SAPPC/9-173    AC A0A067BPW6.1
#=GS C5LD14_PERM5/10-181       AC C5LD14.1
#=GS B4HSN2_DROSE/10-175       AC B4HSN2.1
#=GS A0A074Z976_9PEZI/19-183   AC A0A074Z976.1
#=GS C4M949_ENTHI/7-169        AC C4M949.1
#=GS I1JHT5_SOYBN/4-166        AC I1JHT5.1
#=GS A0A0D2P7T1_GOSRA/1-112    AC A0A0D2P7T1.1
#=GS R1F3N7_EMIHU/15-180       AC R1F3N7.1
#=GS A0A0N1PBP9_LEPSE/285-423  AC A0A0N1PBP9.1
#=GS J4C3Z9_THEOR/10-175       AC J4C3Z9.1
#=GS L5K6N9_PTEAL/10-175       AC L5K6N9.1
#=GS Q7SHZ0_NEUCR/24-191       AC Q7SHZ0.2
#=GS E7NHW7_YEASO/15-219       AC E7NHW7.1
#=GS D0NNV1_PHYIT/37-201       AC D0NNV1.1
#=GS G2R425_THITE/24-192       AC G2R425.1
#=GS A7ARD6_BABBO/10-175       AC A7ARD6.1
#=GS G4VNB2_SCHMA/10-175       AC G4VNB2.1
#=GS B0JYW3_XENTR/10-175       AC B0JYW3.1
#=GS E3KGQ2_PUCGT/10-176       AC E3KGQ2.1
#=GS A0A058ZG82_9EUKA/14-178   AC A0A058ZG82.1
#=GS A0A098VUZ7_9MICR/10-175   AC A0A098VUZ7.1
#=GS A0A0E0AZ81_9ORYZ/10-175   AC A0A0E0AZ81.1
#=GS H6BS57_EXODN/19-185       AC H6BS57.1
#=GS C5GJR6_AJEDR/21-214       AC C5GJR6.1
#=GS Q95Y35_CAEEL/55-239       AC Q95Y35.1
#=GS J9B997_WUCBA/47-231       AC J9B997.1
#=GS A0A074RWM6_9HOMO/10-173   AC A0A074RWM6.1
#=GS W7X5L5_TETTS/175-341      AC W7X5L5.1
#=GS A0A0B2VGD8_TOXCA/46-230   AC A0A0B2VGD8.1
E9AIG4_LEIBR/4-153                   .........................................nlkgra-------AIAALDPPTRHRVLH..S.QTMT-RCANKPL................................-LWVLEELTT-..LRSLGG..............-LTG.PLH.............................................RA.NYFICLVVRL.LQICPSVA..........IAR.VMLE...............................................QDVHK..YLRAAALL....L...I.....RFIGN........................MELQ....RE.AMH.....VG..WSDYR.KLCLYGSDP..............-----....------------.---.......-----...--..-..---------------aqewkestsatvagaggmatdtfr.............................................
A0A0G2JGW4_MOUSE/48-93               ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIY--..------..............----.---.............................................--.----------.--------..........---.----...............................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------fk...................................................................
B0WBK2_CULQU/28-212                  ..............................................l-PLWGNESTMNLNPLILANIQG..S.SYFKVSLFKLKT................................YHEVVDEIYYQ..VKHLEP..............WERG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAFCLLYKL.YTLRLTRK..........QVN.GLLT...............................................HTDSP..YIRALGFM....Y...L.....RYTQP........................PADL....YD.WYE.....EY..LLDEE.---------..............EIDVKa..gGGQSITIGLMCR.QFL.......TKLDW...FS..T..LFPRIPVPIQKQIQ-q....................................................................
B9H3J6_POPTR/3-167                   .............................................vq--TNGKPIDSLFEKVLCMNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDNVEP..............WMTG.NCR.............................................GP.STSFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HKDSP..YIRAVGFL....Y...L.....RYAGD........................PKTL....WN.WFE.....PY..IKDDE.---------..............EFSPG...sSGRKTTIGIYVR.DLL.......LGQYY...FD..T..LFPRIPVPVLR----qita.................................................................
A0A074XVB6_AURPU/19-183              .............................................tl--IRGQNPLLLFEKAVRDRIID..S.YYWKEQCFGLNA................................-ATLCDRAVE-..LSFIGG..............-TYG.IGQ.............................................KP.TPFLCLAFKL.LQLTPEKD..........IIL.HYLR...............................................QEEWK..YLRALAAF....Y...I.....RLTWE........................PKDI....YE.TLE.....GY..LSDYR.KLKRRTRDG..............-----....-YQLSYVDQFVD.DLL.......TKDRV...CA..T..SLWKMPSRTQLED--id...................................................................
A0A067DF16_CITSI/4-97                .......................................iqtcgkpi--------DSLLEKVLCMNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRA----....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------.....................................................................
I0Z2X4_9CHLO/2-166                   ............................................eqy----GNTATFNVESVLQKNIVN..S.EYYRDTCMKLGT................................WEEVVDEIYYS..VQDVEP..............WMSG.NAR.............................................GA.SSAFCLLYRL.FTLVPSKP..........QIK.NLLD...............................................HTDSP..YIRAVGFL....Y...L.....RYAAN........................PRTL....WE.WIQ.....PY..VRDSE.---------..............EIDPSp.egHGKTVTMGEFVR.DVF.......LEQYY...FE..T..IFPRIPKPVH-----ddf..................................................................
K7JAP2_NASVI/32-188                  ..............................................l-PLWGNERTMNLNPLILTNIQS..S.HYFKVNLYELKT................................YHEVIDEIYYK..VSHLEP..............WEKG.SRK.............................................TA.G---------.-QTGMCGG..........QLN.GLIN...............................................HPDSP..YIRALGFM....Y...I.....RYTQP........................PPDL....FS.WYD.....DY..LEDEE.---------..............ELDVKa..gGGQVMKMGDILK.QFL.......TKLEW...FS..T..LFPRIPVPIQKEL--eq...................................................................
PR38A_DANRE/10-175                   ..............................................n-SVHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LKFVGG..............-VYG.GNV.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRLLGAM....Y...M.....RLTGT........................SVDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HAERM...CD..I..ILPRLQKRQVLEEA-e....................................................................
G0W4U6_NAUDC/16-222                  ...............................................KQLNNSSVSLVIPRITRDKIHN..S.IYYKVNLTSQSLrg............................ntMVQLIQVIVRD..FGKLKSqshshssdtmvvrnHLV-.---.............................................GG.TEFKCLLMKI.IELKPTIE..........QIW.ILLEdh..........................................ddtEFDNK..YITVLIIT....Y...I.....RIQYFfigk................ndslARKF....QD.IFQ.....KC..LNNYT.KLKCFQLDAdcw.......spslSLSEE....SVRIIYMDEVVD.WLL.......TKDNI...WG..I..PLGKCQWVAE-----igav.................................................................
C5FIK5_ARTOC/25-209                  .........................................vnpatl----------------------..-.--FEKACFGLNA................................-ATLCDRAVE-..LTYIGG..............-TYG.VGQ.............................................KP.TPFLCLAFKL.LQLAPERD..........VIL.EYLNfhdpeadkeensgdggnnp........gadddpddaqdkadaailkaTGDFK..YLRALAAF....Y...V.....RLTFE........................PVEI....YK.TLE.....PL..LMDYR.KLKRRTKEG..............-----....-FLLTHMDQFVD.DLL.......TKDRV...CG..T..SLWKIPARTMLEDL-d....................................................................
A5K1F2_PLAVS/159-321                 ............................................lem----TNTTTYNVNTLLRNNILS..S.EYFR-SLVPLKT................................FKEVVDEIHLY..ADHVEP..............YCIG.STR.............................................AP.STLFCCLYKL.FTMHLSEK..........QMK.MLIE...............................................SRDSC..YIRACGFL....Y...L.....RYVHS........................PANL....WM.WFE.....PY..LLDED.--QFVT---..............----Sa..dKRKKQTIGEYIQ.CLL.......ADDKY...FN..T..VLPRMPIKIK-----nty..................................................................
C5K6I2_PERM5/108-276                 ............................................vvv----NQGPLYGLYPTLVQNIQS..S.DYFNKGLRGMST................................VEEVVEEVERA..VEHAEP..............YNVG.ALN.............................................IP.STMFCCLYKL.CSKGQARP..........SWS.LSLG...............................................TASRR..YVVCLGLL....Y...L.....RCVAQ........................PSSL....WT.WFY.....PV..LFDTT.VFHPEEV--..............TGEAQ....AAESMMLGRYAE.LLL.......LTHKY...FT..V..NLNRLPETIL-----qky..................................................................
PRP38_ARATH/10-175                   ...............................................KNIRGTNPQNLVEKIVRTKIYQ..H.TFWKEQCFGLTA................................-ETLVDKAME-..LDHLGG..............-TFG.GSR.............................................KP.TPFLCLILKM.LQIQPEKE..........IVV.EFIK...............................................NDDYK..YVRILGAF....Y...L.....RLTGT........................DVDV....YR.YLE.....PL..YNDYR.KVRQKLSDG..............-----....KFSLTHVDEVIE.ELL.......TKDYS...CD..I..AMPRLKKRWTLEQN-g....................................................................
A0A0F7TUV8_9EURO/21-204              ..............................................l--VRGVNPVTLFEKAVRDRITD..S.YYWKEQCFGLNA................................-ATLCDRAVE-..LSFVGG..............-TYG.VSE.............................................KP.SPFLCLAFKL.LQLNPSKD..........IIL.EYLNfsdpgsddeg...........................dnpdnailqtRGDFK..YLRVLAAF....Y...V.....RLTFN........................AVDV....YK.TLE.....PL..LLDYR.KIKRRVRDA..............-----....-YTLTYVDQFVD.DLL.......TKDRV...CG..T..SLWKLPPRQQLEDL-e....................................................................
K7H0X6_CAEJA/52-236                  ..............................................l-PIWGNQVTMNLNTLVLENIRE..S.YYYKNNLIEIDS................................FQALVEQIFYQ..VKHLEP..............WEKG.TRRlqgmtgmcg...........................gvrgvgaggVV.SSAFCILYRL.FNLRMTRK..........QLI.SMLN...............................................SRQSV..YIRGIGFM....Y...I.....RYTQP........................PSDL....WY.WLE.....PY..LDDES.---------..............EIDPRs..gGGDCMTFGMMVR.TMI.......NKLDW...YG..T..LFPRIPVPIQKEID-e....................................................................
D3BAL0_POLPA/154-210                 ...............................................----------------------..-.------------................................-----------..------..............----.---.............................................--.----------.--------..........---.----...............................................-----..--------....-...-.....-----........................----....-K.YLE.....PL..YNDYR.TIRLQLDIG..............-----....-YRKLSMDEFVE.ELL.......TTNYS...LD..I..ALPHLPPRSSLEA--na...................................................................
A0A067RRD2_ZOONE/10-175              ..............................................k-SVRGTNPQYLIEKIIRSRIYD..C.KYWKEECFALSA................................-ELLVDKAME-..LRFLGG..............-VYG.GNI.............................................KP.TPFLCLVLKM.LQIQPEKD..........IIV.EFIK...............................................NEEFK..YVRALGAT....Y...M.....RLVGT........................SLDC....YK.YLE.....PL..FNDSR.KLRRQNRQG..............-----....QFELIHMDEFID.ELL.......REERL...CD..I..ILPRIQKRHVLEEN-n....................................................................
S6EYV6_ZYGB2/14-210                  ...............................................KQLNHQSVSLVIPRIARDKIHN..A.MYYRVNLNTVSLrg............................dtIECLSKVIVRD..LGSLAEpvs.......fqqvHVLG.GIE.............................................--.--FQCLLMKL.VEIRPTWD..........QLE.VMLQed...........................................ntGFNNK..YIVGLILA....Y...I.....RIQYYflqv................edplAQRF....RV.LFK.....HY..YNDYR.KMKSVLFDQdc..........wtKSQTV....SVNILHMDELVE.WLL.......EREEI...WG..I..PLGKCQWKELE----esss.................................................................
M2MPP1_BAUCO/19-184                  .............................................rl--IRGDNPLKLFEKAVRDRIID..S.YYWKEQCFGLNA................................-ATILDRATE-..LTFIGG..............-TYG.VAQ.............................................KP.TPFLCLAFKL.LQIVPDKE..........IIL.FYLE...............................................QEEFK..YLRALAAF....Y...I.....RLAWE.......................kDEEV....YT.TLE.....PY..LSDAR.KLKRRTREG..............-----....-WALTHVDEFID.DLL.......IKGRL...CA..T..TLPKINPRLFLEDE-d....................................................................
K1W8G5_TRIAC/59-194                  ........................................srhgpaa----------------------..-.------------................................-ESLIDKAIA-..LHAIGG..............-VYD.-RQ.............................................TP.TPFMCLLLKL.LQIQPEKE..........ILF.EYLL...............................................AEEFK..YLRALAAM....Y...I.....RLTFR........................SIEV....YE.ILE.....PL..MKDYR.KLRYRQVGG..............-----....-YYLTTFDEFID.DLL.......TQDRV...CD..I..ILPRLTQRSVLEE--ve...................................................................
S0DNK7_GIBF5/26-192                  .............................................ap---NGLNPATIMEKAVKDRIVD..S.YFYKEQCFALNE................................-ADIVDRVVEH..VNFIGG..............-TYG.VTQ.............................................KP.SPFLCLAFKL.LELSPSDA..........VLM.EYLKy.............................................gGEAFK..YLRALACF....Y...F.....RLTRQ........................AKDV....YE.MLE.....PF..LEDRR.KLRRRGRAG..............-----....-VVLTFMDEFVD.ELL.......TKERV...CG..T..SLWKMPKREVLEDL-e....................................................................
A0A0N1NXL0_9EURO/19-185              .............................................pl--IRGQNPALLIETATRDRITD..S.LYWKEQCFGLNA................................-ATLLDRAVE-..LTYIGG..............-TYG.VGM.............................................KP.TPFLCLAFKL.LTIVPDRD..........IVL.EYLNr.............................................gGDEWK..YLRALAAF....Y...V.....RLTFA........................PTEV....YK.TLE.....PF..LEDSR.KLRRRRKEA..............-----....-YVLTYMDEFVD.ELL.......TKKRS...MG..T..ALWELPSRQALEDL-d....................................................................
W6Q0P6_PENRO/21-204                  ..............................................l--VRGVNPATLFEKAVRDRITD..S.YYWKEQCFGLNA................................-ATLCDRAVE-..LTSIGG..............-TYG.VSE.............................................KP.TPFLCLAFKL.LQLGPDRE..........VIL.ELLNytdpgsgdea...........................edpddalvkeRGDFK..YLRALAAF....Y...V.....RLTFD........................PVDV....YK.TLE.....PL..LLDYR.KLKRRVRDT..............-----....-FTLTYMDQFID.DLL.......TKDRV...CG..T..SLWKLPPRSQLEDL-d....................................................................
J9I2Y7_9SPIT/195-356                 ..........................................cdykn---------GNLPEMIRNTILS..C.QYFK-DLYNLKT................................FKEVIEEIKTH..VSYTEP..............WIVG.ANG.............................................VP.STLFCCLYKF.MLMRLNEK..........QVQ.TLLR...............................................YKLSP..YVRACGAL....Y...V.....RFLSP........................NDQL....FD.RLS.....PY..MLDEQ.---------..............SFSYSi..eKSQSLTFGEYVE.RLL.......SEKNY...FS..I..LLPRIPVI-------qfrelqk..............................................................
A0A093XH37_9PEZI/1-164               ..............................................g-----LNPATIFEKPVRERIID..C.YFWKDQCFALNE................................-ADIVSRVVEH..VQFVAG..............-TYG.DSQ.............................................RP.SPFLCLAFKL.LQLGPGDD..........ILK.EYLEy.............................................gGEKFK..YLRALACF....Y...V.....RLTRP........................AKEV....YE.TLE.....PF..LSDER.KLRRRGRQG..............-----....-TSLTFMDQFVD.ELL.......TKERV...CA..T..SLWKMPKREVLEDL-e....................................................................
G3I797_CRIGR/6-94                    ............................................vky---AHHNPQYMVEKIIRTRIYE..S.KYWKEESYGLTA................................-ELVVNKAME-..LRFVGV..............-VYG.GNI.............................................KP.TPFLGLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDF-..--------....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------ne...................................................................
A0A0E0PTE6_ORYRU/4-166               ........................................qssgrpi--------DVLMEKVLSVNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.SSAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAVGFL....Y...L.....RYVAE........................PKTL....WS.WYE.....PY..IKDDE.---------..............EFSPG...sNGKMTTMGVYVR.DLL.......LGQYY...FD..S..LLPRVPLPI------lrqvt................................................................
A0A0N5AFH1_9BILA/10-174              ..............................................s-TVKGTNPQYLVEKIIRTRIYD..S.KYWKEECFALTA................................-ELLVDKGME-..LRYVGG..............-IYA.GNV.............................................KP.TPFLCLCLKM.LQIQPEKD..........IVV.EFIS...............................................QEEYK..YIRALGAM....Y...L.....RLTFS........................SIEV....YK.YLE.....PL..YNDYR.KLRYMDKTG..............-----....HFELVHMDEFID.HLL.......RDERY...CD..I..QLPRLQKREALE---si...................................................................
H2MEA7_ORYLA/10-179                  ..............................................n-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTE................................MLIIFKRFENRgxXXFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRLLGAM....Y...M.....RLTGT........................AVDC....YK.YLE.....PL..YNDYR.KIKTQNRNG..............-----....EFELMHVDEFID.ELL.......HAERV...CD..I..ILPRLQRRQVLEEA-e....................................................................
A0A0D9WDE8_9ORYZ/3-166               ............................................iqt---SGKPIDLLMEKVLCMNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKIL....WT.WYE.....PY..LRDDE.---------..............EFSPG...sNGRMTTMGVYVR.DLV.......LGQYY...FD..S..LLPRVPLPVT-----rqvt.................................................................
Q756P8_ASHGO/14-224                  ...............................................KQLSNQSTSLVIPKIARLRIHN..S.MYYKINLYPTGLrg............................ntLKQLVRVLVRD..LGACKHrsg........pmlHICG.NTE.............................................--.--FQCLLMKV.IEIRPTWS..........QIY.TLLQlgde.......................................rktgKFNNK..YIAVLILV....Y...L.....RIQYYfladekaes.....fppeadgdvtAAKV....KA.LFA.....HF..LADYR.KVKCLDLEVdc..........wsGATQK....SVSVQHVDEIVD.WLC.......TKDSI...WG..I..PLGRCRWLAD-----vlead................................................................
A0A0N0DUZ1_9TRYP/258-435             .................................hfnfdaelwgvlaa----------------------..-.------------................................--KLTNDLVEE..VRACGR..............-TQD.TQQgngrlltaferheqdvaa........vlryceqkvhyagvfdddeEA.SPFLIAMGLC.WRLSLTMD..........DVC.RHFA...............................................RHPRR..VIRALALY....L...A.....RYVLA........................PEDY....VY.FFL.....PS..LTDEV.IIACTEDAQ..............-----....--VTYTMKDLSR.QLL.......TKNDI...VD..A..WLPMLAKY-------wqdqv................................................................
C5Z3V3_SORBI/3-166                   ...........................................iqss----GRSIEGLMEKVLSVNILS..S.DYFK-ELFKYKT................................YHEVVDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.SSAFCLLYKL.FTMKLTVK..........QMH.GLLK...............................................HQDSP..YIRAIGFL....Y...L.....RYVAE........................PKTL....WS.WYE.....PY..IKDGE.---------..............EFAPG...sNGKSTTMGVYVR.DLL.......LGQYY...FD..S..LLPRVPLPI------lrqvt................................................................
G4TPS2_PIRID/10-173                  ..............................................k-AIHGANPQSLVEEVIRLRIWE..S.AYWKEECFGLTA................................-VSLIDKAIK-..LSAIGG..............-VYD.NTK.............................................-P.TQFICLLLKL.LQIQPEKE..........ILV.EYLL...............................................VEEYK..YLRALAAM....Y...I.....RMTFG........................AAEV....YQ.LLE.....PL..LNDYR.KLRLLSMNG..............-----....-FSLTYMDEFVD.KLL.......TEDRV...CD..I..ILPRLPKREILEQ--te...................................................................
R8BK18_TOGMI/23-190                  ............................................lap---NGLNPATIMEKAVRERIVD..S.YFFKEQCFGVNE................................-ADVVDRVVEH..VSFVGG..............-TYG.GVQ.............................................KP.TPFLCLAFKL.LQLAPGDD..........VLA.EYLEy.............................................gGDKFK..YLRALAAF....Y...I.....RLTRQ........................AKEV....YT.MLE.....PY..LEDRR.KLRRKGRAG..............-----....-TSLTYVDEFID.DLL.......IKDRV...CG..T..SLWKMPKRDLLED--le...................................................................
M7NMD2_PNEMU/15-179                  ..............................................q-SIHSMNPVNLIEKIIRERILE..C.RYYKEMCFGLTA................................-ATICDRAVK-..MKYIGG..............-QY-.LNQ.............................................RP.TEFLCLTFKL.LQLQPEKE..........IIL.EYLY...............................................ANDFK..YLQALAAF....Y...I.....RLTFP........................AKEC....YL.ILE.....PF..LNDYR.KLRIRYSTG..............-----....LYGLSYIDEFVD.HLL.......NQERV...CD..I..ALPRLPTRFILEE--me...................................................................
A0A0L0N1A5_9HYPO/24-191              ............................................lap---NGLNPATIMEKAVKDRIVD..S.YFYKEQCFALNE................................-ADIVDRVVEH..VSFIGG..............-THG.AAQ.............................................KP.SPFLCLAFKL.LELSPSDA..........ILR.EYMAy.............................................gGEAFK..YLRALACF....Y...V.....RLTRQ........................AKDV....YE.TLE.....PY..LEDRR.RLRRRGRQG..............-----....-IRLTFVDEFVD.ELL.......TADRV...CA..T..SLWKMPKREILEDL-e....................................................................
W6MI80_9ASCO/16-181                  ..............................................a-RVHGVNPVFLVEKIIRERILD..S.LYWKKDCFHLNA................................-LTILDKAVA-..LRMVGT..............YSNV.NRT.............................................KP.CIFMCLLLKM.LQIQPSPE..........IVN.YLLR...............................................QPHFK..YVTALAAL....Y...V.....RLTSS........................SVQV....YK.TLE.....PL..LEDYR.KLVLFDGMK..............-----....-KRLIHMDELVD.DLL.......TKEKF...CD..L..MMPRLVDRLQLEEQ-e....................................................................
L2G882_COLGN/24-191                  ............................................lap---NGENPATIMEKAVRERIID..A.YFYKEQCFAVNE................................-ADIVDRVVEH..VTFIGG..............-TYG.VTQ.............................................KP.TPFLCLAFKL.LQLAPSDE..........ILE.TYLGf.............................................gGEKFK..YLRALAVF....Y...I.....RMTRK........................AKDV....YL.LLE.....PF..LEDRR.KLRRKGRAG..............-----....-TSLTYMDEFVD.DLL.......TKSRV...CA..T..SFRELPKRVDLVD--lg...................................................................
G2XP06_BOTF4/21-188                  ............................................lap---NGLNPATVLEKPVRERIVD..C.YFWKDQCFALNE................................-ADIVSRVVSH..VTFIAG..............-TYG.DSQ.............................................RP.SPFLCLAFQL.LQLGPGDD..........ILK.EYMGy.............................................gGEKFK..YLRALALF....Y...W.....RMTRQ........................AKDV....YT.MLE.....GY..LEDRR.KLRRKTRTG..............-----....-TTLTFMDQFVD.DLL.......TKDRV...CG..T..TLWKMPKREILEDL-e....................................................................
C4Y6R0_CLAL4/3-178                   ...........................................rskv-----LNKAHLIESIVRNRIQD..S.LFYKQHLFLTNE................................-SNILDVIVQQ..VKYLGG..............MD--.SGG.............................................RP.SPFLCCLLRL.LELEPSDE..........IIE.MYLSq............................................ngYNEFK..YLTALTLL....Y...C.....RLVWK........................PKEF....YT.LYD.....KY..IQDHR.KLRIQLKSP..............EFVNHl.pvHFKLTYMDEWID.RLA.......EDDRV...VD..I..IMPYITPRQTLAE--kg...................................................................
C6HES4_AJECH/21-214                  ..............................................l--IRGVNPATLFEKAVRDRITE..S.YYWKEQCFGLNA................................-ATLCDRAAE-..LSYIGG..............-TYG.LAQ.............................................KP.TPFLCLAFKL.LQLAPEKE..........IVL.EYLNfhdpenghvegsemn.................gleeeqggasgvvkaVGDFK..YLRALAAF....Y...I.....RLTFD........................AADI....YK.SLE.....PL..LTDYR.KLKRRMKDG..............-----....-FVLTYIDQFVD.DLL.......TKDRV...CG..T..SLWKLPSRHQLEDL-d....................................................................
Q4Z0V3_PLABA/10-175                  ...........................................iksf----GSNPQFLISNIIRNKIYD..S.PYWKEKCFALTS................................-ESIIDQAVN-..LKYAGG..............-TYG.GNR.............................................KP.TRFLCLVLKL.LQLQPDKD..........IIY.EFIK...............................................NEEFI..YLRALGIF....Y...L.....RLIGK........................GIEI....YK.NIE.....PI..LFDYR.KIRIRLQDG..............-----....SFQKMYMDVFAD.NCL.......VFNNF...LD..V..DFPPLTKRIVLEEN-n....................................................................
U9TVS5_RHIID/10-166                  ..............................................i-AVHGTNPQYLIEKIMRTRIYE..S.LYWKEFCFGLTA................................-ETLIDRAIE-..LTSFGG..............-EYG.N-Q.............................................KP.TEFLCLTLKL.LQLQPNKD..........IVM.EFIR...............................................NEDYK..YLRVLGAF....Y...L.....RLVGN........................SLEI....YQ.TLE.....PL..LNDYR.KLRKRTSGD..............-----....-FEIVCVDEFIE.ELL.......KEERV...CD..T..ILPRMLK--------r....................................................................
A0A0D3G3V7_9ORYZ/3-166               ............................................iqt---SGKPIDLLMEKVLCMNIMS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKIL....WT.WYE.....PY..LKDDE.---------..............EFSPG...sNGRMTTMGVYVR.DLI.......LGQYY...FD..S..LLPRVPLPV------irqvt................................................................
B6K0B4_SCHJY/16-179                  ..............................................g-PVHEMNPTFLIEKILRERIVE..C.AYWKEQCFGLNA................................-ASLVDRAVQ-..IQCIGG..............--QS.SHQ.............................................RP.TEFICLVYKL.LQLAPEDE..........IVL.QYLN...............................................ATEFK..YLRAIAAF....Y...I.....RLVWK........................DARV....FE.TLE.....PL..LNDYS.KLRTLDMNG..............-----....-YGLTHMDEYVD.ALL.......NEQRV...CD..I..ALPPLMSRIQLEDL-e....................................................................
G8ZTX6_TORDC/14-208                  ...............................................KELNNQSVSLVIPRLTRDRIHN..V.IYYKANLHTVALrg............................dtMKQLCKVIIRD..LGTLQStsi........nrkNVLG.GVE.............................................--.--FKCILMKL.VEIRPTWD..........QLA.LLLRnp...........................................hpSYNNK..YVIALVLT....Y...L.....RVQYFylkn................ddilAQNI....KG.AFK.....EY..ICDYR.KMKSVSLEMdc..........wsASQNV....TVEIIHMDELVD.WLT.......TKDEI...WG..I..PLGRCQWCSS-----ldld.................................................................
A9V7J1_MONBE/525-692                 ...........................................yvcd------SKTMNLGHVLYSNIRD..S.SYFRERCAELES................................IDHIIDEIYEQ..VNHLEP..............FVRK.PSN.............................................AP.STAFCLLYTL.FCFRPKER..........DLD.KIVT...............................................HKDSP..YIRAIGFL....Y...L.....RYTAD........................ADTI....WT.WFS.....DF..LDDPT.PLKVKYAKM..............-----....-APEEPIGLWLR.SLL.......TDLQY...CDpqA..RLPRIPVMKEREIR-d....................................................................
U3JLV7_FICAL/10-175                  .............................................lg--IHGTNPQYLVEKIIRTRIYE..C.RYWKEECFGLTA................................-ELVLDKAME-..LKYVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.ELIK...............................................NKDFK..YVRMLGAL....Y...M.....RLTGA........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRKG..............-----....EFELMHVDEFID.ELL.......HEERV...CD..I..ILPRLQKRYVVEE--ae...................................................................
A0A058Z0D6_9EUKA/4-170               .............................................le--RHGNETTMNLNPALHQNIMG..S.RYFK-NLYNLTT................................FEEVVSEISDE..VTFLEP..............FIPG.T-R.............................................DP.SSAFCLLLKL.FTMKPTVN..........QMR.RMLN...............................................YPRSV..YVRCVGLL....Y...L.....RYAFP........................PARL....ME.WYA.....DM..LFDET.PVVVEGRHG..............-----....-ARSMPLGRYVRnHLL.......LDNKY...FG..T..IMPLLPFRVMES---ikq..................................................................
A4HYV7_LEIIN/4-146                   .....................................nlkgraaias-----------LDPPTRYRVLH..S.HTMT-RCASKPL................................-LWVLEELIT-..LRYLGG..............-LTG.PLH.............................................TA.NYFICLVVRL.LQICPSVA..........IVR.VMLE...............................................QDVHK..YLRAAALL....I...I.....RLIGN........................VELQ....RE.AMR.....VG..WSDYR.KLCLYGSDP..............-----....------------.---.......-----...--..-..---------------aqelaestsntaagaeg....................................................
F2PU74_TRIEC/21-222                  ..............................................l--IRGVNPATLFEKAVRDRITD..S.YYWKEQCFGLNA................................-ATLCDRAVE-..LTYIGG..............-TYG.VGQ.............................................KP.TPFLCLAFKL.LQLAPEKE..........VIL.EYLNfhdpeadeedsntrgdsad.........adgdaddaqdradaailraTGDFK..YLRALAAF....Y...I.....RLTFE........................PVEI....YK.TLE.....PL..LTDYR.KLKRRTKEG..............-----....-FLLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKIPTRTMLEDL-d....................................................................
H3H0K3_PHYRM/37-201                  .............................................la--VYGNDTTYNLNTLLHQNILQ..S.AYFH-DLYKLKT................................YHEVVDEIYYR..VDHAEP..............WSPG.TAR.............................................IP.SSCFCLLHKF.FLMRLTRK..........QMQ.GLLR...............................................HTDSP..YIRVVGFL....Y...L.....RFAFD........................PDEL....WT.WFE.....PF..LEDPE.---------..............EFNASa..nTSLKTTIGEWLI.SLL.......EENNY...FG..T..ILPRIPKKIE-----dgik.................................................................
A0A0N4YCI5_NIPBR/1-176               ...............................................---------MNLNGLVLENVKE..S.YYYKNHLVEIDS................................AQQLLDEVFYK..VKHLEP..............WEKG.TRKvqgmtgmcg...........................gvrgvgaggVV.SSAFCLLYRF.FKVRLTRK..........QLI.SMIN...............................................SRVSP..YIRGLGFM....Y...I.....RYTQP........................PADL....WE.WFE.....PY..LDDEE.---------..............EIDPRs..gGGDVMTFGQIVR.VML.......TKLDW...YG..T..LFPRIPVPIQKEID-e....................................................................
N1R8N2_FUSC4/26-192                  .............................................ap---NGLNPATIMEKAVKDRIVD..S.YFYKEQCFALNE................................-ADIVDRVVEH..VNFIGG..............-TYG.VTQ.............................................KP.SPFLCLAFKL.LELSPSDA..........VLM.EYLKy.............................................gGEAFK..YLRALACF....Y...F.....RLTRQ........................AKDV....YE.MLE.....PF..LEDRR.KLRRRGRAG..............-----....-VVLTFMDEFVD.ELL.......TKERV...CG..T..SLWKMPKREVLEDL-e....................................................................
K3WW49_PYTUL/39-203                  ..............................................l-PIYGNQTTYNLNTLLHQNILQ..S.AYFH-ELYNLKT................................YHEVVDEIYYR..VDHAEP..............LSPG.TAR.............................................IP.STCFCLLHKF.FLMRLTMK..........QMQ.GLLK...............................................HTDSP..YIRAVGFL....Y...L.....RYTCD........................PEKL....WG.WYE.....PY..LDDKE.---------..............EFNAAa..nPNVKTTIGEWLV.GLL.......EDINY...FG..T..ILPRIPKKIED----sik..................................................................
I2FP71_USTH4/10-174                  ..............................................v-SIHGRNPQHLIEKTIRYRIYE..S.AFWKEHCFGLSS................................-STILPLAVS-..LHHIGG..............-LVG.L-E.............................................RP.SHFLCLVQKL.LQIQPEDS..........VIK.AYLD...............................................ACEFK..YLRALTAF....Y...I.....RLTCK........................STEV....YQ.LLE.....PM..LQDGR.KLRWRSADG..............-----....GYEVLHMDEWVD.MLL.......REERV...CD..I..ILPRLSKREV-----cqvrd................................................................
G5AIQ4_PHYSP/37-201                  ..............................................l-PIYGNDSTYNLNTLLHQNILQ..S.AYFH-ELYKLRT................................YHEVVDEIYYR..VDLAEP..............WSPG.TAR.............................................IP.SSCFCLLHKF.FLMRLTRK..........QMQ.GLLR...............................................HTDSP..YIRVVGFL....Y...L.....RFTCD........................PEEL....WT.WFE.....PY..LEDPE.---------..............EFNASa..nPSLKTTIGEWLI.SLL.......EENNY...FG..T..ILPRIPKKIE-----dgik.................................................................
Q6FNB5_CANGA/14-216                  ...............................................KQLNNQSVSLVIPRITRDKIHN..N.IYYRCNLHPVSMrg............................dtMLNLAPIIIRD..LGKLRNpyqk.....plnatLLLG.GSE.............................................--.--FKCLLMKL.IEIRPTWE..........QIM.TLINeem.........................................veeSFENK..YIVALVLV....Y...G.....RIQYYfltfs.............ddyyddAIKW....RR.LFK.....KY..LNDYR.KLKALDLNVdc..........wsTSQMQ....NVELIHLDEIVD.WLA.......TKDDI...WG..I..PLGKCQWANV-----yndd.................................................................
G1KHK2_ANOCA/10-175                  ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LRYTGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRLLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.QLL.......HDERM...CD..I..ILPRLQKRYVLEEA-e....................................................................
G8YPM8_PICSO/12-188                  ............................................dkr---NVLNKASLVEPIVRHRVQD..S.IFYKQYLYLTNE................................-STILNVIIEH..VHYIGG..............--TS.ANG.............................................KP.SPFLCCMVRL.LELEPKQE..........IIQ.MYLSq............................................mgTNTFK..YLTAMTLM....Y...I.....RFVGS........................SEEI....YS.ILE.....EY..YKDYR.KLRFQLKYPr...........ehNGVHK....LYTLTYMDEWVD.DLL.......HKERL...VD..L..ILPRLAPRRFLQ---dag..................................................................
W5KVG4_ASTMX/10-175                  ..............................................n-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LKFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRLLGAT....Y...M.....RLTGT........................SVDC....YK.YLE.....PL..YNDYR.KIKTQNRNG..............-----....EFEIMHVDEFID.ELL.......HAERV...CD..V..ILPRLQKRQVLEEA-e....................................................................
K3XXF9_SETIT/3-166                   ............................................iqs---SGRSIDVLMEKVLSVNILS..S.DYFK-ELYKFKT................................YHEVVDEIYHQ..VDHVEP..............WMTG.NCR.............................................GP.SSAFCLLYKF.FTMKLTVN..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYVAE........................PKTL....WA.WYE.....PY..IKDDE.---------..............EFSPG...sNGKMTTMGVYVR.DLL.......LGQYY...FD..S..LLPRVPLPI------lrqvt................................................................
T5ACD4_OPHSC/26-193                  ............................................lap---NGLNPAMIMEKAVKDRIVD..S.YFYKEQCFALNE................................-ADIIDRVVEH..VSFIGG..............-THG.AAQ.............................................KP.SPFLCLAFKL.LELGPSDA..........ILR.EYLAh.............................................gGEHFK..YLRALACF....Y...V.....RLTRQ........................AKDV....YE.TLE.....PF..LEDRR.KLRRKGRAG..............-----....-TSLTYVDDFVD.DLL.......YKERI...CA..T..SLWKMPKREILEDL-d....................................................................
H2S675_TAKRU/10-175                  ..............................................n-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LKFVGG..............-VYG.GNI.............................................KP.TPFICLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRLLGAM....Y...M.....RLTGT........................AVDC....YK.YLE.....PL..YNDYR.KVKTQNRNG..............-----....EFELMHVDEFID.ELL.......HSERM...CD..I..ILPRLQKRHVLEET-e....................................................................
W5FCD2_WHEAT/10-175                  ..............................................r-SIHGTNPQNLVEKIVRAKIYQ..S.NYWKEQCFGLTA................................-ETLVDKAME-..LDHTGG..............-THG.GNR.............................................RP.TPFLCLALKM.LQIQPDKE..........IVV.EFIK...............................................NEDYK..YVRVLGAF....Y...L.....RLTGT........................VADV....YQ.YLE.....PL..YNDYR.KIRQKLSDG..............-----....KFTLTHVDEFID.ELL.......TKDYS...CD..T..ALPRIQKRWILEA--sg...................................................................
H0Z2D2_TAEGU/48-232                  ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKAI--dq...................................................................
A0A0D3H3F9_9ORYZ/10-175              ...............................................KSIHGTNPQNLVEKIVRSKIYQ..S.TYWKEQCFGLTA................................-ETLVDKAME-..LDHTGG..............-TYG.GNR.............................................KP.TPFLCLALKM.LQIQPDKD..........IVV.EFIK...............................................NEDYK..YVRVLGAF....Y...L.....RLTAT........................VADV....YQ.YLE.....PL..YNDYR.KIRHKLSDG..............-----....KFTLIHVDEFID.DLL.......TKDYS...CD..T..ALPRIQKRWVLET--sg...................................................................
D2VCT3_NAEGR/48-213                  ..............................................i-NVWGNSSTMNITPYLYKKVLA..S.PYFK-SLYEYKT................................YHEVLDLIKN-..IKYIHP..............FTDG.DTN............................................aEP.SIAFSLLFKL.HTLKLSYK..........QLK.GMLQ...............................................KDMST..NTKAMALL....Y...V.....RFAVQ........................PDEM....WD.YFR.....DF..VNDEN.---------..............NTVNI....YTKRISLGEFVR.SLI.......TNQKL...FG..SqcILPILPANLV-----rrmed................................................................
F4PA36_BATDJ/1-156                   ...............................................---------MNIHNILYLNIMS..S.RYFK-SLYEKKT................................YHEVIDEIYYN..VSSLEP..............FFKG.TNA.............................................--.TSAFCLLYKL.FTLKLTEK..........QLE.GLLD...............................................HPDSP..HIRALGFL....Y...L.....RYAGQ........................PSQI....WD.WFE.....PY..LDDTE.ELPVRGGPH..............-----....-PKTMTIGTFCK.ALL.......TEQKW...FE..T..MLPRIPIPIAREIE-q....................................................................
A0A096UWA6_WHEAT/3-165               ...........................................lqts----GRPIEVLMEKVLSMNIVS..S.DYFK-ELYKIKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKL.FTMKLTVN..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYAAD........................PKTL....WT.WYE.....PY..IQDDE.---------..............EFSPG...sNGKMTTMGVYVR.DVI.......LGQYY...FD..S..LLPRVPL--------lilrqv...............................................................
G3N4L7_GASAC/1-34                    ...............................................----------------------..-.------------................................-----------..------..............----.---.............................................--.----------.--------..........---.----...............................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------..............-----....----MHVDEFMD.ELL.......HAERM...CD..I..ILPRLQKRHVLEEA-e....................................................................
A0A091DJ53_FUKDA/1-176               ...............................................---------MNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
V5G3J8_BYSSN/21-207                  ..............................................l--IRGVNPATLFETAVRDRITD..S.YYWKEQCFALNA................................-ATLCDRAAE-..LTSIGG..............-TYG.VGQ.............................................KP.TPFLCLAFKM.LQLAPDKE..........IVL.EYLNftdpgsdaegd........................taeeadngvvksRGDFK..YLRALAAF....Y...I.....RLTFD........................PVDI....YK.SLE.....PL..LLDYR.KLRRRMRDG..............-----....-FVLTTIDQFVD.DLL.......TKDRV...CA..T..SLWKIPSRQQLEDL-d....................................................................
A0A0L0P213_9ASCO/2-178               ............................................dkr---RAENKAYLIGPIVRHRIQD..S.LFYKEKLYLTNE................................-SSIVPVIVEH..VHSVGG..............--TD.EAG.............................................RP.SPFLCCLLRL.LELEPSPA..........IIQ.LLLTq............................................ngYNEFK..YLTALALV....Y...C.....RLVFD........................AKEM....YA.LYD.....EY..IKDYR.KLRMQLKTP..............RFENDl.piHYKLVHMDEWVD.MLV.......EEESV...VD..L..TLPYIAPRK------vyvekg...............................................................
H0ZFB3_TAEGU/10-175                  ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.NRASIAVPSFIS................................-ELVVDKAME-..LKYVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HEERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A8BAJ9_GIAIC/1-145                   ...............................................-----------MEHATRRAILN..S.PLYLMEFKHLGV................................IGLLKDVLVT-..-RNIDL..............-EYG.--Q.............................................EP.SRLLCSLVRL.YMLRPDRS..........IVH.EILS...............................................ARGFA..YATAFAAI....H...V.....RSYWS........................SLDI....HK.ALT.....PL..LNNYT.KIRVSGLKT..............---LG....LQGHVPLDVFVE.ALL.......HQPST...LS..-..---------------tcsgtf...............................................................
H2KVI1_CLOSI/10-175                  ..............................................h-TVHGTNPQYLVEKIIRSRIYE..S.KYWKEHCFALTA................................-ELLVDKAVE-..LRYVGG..............-VYS.GNV.............................................KP.TPFLCLALKM.LQIQPDKD..........IVI.EFIK...............................................QEPYK..YARALGAF....Y...L.....RLVGE........................SVEI....YK.YLE.....TL..YNDFR.RLKFQDRAG..............-----....NFSLIYMDDFID.KLL.......TEERV...CD..V..ILPRLQKRSVLEE--an...................................................................
A0A074W0U8_9PEZI/19-183              .............................................tl--IRGQNPLLLFEKAVRDRIVD..S.YYWKEQCFGLNA................................-ATLCDRAVD-..LTFIGG..............-TYG.VGQ.............................................KP.TPFLCLAFKL.LQLTPEKE..........IIL.HYLQ...............................................QEDWK..YLRALAAF....Y...I.....RLTWE........................PKDI....YE.TLE.....AY..LSDFR.KLKRRTRDA..............-----....-YTLSYIDQFID.DLL.......TKDRV...CA..T..SLWKMPSRTQLEDL-d....................................................................
W7HV93_9PEZI/23-186                  .............................................pt--IHSMNPVRLIEKIIRERIID..S.MYWKEQAWGLNA................................-ATLMDRAVD-..LTYVGG..............-QY-.ANQ.............................................KP.TAFICLVLKL.LQLNPERD..........IIL.EYLN...............................................DDEFK..YLRALAAF....Y...I.....RLTWP........................AAEV....YK.TLE.....PL..MRDYR.KLRLRTIAG..............-----....-FRLTFVDEFID.ELL.......TKERV...CD..I..ALPRIPTRMQLEDT-d....................................................................
T1H306_MEGSC/10-175                  ...............................................KNVHGTNPQYLIEKIIRSRIYD..S.KYWKEKCFALTA................................-ELLVDKAME-..IRFIGG..............-VYG.GNI.............................................KP.TEFLCLTLKM.LQIQPEKD..........IVV.EFIK...............................................NDEFK..YVRALGAF....Y...L.....RLTGT........................SVDC....YK.YLE.....PL..YNDNR.KLRRQNRSG..............-----....QFELVYMDDFID.ELL.......RSDRV...CD..I..ILPRIQKRDVLEEN-n....................................................................
A0A0N5CXD3_THECL/10-175              .............................................vt--VRGTNPQYLIEKIIRTRIYD..S.KYWKEECFALTA................................-ELLVDQGME-..LRYVGG..............-VYA.GNV.............................................KP.TPFLCLCLKM.LQIQPEKD..........IIV.EFLR...............................................QEDYK..YIRALGAM....Y...I.....RLTFP........................SIEV....YK.YLE.....PL..YNDYR.KMRMMTRQG..............-----....KFEVIYVDEFID.NLL.......REDRY...CD..I..HLPRLQKRITLEE--ig...................................................................
M2RIP2_CERS8/10-173                  ..............................................q-AIHGQNPQYLVESVIRNRIYE..S.AYWKEHCFALTA................................-ESLIDKTIE-..LRAIGG..............-VYG.N-Q.............................................KP.TEFLCLLLKL.LQIQPEKE..........ILL.EYLQ...............................................ADEFK..YLRALAVM....Y...I.....RMTFR........................PAEV....YE.ILE.....PL..LKDYR.KIRYRGMNG..............-----....-YSLTFMDEFVD.SLL.......VQERV...CD..I..ILPRLTKRDVLEE--lg...................................................................
W5MGQ8_LEPOC/10-175                  ..............................................n-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LKYVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRLLGAL....Y...M.....RLTGS........................SVDC....YK.YLE.....PL..YNDYR.KIKNQNRNG..............-----....EFELMHVDEYID.ELL.......HSERV...CD..I..ILPRLQKRQVLEEA-e....................................................................
I1CST4_RHIO9/3-153                   ............................................sdk----------------------..-.----------KT................................FHEIVDEIYNE..APFIKG..............----.--N.............................................QP.STAFCLLFKL.WTLKLTIR..........QLE.NLVEhgdsplvkk............................ksvlqlasklTCSVS..YIRAIGFL....Y...L.....RYVCA........................PAQL....WD.WYQ.....YY..LEDDE.---------..............EVAISs.glHPTKVTVGQLIR.MLI.......IEPKF...QG..T..MLPRIPIPIAR----dlek.................................................................
W5L4F4_ASTMX/24-208                  ..............................................l-PLWGNEKTMNLNPMILTNVLS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHAEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PADL....IE.WYE.....PF..LDDEE.---------..............ELDVKa..gGGCVMTVGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKMI--dq...................................................................
A0A0J8C706_BETVU/4-167               ...........................................lqts----GKPIDSLLEKVLCMNILS..S.DYFR-DLLRLKT................................YHEVVDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTAK..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYAGD........................PKQL....WS.WFE.....PY..ITDDE.---------..............EFSPG...sNGRMTTMGVYVR.DLL.......LGQYY...FD..T..LFPRVPVPVVR----qiv..................................................................
I1MBS7_SOYBN/4-166                   .......................................qtcgrpid---------SLLEKVLCMNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAVGFL....Y...L.....RYCAD........................PKTL....WN.WFE.....SY..VKDDE.---------..............EFSPG...sNGRMTTMGVYVR.DLL.......LGQYY...FD..T..LFPRIPVPV------lrqvv................................................................
A0A0D2QSW4_GOSRA/3-162               .......................................iqtcgkpi--------DSLLEKVLCMNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYAAD........................PKTL....WS.WFE.....PY..IKDEE.---------..............EFSPG...sSGRMTTMGVYVR.DLL.......LGQV-...--..-..---------------tsnlekmklptkps.......................................................
A0A085M8W0_9BILA/10-175              ..............................................s-TVKGTNPQYLIEKVVRSRIYD..S.RYWKEECFALSA................................-ELLVDKGME-..LRFVGG..............-VFG.GNV.............................................KP.SPFLCLQLKM.LQIQPDKE..........IVI.EFIR...............................................QEDSK..YIRALGAM....Y...L.....RLTFS........................SIEV....YQ.YLE.....PL..LNDYR.KLRWMSKQG..............-----....KFELMHMDEFVD.RLL.......REERF...CD..I..QLPRLQKRDVLEE--tg...................................................................
W9XE09_9EURO/20-185                  ..............................................l--VRGQNPALLLETAMRDRITD..S.LYWKEQCFGLNA................................-ATLCDRAVE-..LSYIGG..............-TYG.VAM.............................................KP.TPFICLAFKL.LTLVPDRE..........IVL.EYLQn.............................................gGEEWK..YLRALAAF....Y...V.....RLTFE........................PADI....YK.TLE.....PF..LEDSR.KLRQRRKES..............-----....-YVLIHMDEFVD.NLL.......TKDRV...CG..T..SLWKLPARQLLEDL-e....................................................................
A0A066VG41_9BASI/10-174              ..............................................q-QIHSTNPQFLVEKVIRARIYS..N.NYWREQCFALTA................................-ESVIDKALD-..LKYIGG..............-TYG.P-Q.............................................IP.SPFVCLLLKL.LQLQPQKE..........IIL.EYLT...............................................ADEFK..YLRALAAL....Y...V.....RLTFP........................SMEV....YE.VLE.....PM..LNDYR.RLRYRNQGG..............-----....CYTITHMDEFID.DLL.......TQERV...CE..L..ILPRLTRRDVLEES-e....................................................................
S7QHR4_GLOTA/10-173                  ..............................................q-AIHGQNPQYLVETVIRNRIYE..S.PYWKEQCFALTA................................-ETLIDKAID-..LKCIGG..............-VYG.N-Q.............................................KP.TAFLCLLLKL.LQIQPEKE..........ILI.EYLQ...............................................ADEFK..YLRALAAM....Y...I.....RMTFR........................SVEV....YE.ILE.....PL..LKDYR.KLRYRTNTG..............-----....-YTLTYMDEFVD.NLL.......REERV...CD..I..ILPRLAKRSVLEE--tg...................................................................
A0A0N4VGU5_ENTVE/46-253              ..............................................l-PLWGNNHTMNLNSLVLENIIQ..C.TYYKNYLAEANG................................FQQLTEEIYY-..-NVFDN..............MFKN.GSGfepynelhlrnglhvkhlepwergtrktqgmtgmcggvrgvgaggVV.STAFCLLYKL.FTIRLTRK..........QLV.SMIN...............................................NRDSP..YIRGIGFM....F...I.....RFCQP........................PADL....WA.WME.....PY..LDDEE.---------..............QIDPRs..gGGDIMTIGQVVK.MML.......TKLDW...YG..T..LFPRIPVPIQV----sn...................................................................
A0A024VKM8_PLAFA/173-301             ............................................lem----TNTTTYNVNTLLRNNILS..S.EYFK-SLIPIKT................................FKEVVDEIHSY..ADHVEP..............YCIG.SNR.............................................AP.STLFCCLYKF.FTMQLSEK..........QVT.HKL-...............................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------vsilprlpikiknvygarlmiiddhrrrlkknkeniskflkgepvl.......................
I3MZU9_ICTTR/10-159                  ..............................................h-SIYGTNPQYLVEKIIRTRIYE..S.KYWKEECVGLTA................................-ELVVDKAME-..------..............-LYG.GNI.............................................KP.TPFLCLTLKM.FQIQPEKD..........IIV.EF-K...............................................NEDFK..YVCMLG-L....Y...M.....RLTGT........................VIDC....YK.YLE.....PL..YNDCR.KIKSQNRNG..............-----....EFELMHVDEFID.E--.......-----...-H..I..ILPRLQ---------kcyvleeae............................................................
F6UQW2_HORSE/10-175                  ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
I1QLT6_ORYGL/10-175                  ...............................................KSIHGTNPQNLVEKIVRSKIYQ..S.TYWKEQCFGLTA................................-ETLVDKAME-..LDHTGG..............-TYG.GNR.............................................KP.TPFLCLALKM.LQIQPDKD..........IVV.EFIK...............................................NEDYK..YVRVLGAF....Y...L.....RLTAT........................VADV....YQ.YLE.....PL..YNDYR.KIRHKLSDG..............-----....KFTLIHVDEFID.DLL.......TKDYS...CD..T..ALPRIQKRWVLET--sg...................................................................
A0A0A1T126_9HYPO/24-191              ............................................lap---NGLNPATIMEKTVKDRIIE..S.YFYKEQCFALNE................................-ADIIDRVVEH..VNFIGG..............-THG.SMQ.............................................KP.SPFLCLAFKL.LELAPSDE..........ILS.EYLKy.............................................gGEEFK..YLRALACF....Y...L.....RMTRQ........................AKDV....YE.QLE.....PY..LEDRR.KLRRKGRAG..............-----....-TALTYMDEFVD.DLL.......TKERV...CA..T..SLWKMTKREILEDL-e....................................................................
I1F011_AMPQE/7-103                   ..............................rqnsekipihidvlmlc----------------------..-.------------................................-----------..------..............----.---.............................................--.----------.--------..........---.----...............................................---SK..YVRALGSL....Y...L.....RIVGT........................SVEC....YK.YLE.....PL..YNDYR.KIKYKNRQG..............-----....KFELSHVDEFVD.SLL.......REDRV...CD..V..ILPRIQKRHILEET-e....................................................................
B6AGF3_CRYMR/3-168                   .............................................eq--IGDTRKLFLISSILRNRVFS..C.IYWKSECFGLDS................................-ETILDKAIQ-..LDYVGS..............-TFG.PER.............................................RP.CTFLCLLVKL.LQIQPSLD..........IIL.EYIT...............................................NPEFK..YLTALGII....Y...L.....RLVAS........................PKDI....YI.NLE.....PL..YKDYR.KLKCRDLDG..............-----....SFYILCIDELID.RCL.......RDNVL...FD..I..DLPYLPKRLMLV---keg..................................................................
A0A061DC29_BABBI/10-175              .............................................hl--VHGTNPQFLFSKIMRDKVYN..C.MYWKESCFGLTA................................-ESIIDKAIE-..LQYVGG..............-TFG.GNR.............................................QP.SPFICLVLKL.LQIQPDLD..........IIE.EYIR...............................................NTEFK..YLRALGIY....Y...M.....RLVGS........................SVKV....YE.TLE.....PI..YSDYR.KLRFRLNDG..............-----....SYELKHMDEFVD.DCL.......RLSSY...LD..V..DLPPLPKRMVLEDA-n....................................................................
Q4Q9W3_LEIMA/270-441                 nfdaelwgvlesrltdelveqvrsagaapnggrlltafeqheqnvka----------------------..-.------------................................---VLRYCEQN..VRYAGV..............--FD.DSE.............................................EA.SPFLLAMGLC.WRLGLTMD..........DVC.RHFA...............................................RHPRR..VVRALALY....L...A.....RYTLA........................PEDY....VY.FFT.....PS..LCDEV.IIACTEDAQ..............-----....--VTFSMKDLSR.QLL.......TKKDV...VD..A..WLPILSKRWQE----dv...................................................................
W9QIC3_9ROSA/10-174                  ...............................................KSIRGTNPQNLVEKIVRSKIYQ..N.TYWKEQCFGLTA................................-ETLVDKAME-..LDHVGG..............-TFG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKE..........IVI.EFIK...............................................NDDYK..YVRVLGAF....Y...L.....RLTGS........................DTDV....YQ.YLE.....PL..YNDYR.KIRRKLADG..............-----....NFSLTHVDEVID.ELL.......TKDYS...CD..I..ALPRIKKRWTLE---si...................................................................
V3ZLZ8_LOTGI/10-175                  ..............................................h-SIKGTNPQYLIEKIIRTRIYE..C.RYWKEECFALTA................................-ALLVDKAME-..LKYIGG..............-VFG.GNV.............................................KP.TDFLCLILKM.LQIQPEKD..........IVV.EFIK...............................................NEDFK..YVRALGAI....Y...M.....RLTGT........................SLDC....YK.YLE.....PL..YLDYR.KMKRMNRNG..............-----....EFEILHMDEFID.ELL.......REERV...VD..I..ILPRLQKRQVLEES-n....................................................................
F7A5D9_CALJA/47-231                  ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
M4A2I4_XIPMA/25-209                  ..............................................l-PLWGNEKTMNLNPMILTNVLS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHIEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....LD.WYN.....DF..LDDEE.--KTVQKAS..............-----....GETKKKEGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKAI--dq...................................................................
M3K4S3_CANMX/17-194                  ............................................dkr---YTQNKGNLIEPIIRHRIQD..S.IFYKQHLYLTNE................................-ATLLPVITNH..VHYISG..............--TD.SSN.............................................RP.SPFISCLFRM.LELEPSKE..........IID.TYLTq............................................lnFNEFK..YLTALTLI....Y...I.....RLVYK........................SEDI....YR.LFD.....PY..FKDFR.KLRVRLKNPmf..........dsMQIPK....HYKISYIDEWVD.ELL.......TNDRV...ID..L..ILPRLVPRISLVE--kg...................................................................
E9IFJ0_SOLIN/10-175                  ...............................................KSIRGTNPQYLIEKIIRSRIYD..S.KYWKEECFALTA................................-ELLVDKAME-..LRFLGG..............-VYG.GNV.............................................KP.TPFLCLILKM.LQIQPEKD..........IIV.EFIK...............................................NEEYK..YVRALGAL....Y...M.....RLTGS........................SLDC....YK.YLE.....PL..FNDNR.KLRIQNKQG..............-----....VFELIHMDELID.HLL.......REERC...CD..V..ILPRIQKRHVLEEN-n....................................................................
F2TEA8_AJEDA/21-214                  ..............................................l--IRGANPATLFEKAVRDRITD..S.YYWKEQCFGLNA................................-ATLCDRAVE-..LTYIGG..............-TYG.LAQ.............................................KP.TPFLCLAFKL.LQLAPEKD..........IVL.EYLNfhdpenerveggegn.................gleeeqdandgvvkaVGDFK..YLRALAAF....Y...I.....RLTFD........................AADI....YR.TLE.....PL..LVDYR.KLKRRTKDG..............-----....-FMLTYIDQFVD.DLL.......TKDRV...CG..T..SLWKLPSRTQLEDL-d....................................................................
A0A0A1NZE8_9FUNG/11-174              .............................................tg--VHGRHPMHLVEKIIRERIQE..S.IYWKEKCYGLTA................................-ATLMERAVE-..IDYIGG..............-TFG.NLQ.............................................-P.TEFLCLLLKL.LQLLPERE..........III.EYIM...............................................QDDFK..YLRALGAF....Y...L.....RLTGK........................SVEI....YK.YLE.....PL..LLDYR.KLRVRGKDG..............-----....-YSITYMDVFID.DLL.......TKDRV...CD..I..ILPRIMARHILEQN-d....................................................................
S8BH21_PENO1/21-204                  ..............................................l--VRGVNPVTLFEKAVRDRITD..S.YYWKEQCFGLNA................................-ATLCDRAVE-..LSCVGG..............-TYG.VSE.............................................KP.TPFICLAFKL.LQLNPSRD..........IVL.EYLNfsdpgsddeg...........................enpdsgvvqtRGDFK..YLRVLAAF....Y...V.....RLTFD........................AVDV....YK.TLE.....PL..LLDYR.KIKRRVRDS..............-----....-FTLTYVDQFID.DLL.......TKDRV...CG..T..SLWKLPPRQQLEDL-d....................................................................
M0SG80_MUSAM/10-174                  ...............................................KSIHGTNPQNLVEKILRSKIYQ..N.TYWKEQCFGLTA................................-ETLVDKAME-..LDHLGG..............-TYG.GSR.............................................KP.TPFMCLILKM.LQIQPDKE..........IVV.EFIK...............................................NDEYK..YVRVLGAF....Y...M.....RLTGS........................VTDV....YR.YLE.....PL..YNDYR.KLRLKLSEG..............-----....KFCLTHVDEVID.ELL.......TKDYS...CD..I..ALPRVQKRWTLE---ac...................................................................
A1CAF4_ASPCL/21-209                  ..............................................l--IRGVNPATLFEKAVRDRITD..S.YYWKEQCFGLNA................................-ATLCDRAVE-..LSSIGG..............-TYG.VAE.............................................KP.TPFLCLAFKL.LQLNPERD..........VIL.EYLNytdpgsdeeaea......................taeeqarngvagqKGDFK..YLRALAAF....Y...V.....RLTFD........................AVDV....YK.TLE.....PL..LLDYR.KLKRRVRDS..............-----....-FVLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKLPSRQQLEDL-d....................................................................
Q4YH72_PLABA/10-175                  ...........................................iksf----GSNPQFLISNIIRNKIYD..S.PYWKEKCFALTS................................-ESIIDQAVN-..LKYAGG..............-TYG.GNR.............................................KP.TRFLCLVLKL.LQLQPDKD..........IIY.EFIK...............................................NEEFI..YLRALGIF....Y...L.....RLIGK........................GIEI....YK.NIE.....PI..LFDYR.KIRIRLQDG..............-----....SFQKMYMDVFAD.NCL.......VFNNF...LD..V..DFPPLTKRIVLEEN-n....................................................................
I1PSX7_ORYGL/3-166                   ............................................iqt---SGKPIDLLMEKVLCMNIMS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKIL....WT.WYE.....PY..LKDDE.---------..............EFSPG...sNGRMTTMGVYVR.DLI.......LGQYY...FD..S..LLPRVPLPV------irqvt................................................................
L8FWG2_PSED2/22-189                  ............................................lap---NGLNPATIFEKPVRERIID..C.YFWKDQCFALNE................................-ADIVSRVVEH..VHFVAG..............-TYG.DSQ.............................................RP.SPFLCLAFKL.LQLGPGDD..........ILK.EYLGy.............................................gGERFK..YLRALACF....Y...V.....RLTRP........................AKEV....YE.TLE.....PY..LEDGR.KLRRRGRQG..............-----....-TSLTFVDQFVD.ELL.......TKERI...CA..T..SLWKMPKREVLEDL-e....................................................................
D8LWY4_BLAHO/35-198                  ..............................................v-PINGNAESFNLGDIMVSNIME..S.RYFF-KVLDLTD................................IEEVINEIKRE..VHDLEP..............LVIG.SSR.............................................HP.SSAFCILYKL.SRMRITYQ..........ELS.ELIH...............................................CLDNS..YVRGIGYL....Y...I.....RFAIA........................PREL....WK.FYA.....PY..FDDNT.S--------..............-LVPF...sDKTPTTIGRFVT.GLI.......TNKRY...QT..V..MLPTIPIVVK-----rdwe.................................................................
E2A1P6_CAMFO/10-175                  ...............................................KSIRGTNPQYLVEKIIRSRIYD..S.KYWKEECFALTA................................-ELLVDKAME-..LRFLGG..............-VYG.GNV.............................................KP.TPFLCLILKM.LQIQPEKD..........IIV.EFIK...............................................NEEFK..YVRALGAL....Y...M.....RLTGS........................SLDC....YK.YLE.....PL..FNDNR.KLRIQNKQG..............-----....VFELIHMDEFID.HLL.......REERC...CD..V..ILPRIQKRYVLEEN-n....................................................................
A0A0K0EJ62_STRER/6-171               ..............................................r-TIRGTRSTFLIEKIIRTRINE..S.LYWKEECFGLSA................................-ETVIDKGAE-..LRYVGG..............-IYA.GNT.............................................KP.TPYLCLMLKL.LELAPEKD..........III.EYIK...............................................QEDFK..YIRALGAM....Y...I.....RLTFP........................SVEI....YQ.YLE.....PL..YNDYR.KLRYMNRMG..............-----....RFELMYMDDFID.KLL.......HEELF...CD..I..HLPKIQGRQLLEQN-d....................................................................
B3S4R2_TRIAD/10-175                  .............................................vt--VKGTNPQYLVEKITRSRIYE..C.KYWKEKCFAVTA................................-ELLVDRAME-..LDHIGG..............-TFG.GNI.............................................KP.TPFLCLILKM.LQIQPEKD..........IIV.EFIK...............................................NEDYK..YVRALGAI....Y...M.....RLVGT........................SNDC....YN.YLE.....PL..YNDFR.KLKRKQRSG..............-----....QFQVIHMDEFVE.ELL.......TEDRA...CD..T..ILPRIQKRYILEQ--tn...................................................................
G0QNS3_ICHMG/118-284                 ..............................................f-QIWGDETSGNINPKLRTNIMN..C.SYFRIDLFSLKT................................YHEVIEEIQKN..VNHAEP..............WARG.ATG.............................................VP.SSMFCCLYKF.MLMKLTVK..........QVR.GLVE...............................................YKFSP..MVRAAGFL....Y...I.....RFCCD........................PKYM....FA.WFK.....KY..LLDDE.DFKPGA---..............---DK....NSPSMTIGDYVE.GLL.......NNQEY...YN..T..RLPRIPTKYET----klk..................................................................
A0A0L9SRI6_9HYPO/24-191              ............................................lap---NGLNPATIMEKAVRDRITN..S.YFYQEQCFFANE................................-ADMVDRAVEY..VNFIGG..............-THG.ADQ.............................................KP.SPFLCLAFKL.LELAPSED..........IVA.EYLAy.............................................gGERFK..YLRALACF....Y...V.....RLTRP........................AAEV....YR.LLE.....PF..LEDRR.KLRRRRRDG..............-----....-CFLSFVDEFVD.DLL.......TKERV...CA..T..SLWKMPARETLEDA-e....................................................................
Q2H4I5_CHAGB/105-167                 ..........................................yprlw----------------------..-.------------................................-----------..------..............----.---.............................................--.----------.--------..........---.----...............................................-----..--------....-...-.....-----........................----....RR.EVQ.....PF..LEDRR.KLRRKGRDG..............-----....-TTLTYMDVFVD.DLL.......TKDRV...CA..T..SLWKMRKRDILEDL-e....................................................................
F6SY19_ORNAN/10-56                   ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTG................................-----------..------..............----.---.............................................--.----------.--------..........---.----...............................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------erldapgmklrp.........................................................
D6X552_TRICA/24-208                  ..............................................l-PLWGNERTMNLNPLILTNIQS..S.HYFKVNLYELKT................................YHEVVDEIYYK..VNHLEP..............WEKG.SRRtsgqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.FTLKLTRK..........QLN.GLIN...............................................HCDSP..YIRALGFM....Y...I.....RYTLP........................PKDL....LE.WYE.....DY..LEDEE.---------..............ELDVKa..gGGQMMTIGTMLR.QWL.......VKLEW...FS..T..LFPRIPVPIQQKIQ-k....................................................................
A0A0C4E3X3_MAGP6/24-191              ............................................lap---NGLNPARIMEKAVVDRIID..S.YFWKEQCFGLNE................................-ADIVDRVVDH..VHFIGG..............-ITG.PSQ.............................................KP.TPFLCLALKL.LQLAPGDD..........VLA.EYLHf.............................................gGEKFK..YLRALALF....Y...V.....RLTRA........................PKDV....YA.TIE.....PF..LEDYR.KLRRKGRAG..............-----....-TSLTYIDDFAD.DLL.......VKDRV...CA..T..SLYKLTKRDVLEDL-d....................................................................
A0A0K6G8X0_9HOMO/10-173              ..............................................i-HIHGQNPQFLVEKVIRTRIWE..S.AFWKEQCFALTA................................-ESLIDKAIE-..LNSIGG..............-VYG.NQR.............................................-P.THFICLLLKL.LQIQPEKE..........ILI.EYLM...............................................VDEFK..YLRALAAM....Y...I.....RMTFP........................AVEI....YE.LLE.....PL..LKDYR.KIRLRNMAG..............-----....-YSLTYMDEFVD.QLL.......TEERV...CD..I..ILPRMAKREVLEDT-e....................................................................
A0A095C2R6_CRYGA/9-163               ..............................................t-AVHGSNPQYLIEKVIRARIYD..S.LYWKEHCFALTE................................-----------..LRAIGG..............--VT.DRQ.............................................TP.TPFICLVLKL.LQLQPEKE..........ILI.EYLL...............................................AEEFK..YLRALAAF....Y...V.....RLTFR........................SLEV....YE.ILE.....PL..MKDYR.KLRVVHAGG..............-----....-YSLTYFDEFID.ELL.......TQERV...CD..I..ILPRLTQRSVLEET-e....................................................................
A0A074T919_HAMHA/142-303             ............................................emt-----DSTTYNVNALLRSNILS..S.EYFK-SLHELKT................................VPEVVEEITQY..AQHAEP..............YCSG.SSR.............................................AP.STLFCCLYKL.FTMKLTTK..........QLE.QLLD...............................................YSDSP..YVRCTGFL....Y...L.....RYVHP........................PEKL....WK.WYE.....QY..FLDDE.-VFAASSD-..............-----....AKRTTTMGEYVE.SLI.......MEDKY...FN..T..VLPRLPVKVK-----nly..................................................................
G7XH18_ASPKW/21-207                  ..............................................l--VRGVNPATLFEKAVRDRITD..S.YYWKEQCFGLNA................................-ATLCDRAVE-..LTCIGG..............-VYG.VSE.............................................KP.SPFLCLAFKL.LQLNPERD..........IIL.EYLNfsdpanddnnd........................esyeegngvvkaRGDFK..YLRALAAF....Y...V.....RLTFE........................PVEV....YK.TLE.....PL..LLDYR.KLKRRVRDS..............-----....-FTLTYMDQFVD.ELL.......TKERV...CG..T..SLWKLPARQVLEDL-d....................................................................
A0A0N4UBE6_DRAME/47-98               ..............................................l-PLWGNNQTMNLNALVLENIVQ..C.TYYKNYLAETTG................................FQQLIEEIYYR..VS----..............----.---.............................................--.----------.--------..........---.----...............................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------lrnc.................................................................
L5LMJ2_MYODS/10-175                  ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKGECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFKK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSPNRNG..............-----....EFELMHVDEFID.DLL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
M7XZP0_RHOT1/10-174                  ..............................................l-SVHGTNPQYLVPTVIRKRVYD..T.LYWKEHCFALNS................................-ATIIDRAVE-..LKYIGG..............-TYA.NTR.............................................-P.TEFMCLVLKL.LQLQPERE..........IVL.EYLR...............................................AEEFK..YLRALAAF....Y...V.....RLTFD........................SLNA....YE.TLE.....PL..LDDYR.KLRFRGMDG..............-----....SYSILTMDEFVD.QLL.......AGEMV...CE..I..QLPRLTQRKVLEDT-e....................................................................
Q4E0F0_TRYCC/9-176                   .............................................wn--LKGRSAVAALDPSTRHRIMQ..S.HAMASSFHKPLL................................-ATLEVLITP-..-QYVGG..............-LTG.PLQ.............................................KP.EPFICHVTRL.LQITPDPS..........IVL.AMLH...............................................QDVHK..YLRVAALF....I...I.....RLIGN........................EAMM....RE.AMR.....VG..WEDYR.KIRVYGYVE..............-----....------------.---.......-----...--..-..---------------dlagtidskennapdeeegfvrapaygimcvdeitdrlfnv............................
A0A0G4IQ99_PLABS/427-592             ..............................................s-SVHGQHPQFLIEKIVRLKIYD..L.PYWKEQCFALNA................................-ETLVDRAVA-..LDCVGG..............-CYG.GTR.............................................QP.SRFLCLLLKM.LQISPELD..........IVL.ALID...............................................AEDFK..YMRLLGAV....Y...L.....RLTAD........................PLDV....YT.YLE.....PL..LNDYR.KVVLRKDGG..............-----....ELELSHIDQVID.ELL.......TGEHF...CN..V..TLPRLPKRRILEE--tg...................................................................
Q4QCT1_LEIMA/4-144                   .....................................nlkgraaias-----------LDPPTRYRVLH..S.HTMT-RCANKPL................................-LWVLEELIT-..LRYLGG..............-LTG.PLH.............................................TA.NYFICLVVRL.LQICPSVA..........IVR.VMLE...............................................QDVHK..YLRAAALL....I...I.....RLIGN........................VELQ....RE.AMR.....VG..WSDYR.KLCLYGSDP..............-----....------------.---.......-----...--..-..---------------aqelaeststtaaga......................................................
F6SUR6_MONDO/10-175                  ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
W4FTM1_9STRA/9-142                   .............................................fs--VHGVNPQHLVEKILRNRIYD..S.MYWKEQCFGLTA................................-ETLVDKAIE-..LTHIGG..............-HFG.GNQ.............................................QP.TPFLCLLLKM.LQIQPDME..........IVV.EFIK...............................................NGDYK..YVTMLGAF....Y...L.....RLVGK........................PTDV....YP.ILE.....EL..LADYR.KIRKRNTL-..............-----....------------.---.......-----...--..-..---------------gpslvhl..............................................................
E1ZPB8_CHLVA/2-179                   .............................................eq---YGNQTTFNLESVLLQNIKR..S.QYWEKRAKDIAD................................WSELVDEIFET..VDNVEP..............WMSG.NAR.............................................GP.STAFNLLYRL.CQLKPDVR..........QVR.QMLD...............................................HVDST..FIRAIGLL....Y...L.....RYVCD........................PRQL....WD.WFR.....NY..VRDEE.ICKAGLLSLlf..........tqEFEPSp.pgLGRTVTIGAFAR.DIL.......LDQFY...FE..T..IFPRVPKP-------ggadr................................................................
Q4N1F2_THEPA/1-29                    ...............................................----------------------..-.------------................................-----------..------..............----.---.............................................--.----------.--------..........---.----...............................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------MGEYVE.SLL.......MEDKY...YH..T..ILPRLPVRVK-----nl...................................................................
T1K3B4_TETUR/10-175                  ...............................................KSIHQTNPQYLVEKIIRGRIYE..S.RFWKEDCFGINE................................-ESLVDKATE-..LKYIGG..............-IYG.GNI.............................................KP.TPFMCLILKM.LQIQPHKD..........ITI.EFIK...............................................QPHFK..YARALGAY....Y...L.....RLTAV........................SLDV....YK.YLE.....PL..YADYR.KLRYIDRMG..............-----....KFSIIHMDEFID.MLL.......REDRV...FD..V..ILPRIKARRIHEEN-d....................................................................
A0A0M3ILB4_ASCLU/10-168              .............................................vt--VKGTNPQYLVEKIIRTRIYD..S.KYWKEECFALTA................................-ELVVDRGIE-..LRYVGG..............-IYA.GNV.............................................KP.TPFLCLSLKL.LQIQPEKD..........IIV.EFIR...............................................QEEYK..YIRALGAM....Y...L.....RLTFS........................SIEV....YK.YLE.....PL..YNDYR.KLRYMNKDG..............-----....RFELVYMDEFID.NLL.......RQERY...CD..I..QLPRLQ---------lv...................................................................
W2S0L2_9EURO/19-185                  .............................................pl--IRGQNPATFIETATRDRITD..S.LYWKEQCFGLNA................................-ATLLDRAVE-..LTYIGG..............-TYG.VGM.............................................RP.TPFLCLAFKL.LTIVPDRD..........IVL.EYLNr.............................................gGEEWK..YLRALAAF....Y...I.....RLTFD........................PAEI....YK.TLE.....PF..LEDSR.KLRRRRKEI..............-----....-YVLTYMDEFVD.ELL.......TKKRS...MG..T..ALWPMPSRQALEDL-d....................................................................
A0A0L1KXD1_9EUGL/17-211              ..............................nmkrkrswrcekllrsd---------------IYELIES..S.SLWT-EIANVNT................................-VRLISMAIDR..LKVVEG.............tRFSG.KSR.............................................EA.STFQVLLAKL.LELKLPTS..........VIT.AMLC...............................................QPYFK..YITLLSAV....V...I.....RLTQP........................HWVI....WQ.LLG.....PL..LNDYR.NLIIRVPPCp...........snSIESS....GHESFLLDNLIM.TLD.......-----...--..-..---------------gqqtyallnmdvlifdllhltghyrildihlphisitpsn.............................
J3MVI2_ORYBR/10-175                  ...............................................KSIHGTNPQNLVEKIVRSKIYQ..S.TYWKEQCFGLTA................................-ETLVDKAME-..LDHTGG..............-TYG.GSR.............................................KP.TPFLCLALKM.LQIQPDKD..........IVV.EFIK...............................................NEDYK..YVRVLGAF....Y...L.....RLTGT........................VADV....YQ.YLE.....PL..YNDYR.KIRQKLSDG..............-----....KFTLTHVDEFID.ELL.......TKDYS...CD..T..ALPRIQKRWVLET--sg...................................................................
H2WNF1_CAEJA/10-112                  ..............................................k-TVKGTNPQFLVEKIIRQRIYD..S.MYWKEHCFALTA................................-ELVVDKGMD-..LRYIGG..............-IYA.GNI.............................................KP.TPFLCLALKM.LQIQPDKD..........IVX.X---...............................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------xxxxxpyrvsashddrrdrrdkk..............................................
W4GRF9_9STRA/57-221                  ..............................................l-PIHGNQTTYNFNTLLYDNVMN..S.DYFR-KLYELAT................................YHEVVDEIYYR..VDHAEP..............WAAG.TSR.............................................IP.STCFCLLMKF.CTMRLTVN..........QMQ.GLLK...............................................HVDSP..FIRCVGFL....Y...L.....RYTCD........................PELL....WE.WYE.....PF..LDDEE.---------..............EFNASs..nDAILTTMGAWIR.SLL.......EDLNY...FN..T..ILPRIPKKIQ-----dgik.................................................................
F0XUL2_GROCL/26-192                  .............................................ap---NGLNPATIMEKAVRERIVD..S.YFWKEQCFGVNE................................-ADVVDRVVDH..VNCIGG..............-TTG.TAQ.............................................KP.TPFLCLAFKL.LQLAPNDE..........ILA.AYLQh.............................................gGERFK..YLRALALF....Y...V.....RLTRP........................ADAV....YR.TLE.....PF..LADRR.KLRRRGRAG..............-----....-TTLTFVDDFVD.DLL.......VKPRV...CA..T..SLWKLPSRDVLED--lg...................................................................
A0A075AYX0_9FUNG/10-174              ..............................................f-QVHGVDPQFLIEKITRTRIYE..S.QYWKENCFGLNI................................-ETLVDKAVK-..LDHIGG..............-LFG.T-N.............................................IP.TPFLCLVLKM.LQLAPTKD..........IVF.EFVR...............................................NGDYK..YVRALGVF....Y...L.....RLVGS........................GLEI....YR.ELE.....PL..LADYR.KLRLRNKDR..............-----....SYTIIHMDEFVD.ELL.......TQERT...FD..T..ILPRIVKRHVLAE--tg...................................................................
M7YQW6_TRIUA/1-102                   ..............................................m----------------------..-.------------................................----------E..LDHTGG..............-THD.GNR.............................................RP.PPFLCLALKV.LQIQPNKE..........IVL.EFIK...............................................NEDYK..YVRVLGAF....Y...L.....RLTGT........................VADV....YQ.YLE.....PL..YNDYR.KISQKLSDG..............TS---....------------.---.......-----...--..-..---------------rtleprrsaleddf.......................................................
A0A0A2VHG9_BEABA/24-191              ............................................lap---NGLNPANIMEKAVKDRITD..S.YFYKEQCFALNE................................-ADIVDRVVEH..VRFIGG..............-TSG.TTQ.............................................KP.SPFLCLAFKL.LELSPSDA..........VLA.EYLAy.............................................gGEHFK..YLRALACF....Y...L.....RLTRQ........................AKDV....YE.TLE.....PF..LADRR.KLRRKGRER..............-----....-TTLTYMDEFVD.DLL.......SKDRV...CA..T..SLWKMPKREILEDL-e....................................................................
F0XVG8_AURAN/1-161                   .............................................mv--LHGNQETFNLNPLLANCILN..H.EYSR-VLWEMGP...............................sFDKLVAEARTK..VTHVEP..............WQRG.TSR.............................................TP.STAFCIVMRL.FQLNLHEG..........HVR.ALLD...............................................QRDAP..WVRCVGFL....Y...L.....RYVCP........................PGDL....WK.WCE.....DV..LLDDG.---------..............AAPVE....PRGDVSLSQWLR.GLL.......TDQKY...FG..T..ILPRIPLKIE-----r....................................................................
U6Q036_HAECO/10-175                  ..............................................h-TVKGTNPQFLVEKIIRQRIYD..S.KYWKESCFALSA................................-DLIVDRALD-..LRYIGG..............-IYA.GNV.............................................KP.TPFLCLALKM.LQIQPEKD..........III.EFIQ...............................................QEQSK..YARALGAM....Y...L.....RLTFS........................SVEI....YK.YLE.....PL..FNDYR.KLRYMNKLG..............-----....RFELVYMDEFID.NLL.......REERY...CD..I..QLPRLQKRQALED--ag...................................................................
A0A074XMF4_9PEZI/19-183              .............................................tl--IRGQNPLLLFEKAVRDRIID..S.YYWKEQCFGLNA................................-ATLCDRAID-..LSFIGG..............-TYG.IGQ.............................................KP.TPFLCLAFKL.LQLTPEKE..........IIL.HYLQ...............................................QDDWK..YLRALAAF....Y...I.....RLAWE........................PKDI....YE.TLE.....MY..LSDYR.KLKRRTRDA..............-----....-YALSHVDQFID.DLL.......TKDRV...CA..T..SLWKMPTRTQLEDL-d....................................................................
A4HE72_LEIBR/304-441                 .....................ftafeqheqnvkavlhycetnvcyag----------------------..-.------------................................-----------..------..............-VFD.DHE.............................................EA.SPFLVAMGLC.WRLGLTMD..........DVC.RHFA...............................................RHPRR..VIRALALY....L...A.....RYTLA........................PEDY....VY.FFT.....PS..LCDEV.VIACTEDAQ..............-----....--VTLSMRDLSR.QLL.......TKNDV...VD..A..WLPILSKHWQ-----vnv..................................................................
H2KT99_CLOSI/29-213                  ..............................................l-KLWGNQQTMNLNTMVYTNIVQ..S.PYFKANLIELRT................................YHEVIDEIYYK..VEHLEP..............WERG.SRRvggqsgmcg...........................gvrgvgaggIV.STAFCLLYKL.FTLKLTRK..........QLK.GLLD...............................................HPDSP..YIRALGFM....Y...I.....RYCLP........................PEDF....WW.WYA.....PY..LDDAE.---------..............EIDVKa..gGGSMMTIGSMIQ.HWL.......TKLDW...FG..T..LFPRIPVPVQKK---lee..................................................................
PR38A_HUMAN/10-175                   ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
#=GR PR38A_HUMAN/10-175        SS    ..............................................---BTTB-GGGGS-HHHHHHHHC..S.HHHHHHSTT--G................................-GGHHHHHTT-..---EE-..............-EET.TTT.............................................EE.-HHHHHHHHH.HHH---HH..........HHH.HHHH...............................................-SS-H..HHHHHHHH....H...H.....HHHS-........................HHHH....HH.HHG.....GG..GG---.EEEEE-TTS..............-----....-EEEEEHHHHHH.HHH.......H-SEE...TT..E..E------CHHHCCT-T....................................................................
A0A0D3B635_BRAOL/10-175              ...............................................KNIRGTNPQNLVEKIVRTKIYN..H.TFWKEQCFGLTA................................-ETLVDKAME-..LDHVGG..............-TFG.GNR.............................................KP.TPFLCLILKM.LQIQPEKE..........IVV.EFIK...............................................NDDYK..YVRILGAF....Y...L.....RLTGS........................DVDV....YR.YLE.....PL..YNDYR.KVRQKLSDG..............-----....RFSLTHVDEVIE.ELL.......TKDYS...CD..I..AMPRLKKRWTLEQN-g....................................................................
A4RRH8_OSTLU/10-175                  ..............................................k-TVRGMDPQNIMERITRDKVYA..M.TYWKEKCFAVSA................................-EALVDLAVD-..LRAVGG..............-IYG.GNN.............................................RA.TEFLCLTLKL.LQIQPEKE..........IIL.EFIK...............................................NEDHK..YVRLLGAF....Y...L.....RLVGK........................PTDV....YQ.YLE.....PL..LNDYR.KVRYRSRDG..............-----....KYVLTHVDEFVN.NLL.......TKDMF...CD..V..ALPRVPHRQALEA--ag...................................................................
C1E4N5_MICSR/10-173                  ............................................tgr----DNGKSYNMERVLRSNILN..S.DYFV-QLSKIED................................FMDLVDEIYNE..VDHVEP..............WMSG.NAR.............................................GP.STAFCLLYRL.FTMELDDR..........NVN.HLIR...............................................HRDSP..YIRAIGFL....Y...V.....RYVRD........................PKEF....GR.WFD.....PF..FKDDE.---------..............EFAPM...pGGKNVTIGAFVR.DLV.......LDQYY...FE..T..IFPRCPEVT------rralvd...............................................................
A0A0D2WQ43_CAPO3/10-175              ..............................................v-SVHGTNPQYLIEKILRERIVE..D.AYWKEHCFALTA................................-ESVIDKAVE-..LAYVGG..............-TFG.QHV.............................................KP.SPFLCLTLKL.LQLQPSHD..........IIM.TYIE...............................................NTDFK..YLRALGAF....Y...L.....RLTAQ........................SLEI....YE.VLE.....PL..YTDFR.KLRTRNKEG..............-----....EYGLTHMDEFID.RML.......RDDRV...CD..V..ALPRLMQRHVLE---vsg..................................................................
F7GLK3_MONDO/52-236                  ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
F2EBP1_HORVD/3-150                   ...........................................lqts----GRPIEVLMEKVLSMNIVS..S.DYFK-ELYKIKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKL.FTMKLTVN..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYAAD........................PKTL....WT.WYE.....PY..IQDDE.---------..............EFSPG...sNGKMTTMGVYVR.DVI.......L----...--..-..---------------gqvyl................................................................
A0A0J7LB91_LASNI/37-224              ..............................................l-PLWGNERTMNLNPLILTNIQS..S.HYFKVNLYELKT................................YHEVIDEIYYK..VSHLEP..............WEKG.SRKtagqtgmcggr.......................fmqvrgvgaggIV.STAYCLLYKL.FTLRLTRK..........QLN.GLIN...............................................HPDSP..YIRALGFM....Y...I.....RYTQP........................PADL....FS.WYS.....DY..LEDEE.-----DLDV..............--KAG....GGQTMKMGDILK.QFL.......TKLEW...FS..T..LFPRIPVPIQKD---le...................................................................
G8F4J3_MACFA/47-231                  ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
A2QN12_ASPNC/21-209                  ..............................................l--VRGVNPATLFEKAVRDRITD..S.YYWKEQCFGLNA................................-ATLCDRAVE-..LTSIGG..............-VYG.VSE.............................................KP.SPFLCLAFKL.LQLNPERD..........IIL.EYLNfsdpandedstg......................heerehddgvvkaRGDFK..YLRALAAF....Y...V.....RLTFE........................PVEV....YK.TLE.....PL..LLDYR.KLKRRVRDS..............-----....-FTLTYMDQFVD.ELL.......TKERV...CG..T..SLWKLPARQVLEDL-d....................................................................
H2R123_PANTR/10-175                  ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
B8AYN3_ORYSI/3-166                   ............................................iqt---SGKPIDLLMEKVLCMNIMS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKIL....WT.WYE.....PY..LKDDE.---------..............EFSPG...sNGRMTTMGVYVR.DLI.......LGQYY...FD..S..LLPRVPLPV------irqvt................................................................
G3VUT2_SARHA/10-175                  ..............................................h-HIHGTNPQFLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDRATE-..LRFVGG..............-VFG.PNI.............................................QP.TPFLCLTLKM.LQIQPEKD..........IVI.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AMDC....YN.YLE.....PL..YNDNR.KSRIQNRNG..............-----....DFEFIHVDEFID.QLL.......HSERV...CD..I..ILPRLQKRHVLEET-n....................................................................
E2QU96_CANLF/10-175                  ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A3GFM9_PICST/15-192                  ............................................dkr---NVLNRAHLIEPIVRHRIQD..S.LFYKQHLHLTNE................................-ASILPVIIDQ..VHYLAG..............--MD.SSG.............................................RP.SPFICCLLRL.LELEPSME..........IVQ.TCLDq............................................lgYNEFK..YLTALMLI....Y...I.....RLVGS........................SDLV....YT.TFD.....KY..LSDFR.KLRTKLKSP..............IFNEKglpiNYRLTYFDEWID.NML.......LQERV...MD..I..ILPRLTPRRNLVE--kg...................................................................
A0A0A2KNT9_PENIT/21-204              ..............................................l--VRGVNPATLFEKAVRDRITD..S.YYWKEQCFGLNA................................-ATLCDRAVE-..MTSIGG..............-TYG.VSE.............................................KP.TPFLCLAFKL.LQLGPDRD..........VIL.ELLNytdpgsgdea...........................enpddalvkdRGDFK..YLRALAAF....Y...V.....RLTFD........................PVDV....YK.TLE.....PL..LLDYR.KLKRRVRDT..............-----....-FTLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKLPPRAQLEDL-d....................................................................
A0A078A0F3_STYLE/218-371             .........................................pincdy-------KNGNLPDMLRNNILS..C.QYFK-DLYALKS................................FQEVIEEIKTN..VTYTDA..............WVIG.ANS.............................................IP.SSLFCCLYKL.MLMRLNEK..........QVG.NLIK...............................................YKHSQ..YVRACGAL....Y...I.....RFLSP........................HDQL....WD.RLS.....PY..MLDEQ.---------..............EFCYS...iDKSKINFGEYVE.KLL.......EIQ--...--..-..---------------kkllsipekr...........................................................
F7ISR6_CALJA/47-92                   ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIY--..------..............----.---.............................................--.----------.--------..........---.----...............................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------fk...................................................................
A0A0E0QYC5_ORYRU/23-76               ...........................................kkvv---------------LSVNILS..S.DYFK-ELYRLKT................................YHEVINVIYNQ..VDHVEQ..............WMTG.Q--.............................................--.----------.--------..........---.----...............................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------llwplqrll............................................................
C5LME5_PERM5/21-137                  ............................................lql----TNTTTYNYPQMLHQQLAK..S.AYYH-SIQPLDT................................PEAIIDEIKTR..CKDAEP..............YAPG.SHT.............................................AP.STMFCCLYRL.FVMRINSK..........VLG.QLIN...............................................YHGAP..YVRCAGFL....Y...V.....RFGLS........................PRDY....WS.FLQ.....PH..L----.---------..............-----....------------.---.......-----...--..-..---------------l....................................................................
G3NPB2_GASAC/10-174                  ..............................................n-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LKYVGG..............-VFG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..NVRLLGAM....Y...M.....RLTGT........................AVDC....YK.YLE.....PL..YNDYR.KEKNQNRNG..............-----....EFELMHVDEFID.ELL.......HAERM...CD..I..ILPRLQRHV-LE---eae..................................................................
A0A0D3BZE4_BRAOL/4-168               ..............................................i-QTNGRAYESLLEKVLSMNIVS..S.DYFK-ELYGLKT................................YHEVIDEIYNQ..VSHVEP..............WMGG.NCR.............................................GP.STAYCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HTDSP..YIRAVGFL....Y...L.....RYVAD........................AKTL....WT.WYE.....PY..IKDDE.---------..............EFAPG...sNGRTTTMGVYVR.DLL.......LGLYY...FD..T..LFPRIPVPVMR----qivs.................................................................
PR38B_RAT/47-231                     ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
W5QC53_SHEEP/39-223                  ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
G3TY10_LOXAF/47-231                  ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
F7VQJ3_SORMK/24-191                  ............................................lap---NGLNPATIMEKAVRERIID..S.YFYKEQCFGVNE................................-ADIVDRVVEH..VDYIGG..............-VAG.TVQ.............................................KP.TPFLCLAFKL.LQLAPSDD..........ILN.EYLQf.............................................gGEKFK..YLRALALF....Y...I.....RLTRK........................DHDV....YK.TLE.....PF..LEDRR.KLRRKGRNG..............-----....-TSLTYMDVFVD.DLL.......TKDRV...CA..T..SLWKMRKRDILEDL-d....................................................................
L9KRQ0_TUPCH/10-175                  ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.ANI.............................................KP.MPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
C4JLP1_UNCRE/21-208                  ..............................................l--IRGVNPATLFEKAVRDRITD..S.YYWKEQCFALNA................................-ATLCDRAVE-..LSYIGG..............-TYG.ANQ.............................................KP.TPFLCLAFKL.LQLAPEKE..........VVL.EYLNfhdpaaddddvd.......................eeggdgaavlkaVGDFK..YLRALAAF....Y...I.....RLTFD........................PVEA....YT.VLE.....PL..LSDYR.KLKRRTKDG..............-----....-FVLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKLPARRVLEDL-d....................................................................
H2N6K2_PONAB/47-231                  ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
B4NCI0_DROWI/29-213                  ..............................................l-PFWGNETSMNLNPLILANIQS..S.SYFKVHLFKLKT................................YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.YTLRLTRK..........QIN.GLLN...............................................HTDSA..YIRALGFM....Y...L.....RYTQP........................PGDL....YE.WYK.....DY..LQDEE.---------..............EIDVKa..gGGQVLTMGQMVY.QFM.......TKLDW...FS..T..LFPRIPVPIQKQIE-k....................................................................
A0A078A1R7_STYLE/10-175              ...............................................KQIHGTNPQFLIDTVMRKNIHN..D.PYYKEKCFALTA................................-ETLVDRAIE-..LKYVGG..............-TYG.GNS.............................................RP.TKFMCLILKM.LQIQPDTD..........IVL.EFIK...............................................NTDYK..YIRLLGAF....Y...W.....RLTAK........................GQDV....FK.VLE.....PI..YSDYR.RVAFRKKDG..............-----....QFEAMHIDEFID.HLI.......RDEIF...CD..V..SFPRINKRHVYEED-n....................................................................
Q4GZ20_TRYB2/36-209                  .............................................wn--LKGRSAVAAFDPVTRHRILQ..S.QTMA-ACFHRPL................................MATMEDLI-S-..VSYVGG..............-LSG.PLR.............................................KP.EPFICLIARV.LQITPNTA..........IVM.AMLR...............................................QDVHK..YLRVAALF....I...I.....RLIGN........................GTAM....RE.ALR.....IG..WNDYR.KIRVYGSKDd............cT----....------------.---.......-----...--..-..---------------cetksqdgekadtnevegealvaapihaimcvdeitdrlfntgr.........................
D7MIA4_ARALL/4-168                   ..............................................i-QTNGRAYESLLEKVLSMNILS..S.DYFK-ELYGLKT................................YHEVIDEIYNQ..VNHVEP..............WMGG.NCR.............................................GP.STAYCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HTDSP..YIRAVGFL....Y...L.....RYVAD........................AKTL....WT.WYE.....PY..IKDDE.---------..............EFSPG...sNGRMTTMGVYVR.DLL.......LGLYY...FD..T..LFPRIPVPVMR----qivs.................................................................
L1LC98_THEEQ/10-175                  .............................................nm--VHGTNPQYLFSKIMRDKVYN..S.IYWKESCFGLTS................................-ESIIDKAIE-..IEYIGG..............-TFG.GNR.............................................QP.SPFICLVLKL.LQIQPELD..........IVE.EYIK...............................................NEDYK..YLRALGVY....Y...L.....RLVGD........................PVRV....YK.TLE.....PL..LSDYR.RLRFRGPDG..............-----....SYTIKHMDEFVD.DCL.......RSSTY...LD..V..DLPPLAKRINLENS-n....................................................................
A0A0D9S7A0_CHLSB/1-34                ...............................................----------------------..-.------------................................-----------..------..............----.---.............................................--.----------.--------..........---.----...............................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------..............-----....----MHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
U3IFV6_ANAPL/4-188                   ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKTI--dq...................................................................
F4P219_BATDJ/9-173                   ...............................................KNIHGTNPQFLIEKILRERIYE..S.AYWKEKLFGVSA................................-ETLLDRAVE-..LQAIGG..............-QFG.SQ-.............................................KP.TEFICLALKI.LQLQPDDE..........IIT.LFLT...............................................NSDFK..YLTALAAF....Y...I.....RLTES........................HSQV....YR.RLE.....PL..LQDRR.KLRRRTNVG..............-----....GYELTFMDQFIS.DLL.......LEDRM...CD..T..ILPRLTKRYILEDQ-g....................................................................
G2PZZ7_MYCTT/24-191                  ............................................lap---NGLNPATIMEKAVRERIVE..S.YFFKEQCFGVNE................................-ADIVDRVVEH..VDHVGG..............-VTG.TSQ.............................................RP.TPFLCLAFKL.LQLAPGDD..........ILD.EYLHf.............................................gGDKFK..YLRALAAF....Y...I.....RLTRP........................DRDV....YI.RLE.....PF..LEDRR.KLRKKGRNG..............-----....-TTLTYMDEFID.DLL.......TKDRV...CS..T..SLWKMRRRDILEDL-d....................................................................
G5B2Y6_HETGA/1-99                    ...............................................----------------------..-.------------................................-----------..------..............----.---.............................................--.---------M.LQIQPEKE..........III.EFLK...............................................NEDCK..YVRLLGAL....Y...T.....RLTGT........................AIDC....YK.YLE.....PL..YKDYR.KIKSQKQNG..............-----....ELELMHVDDFID.VLL.......HSETV...CE..I..ILPRLQKRYVLQE--ae...................................................................
A0A0D2R045_GOSRA/3-166               .......................................iqtcgkpi--------DSLLEKVLCMNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYAAD........................PKTL....WS.WFE.....PY..IKDEE.---------..............EFSPG...sSGRMTTMGVYVR.DLL.......LGQYY...FD..T..LFPRIPVPVL-----rqvt.................................................................
U5FR78_POPTR/10-175                  ...............................................KNIRGTNPQNLVEKILRSKIYQ..H.TYWKEQCFGLTA................................-ETLVDKAME-..LDHLGG..............-TYG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKD..........IVV.EFIK...............................................NEDYK..YVRVLGAF....Y...L.....RLTGT........................DIDV....YR.YLE.....PL..YNDYR.KLRKKLTDG..............-----....KFALTHMDEVID.ELL.......TKDYS...CD..I..AMPRIKKRWTLET--la...................................................................
A0A067TR38_9AGAR/10-173              ..............................................q-AIHGQNPQFLVETVIRNRIYE..S.TYWKEHCFALTA................................-ESLIDKAID-..SRFIGG..............-VYG.NQR.............................................-P.TEFLCLLLKL.LQIQPEKE..........ILV.EYLR...............................................AEEFK..YLRALAAL....Y...I.....RMTFR........................AVDV....YE.LLE.....PL..LKDYR.KLRMRNMSG..............-----....-YSLVFMDEFIC.SLL.......TEERV...CD..I..IMPRIAKRQVLEEN-g....................................................................
A0A094GDZ7_9PEZI/22-189              ............................................lap---NGLNPATIFEKPVRERIID..C.YFWKDQCFALNE................................-ADIVSRVVEH..VHFVAG..............-TYG.DSQ.............................................RP.SPFLCLAFKL.LQLGPGDD..........ILN.EYLGy.............................................gGERFK..YLRALACF....Y...V.....RLTRP........................AKEV....YE.TLE.....PF..LEDGR.KLRRRGRQG..............-----....-TTLTFVDQFVD.ELL.......TKERI...CA..T..SLWKMPKREVLEDL-e....................................................................
A0A044QM65_ONCVO/10-175              .............................................vt--VKGTNPQYLVEKIIRTRIYD..S.KYWKEECFALTA................................-ELLVDKGME-..LRYIGG..............-IYA.GNV.............................................KP.TPFLCLCLKM.LQIQPEKD..........IAV.EFIR...............................................QEEYK..YIRALGAM....Y...I.....RLTFT........................SIEV....YK.YLE.....PL..YNDYR.KLRMMNNEG..............-----....RFEIVHMDEFID.NLL.......REERY...CD..I..HLPRIQKRITLEE--vg...................................................................
K3VWG0_FUSPC/26-192                  .............................................ap---NGLNPATIMEKAVRDRIVD..S.IYYKMQCFACNE................................-ADIVDRVVED..VKFIGG..............-TYG.TTQ.............................................VP.SPFLCLAFKL.LELSPSDA..........VLL.EYLKf.............................................gGEAFK..YLRALACF....Y...F.....RLTRQ........................AKNV....YE.MLE.....PF..LEDRR.KLRRRGREG..............-----....-VKLSYMDEFVD.DLL.......TKERV...CG..T..SLWKMPKREVLEDL-e....................................................................
E9EAI6_METAQ/24-191                  ............................................lap---NGLNPATIMEKAVKDRIVE..S.YFYKEQCFALNE................................-ADIVDRVVEH..VSFVGG..............-THG.DAQ.............................................KP.SPFLCLAFKL.LELGPSED..........VVR.EYLSy.............................................gGEHFK..YLRALACF....Y...Y.....RLTRK........................AADV....YR.TLE.....PF..LDDRR.KLRRKGRRG..............-----....-TSLTYVDDFVD.DLL.......TRERV...CA..T..SLWKMPPREILEDL-d....................................................................
W9QWY7_9ROSA/10-174                  ...............................................KSIRGTNPQNLVEKIVRSKIYQ..N.TYWKEQCFGLTA................................-ETLVDKAME-..LDHVGG..............-TFG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKE..........IVI.EFIK...............................................NDDYK..YVRVLGAF....Y...L.....RLTGS........................DTDV....YQ.YLE.....PL..YNDYR.KIRRKLADG..............-----....NFSLTHVDEVID.ELL.......TKDYS...CD..I..ALPRIKKRWTLE---si...................................................................
S9VFC1_9TRYP/46-244                  .............................................wn--LQGRSAFAVLDPTTRHRIAH..A.HNMT-RCRDQPL................................-LWVLEELIT-..IESVGG..............-LSG.PLF.............................................RV.EYFLCLVARV.LQAAPDPA..........VVL.ALLR...............................................QDVHK..YLRVAALF....M...I.....RLIGN........................VAMQ....KE.AVR.....VG..WDDYR.KIRVYGDEG..............EVD--....------------.---.......-----...--..-..---------------yvfdatlrgrkxpreaaegeqppvnieeakpahyfilcmdeltdrlfrvdsdgekrsqffgvplpplmf
H0WS15_OTOGA/10-175                  ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
Q8II38_PLAF7/11-175                  ............................................knf----GSNPQYLISNIIRSKIYD..S.PYWKEKCFALTS................................-ESIIDQAIN-..LKYVGG..............-TYG.GNR.............................................KP.TRFLCLILKL.LQIQPDKD..........IIY.EYIK...............................................NEDFV..YLRALGIF....Y...L.....RLIGK........................SLEV....YN.HLE.....PI..LFDYR.KIRMRLQNG..............-----....TFEKIYMDVFVD.NCL.......ILNNF...LD..V..DFPTLTKRQVLEEN-n....................................................................
E3RUL4_PYRTT/23-233                  ..............................................k-LIRGQNPALLFEKGVRERITE..S.YYWKEQCFGLNA................................-ATLCDRAAE-..LKFIGG..............-TTG.ING.............................................KP.TPFLCLAFKM.LQLVPDKD..........IIL.EYLNfrdddedeehnedntdanadaen.ghvsdtestaaakktldlnakgkLGNFK..YLRCLAAF....Y...I.....RLAWE........................PVEI....YT.TLE.....PL..LTDYR.KIKRRLKDA..............-----....-FTLTYIDQFVD.DLL.......TKERI...CA..T..SLWKLPSRANLEDL-d....................................................................
V9FB38_PHYPR/37-201                  ..............................................l-PIYGNDTTYNLNTLLHQNILQ..S.AYFH-ELYKFRT................................YHEVVDEIYYR..VDHAEP..............WSPG.TAR.............................................IP.SSCFCLLHKF.LLMRLTRK..........QMQ.GLLR...............................................HTDSP..YIRVVGFL....Y...L.....RFTCD........................PEEL....WT.WFE.....PF..LEDPE.---------..............EFNASa..nPSVKTTIGEWLI.SLL.......EENNY...FG..T..ILPRIPKKIE-----dgik.................................................................
G1LCH7_AILME/47-231                  ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
A0A067D0W8_SAPPC/50-213              ..............................................l-PVHGNATTYNLNKMLFDNIMQ..S.VYFG-QLYALKT................................YHEVVDEIYYR..VDHAEP..............LSPG.TAR.............................................IP.SSCFCLLLKF.CTMRLTHN..........QMQ.GLLK...............................................HVDSP..YIRCVGFL....Y...L.....RYTMD........................PEEL....WA.WFE.....PY..LDDAE.---------..............EFNASa..nDKIITTIGVWLR.TLL.......EEINY...FG..T..ILPRIPKKI------ldgi.................................................................
A0A0G4F474_9ALVE/149-314             ............................................vem----TNPTTFNLNTLLRENILS..S.EYYK-SLFALKQ................................FHEVVDEIYQY..ADHADP..............YCAG.NSR.............................................AP.STLFCCLYKF.FTMRLTEK..........QVK.SLLD...............................................HQDSP..YIRACGFL....Y...L.....RYILD........................PQKL....WK.WYE.....PY..FLDDE.---------..............EFAPGt..dKNKKMEMGQFVE.SLI.......TEDKYgshSS..T..VLPRLPVKIKT----qy...................................................................
B4NNL6_DROWI/10-175                  ...............................................KNVHGTNPQYLIEKIIRSRIYD..S.KYWKEQCFALTA................................-ELLVDKAME-..LRFVGG..............-VFG.GNI.............................................KP.TQFLCLTLKM.LQIQPEKD..........IVV.EFIK...............................................NEEFK..YVRALGAF....Y...L.....RLTGA........................ALDC....YK.YLE.....PL..YIDNR.KLRRQNRSG..............-----....QFEIVYMDEYID.ELL.......RNDRV...CD..I..ILPRIQKRTILEEN-n....................................................................
A0A059ADM4_EUCGR/1-112               ...............................................----------------------..-.------------................................-----------..------..............-MTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYAAD........................PKTL....WS.WCE.....PY..VKDEE.---------..............EFSPG...sNGRMTTMGVYLR.DLL.......LGQYY...FD..T..LFPRIPVPVL-----rqiv.................................................................
K7IUN1_NASVI/10-175                  ...............................................KSIRGTNPQYLVEKIIRSRIYD..S.KYWKEECFALTA................................-ELLVDKAME-..LRFIGG..............-VFG.GNI.............................................KP.TPFLCLILKM.LQIQPEKD..........IIV.EFIK...............................................NEEFK..YVRALGAF....Y...M.....RLTGT........................SLDC....YR.YLE.....PL..LNDYR.KLRKQNRQG..............-----....QFEIIHVDEFID.DLL.......RAERC...CD..I..ILPRIQKRHVLEEN-n....................................................................
Q6CS55_KLULA/14-213                  ...............................................KQLNHQSASLVVPQIFRNKVSS..C.MYYKFNLTPASLrg............................dtIVELIPVIVRD..FGTMDErkt........phvTVLG.GIE.............................................--.--FKCLLMKL.INLRPPWE..........QLK.VLLEp............................................hePLNNK..YIAALVLC....Y...M.....RISYYfltesn...........pseqdisFNLL....HD.LMK.....KY..ILDHR.KLKSYSLDMdc..........wsSSIKK....EIKLIHFDELID.WLC.......DRNEI...WG..I..PLGKCNW-CKIW---ddee.................................................................
V2XVC5_MONRO/10-173                  ..............................................k-AIHGQNPQFLVETVIRNRIYE..S.SYWKEHCFALTA................................-ESLIDKAIE-..LKCIGG..............-VYG.NQR.............................................-P.TEFLCLLLKL.LQIQPEKE..........ILI.EYLQ...............................................ADEFK..YLRALAAM....Y...I.....RMTFG........................AAEV....YQ.ILE.....PL..LKDYR.KLRLRNMTG..............-----....-YILTFMDEFVD.SLL.......TEERV...CD..I..ILPRLIKRQVLEEN-g....................................................................
E6NU38_JATCU/10-175                  ...............................................KSIRGTNPQNLVEKILRSKIYQ..N.TYWKEQCFGLTA................................-ETLVDKAME-..LDHLGG..............-TFG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKD..........IVV.EFIK...............................................NDDYK..YVRILGAF....Y...L.....RLTGT........................DVDV....YR.YLE.....PL..YNDYR.KLRQKLPDG..............-----....KFALTHVDEVID.ELL.......TKDYS...CD..V..ALPRIKKRWTLES--lg...................................................................
C3ZRP3_BRAFL/7-191                   ..............................................l-PLWGNDKTMNLNSLILTNIQS..S.PYFKNDLFQLKT................................YHEVIDEIYYK..VQHLEP..............WEKG.SRNtggqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.FTLKLTRK..........QVN.GLLQ...............................................HGDSP..YIRGLGFM....Y...I.....RYTQP........................PADL....WE.WYE.....PY..IDDDE.---------..............ELDVKa..gTGCMMTVGEMLR.SFL.......GKIEW...FS..T..LFPRIPVPIQKD---leg..................................................................
A0A0K9PSL8_ZOSMR/10-175              ...............................................KSIHGTNPQNLVEKIVRSKVYQ..H.TYWKEQCFGLTA................................-ETLVDKAME-..LDHLGG..............-TYG.GTR.............................................KP.TPFICLVLKM.LQIQPEKE..........IVV.EFIK...............................................NEDHK..YVRVLGAF....Y...L.....RLTGT........................VMDV....YQ.YLE.....PL..YNDYR.KIRRKQADG..............-----....KFSLTRVDEFMD.ELL.......TTDYS...CD..I..ALPRVQKRWVLEQ--ag...................................................................
G8YR38_PICSO/12-187                  ............................................dkr---NVLNKASLVEPIVRHRVQD..S.IFYKQYLYLTNE................................-STILNVIIEH..VHYIGG..............--TS.ANG.............................................KP.SPFLCCMVRL.LELEPKQE..........IIQ.MYLSq............................................mgTNTFK..YLTAMTLM....Y...I.....RFVGS........................SEEI....YS.ILE.....EY..YKDYR.KLRFQLKYPr...........dhNGVHK....LYTLTYMDEWVD.DLL.......HKERL...VD..L..ILPRLPPRRFL----qei..................................................................
I3ND88_ICTTR/50-234                  ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
G1Q147_MYOLU/28-211                  ..............................................l-QLWGNEKTMNLNPMILTNI-S..S.PYFKGQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgiggIV.STAFCLLYKL.FTLKLTRK..........QVV.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLW.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
Q7PX02_ANOGA/10-175                  ...............................................KNVHGTNPQYLIEKIIRSRIYD..S.KYWKEQCFALTA................................-ELLVDKAME-..LRFVGG..............-VFG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IVV.EFIK...............................................NEEFK..YVRALGAF....Y...L.....RLTGS........................SLDC....YK.YLE.....PL..YNDNR.KLRKQNRMG..............-----....AYELIHMDEFID.ELL.......REERV...CD..I..ILPRIQKRHVLEEN-n....................................................................
A0A096MX21_PAPAN/48-232              ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
D0NHN2_PHYIT/9-173                   ..............................................q-SVHGVNPQTLVEKIMRNRIYA..S.IYWKEQCFGLTA................................-ETLVDKAVE-..LQEFGG..............-TFG.GNQ.............................................QP.THLLCLLLKM.LQLQPELE..........VVK.QFIE...............................................NEDYK..YVTVLGAV....Y...L.....RLVGK........................PLEV....YT.LLE.....PL..LSDYR.KIRKRNVIG..............-----....-WEITHVDEIAD.ALL.......NEEYY...ID..L..ALPRLVERELLEKS-d....................................................................
W7TLT3_9STRA/33-198                  ..............................................l-PIHGNQTTYNVNTLLANNIMG..C.DYFR-ALYPLQT................................YHEVIDEVYNK..VTHVEP..............WATG.TSR.............................................LP.STAFCLLFKF.FTMRLTKK..........QVT.GLLT...............................................HSDSP..YIRAIGFL....Y...L.....RYACD........................PKQI....WD.WYA.....PY..LDDSE.---------..............EFAPSs..dPNALTTLGLWLR.GLL.......SDLHY...YG..T..MLPRIPVPLERK---ikm..................................................................
A8PRE0_MALGO/10-174                  ..............................................q-AIHGTNPQFLVERVIRSRIYD..S.TYWKQDCFALNA................................-ATLIDKAVD-..LTYVGG..............-TYG.AQR.............................................-P.SPFLCLILKL.LQIQPERA..........IVL.EYLA...............................................AEDFK..YLRAVAAL....Y...V.....RLTFP........................AIEV....YE.LLE.....PM..LNDYR.KLRWRDMAG..............-----....NYSLTHMDEFID.QLL.......TEERV...CE..L..ILPRLTKRSVLESN-d....................................................................
PRP38_SCHPO/14-177                   ............................................eaa---HEMLPTFLIGKILRERIVD..S.IYWKEQCFGLNA................................-CSLVDRAVR-..LEYIGG..............-QYG.NQR.............................................-P.TEFICLLYKL.LQIAPEKE..........IIQ.QYLS...............................................IPEFK..YLRALAAF....Y...V.....RLTWD........................DVEV....HQ.TLE.....PL..LRDYR.KLRIRTNSE..............-----....-IRLTYLDEVVD.DLL.......NAEVV...CD..I..SLPPLRSRLQLEDL-d....................................................................
W7AJL3_PLAVN/162-324                 ............................................iem----TNTSTYNVNNLLRNNILS..S.EYFR-SLISLKT................................FKEVLDEILSY..ADHVEP..............YCIG.STR.............................................AP.STLFCCLYKF.FTMQLTKK..........QLK.SLID...............................................NKESC..YVRACGFL....Y...L.....RYVHC........................PSNL....WM.WFE.....PY..MLDDD.---------..............EFTVSa..dKRKLMTIGEYVQ.SLL.......YDDKY...FN..T..VLPRLPIKIK-----niy..................................................................
F2TX53_SALR5/105-247                 .............................................iw----------------------..-.------MFALKT................................FEDIVDEIYTF..VDHLEP..............IILS.PQN.............................................SP.STAFCLLYRL.FCLRLNEA..........QLD.TLVT...............................................HKDSV..YIRAIGFL....Y...L.....RYTAD........................PETL....WT.WFS.....DY..IDDPE.PVKVKMAAA..............-----....-APQMPLGEYLR.MLI.......TELQY...LHpvC..RLPRIPVMEH-----rdmld................................................................
A0A063BZU8_9HYPO/25-192              ............................................lap---NGLNPATIMEKAVRDRITE..S.YFYKEQCFALNE................................-ADVVDRVVEH..VRFVGG..............-THG.DAQ.............................................KP.SPFLCLAFKL.LELAPGDD..........ILR.EYLAh.............................................gGAHFK..YLRALACF....Y...V.....RLTRP........................ARDV....YA.SLE.....PL..LRDGR.KLRRRGRAG..............-----....-TSLTFVDEFVD.DLL.......TKERV...CA..T..SLWKMPAREVLEDL-e....................................................................
G4V8E6_SCHMA/26-210                  ..............................................l-KLWGNPQTMNLNTMIYTNIVQ..S.PYFKANLVELKT................................YHEVIDEIYYK..VEHLEP..............WERG.SRRigvqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.FTLKLTRK..........QLK.GLLD...............................................HPDSP..YIRALGFM....Y...I.....RYCIP........................PEDF....WW.WYS.....PY..WSDSE.---------..............ELDVKa..gGGCIMTIGNMLE.HWL.......TKLDW...FS..T..LFPRIPVPVQKK---lee..................................................................
A0A066XD06_COLSU/24-191              ............................................lap---NGENPATIMEKAVRERIID..S.YFYKEQCFAVNE................................-ADIVDRVVEH..VSFIGG..............-TYG.VTQ.............................................KP.TPFLCLAFKL.LQLAPSDA..........VLE.TYLGf.............................................gGDKFK..YLRALACF....Y...V.....RMTRK........................PRDV....YL.LLE.....PF..LEDRR.KLRRKGRQG..............-----....-TSLTYMDDFVD.DLL.......TKTRV...CA..T..SFRELPKRSDLVD--ld...................................................................
PR38B_HUMAN/47-231                   ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
A0A0E0QMP1_ORYRU/10-175              ...............................................KSIHGTNPQNLVEKIVRSKIYQ..S.TYWKEQCFGLTA................................-ETLVDKAME-..LDHTGG..............-TYG.GNR.............................................KP.TPFLCLALKM.LQIQPDKD..........IVV.EFIK...............................................NEDYK..YVRVLGAF....Y...L.....RLTAT........................VADV....YQ.YLE.....PL..YNDYR.KIRHKLSDG..............-----....KFTLTHVDEFID.DLL.......TKDYS...CD..T..ALPRIQKRWVLET--sg...................................................................
Q5CUQ1_CRYPI/3-168                   ..........................................neqns-----HHKLFSVSSILRDRVFS..S.IYWKGECFALDS................................-ETILDKAVL-..LDYIGT..............-TYG.GDR.............................................KA.TPFLCLLVKL.LQIRPSTE..........IVL.EYIN...............................................NPRFK..YLTALGIV....Y...L.....RLTES........................SIVI....HK.SIE.....HL..YQDYR.RIRIRNLDG..............-----....SFDIIHLDELVE.ICL.......CEKKF...LD..L..DFPYIHKRAVLVK--qg...................................................................
C1MPU3_MICPC/21-182                  ............................................qal----DNGKSYNMEKVLRTNILA..S.DYFS-QLVKMND................................FYELVDEIYNE..VDHVEP..............WMSG.NAR.............................................GP.STAFCLLYRL.FTMEIEDN..........EVK.HLIN...............................................HGDSP..YIRALGFL....Y...V.....RYARD........................PKEF....GR.WFD.....EF..LRDEE.---------..............EFSPS...pHGKSVTMGAFVR.DLI.......LDQYY...FE..T..IFPRIPEV-------srral................................................................
F7HY13_CALJA/10-175                  ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A6QTF5_AJECN/41-234                  ..............................................l--IRGVNPATLFEKAVRDRITE..S.YYWKEQCFGLNA................................-ATLCDRAAE-..LSYIGG..............-TYG.LAQ.............................................KP.TPFLCLAFKL.LQLAPEKD..........IVL.EYLNfhdpenghvegsemn.................gsegeqggasgvvkaVGDFK..YLRALAAF....Y...I.....RLTFD........................AADI....YK.SLE.....PL..LTDYR.KLKRRMKDG..............-----....-FVLTYIDQFVD.DLL.......TKDRV...CG..T..SLWKLPSRHQLEDL-d....................................................................
A0A0K0JRM4_BRUMA/47-231              ..............................................l-PLWGNTQTMNLNALVLENIIQ..C.TYYKNYLAETTG................................FQQLTEEIYYS..VKHLEP..............WERG.TRKtqgmtgmcg...........................gvrgvgaggVV.STAFCLLYKL.FTIRLSRK..........QLV.SMIN...............................................NSDSP..YIRGIGFM....Y...I.....RFCQP........................PQDL....WA.WME.....PY..LDDEE.---------..............QIDPRs..gGGDVMVMAQVVK.MML.......TKLDW...YG..T..LFPRIPVPIQKEI--el...................................................................
C1GJF7_PARBD/21-214                  ..............................................l--IRGVNPATLFEKAVRDRITE..S.YYWKEQCFGLNA................................-ATLCDRAVE-..LTYIGG..............-TYG.LAQ.............................................KP.TPFLCLAFKM.LQLSPEKE..........IVL.EYLNfhdpetghdgvygen.................nveedhdkdsgvvkaVGDFK..YLRALAAF....Y...I.....RLTFD........................AAEI....YT.TLE.....PL..LADYR.KLKRRTKDG..............-----....-FLLTYMDQFVD.DLL.......TKDRV...CA..T..SLWKLPSRTQLEDL-d....................................................................
C7YSE8_NECH7/25-192                  ............................................map---NGLNPATIMEKAVKDRIVD..S.YFYKEQCFALNE................................-ADIVDRVVEH..VSFIGG..............-TYG.VTQ.............................................KP.SPFLCLAFKL.LELAPSDA..........VMH.EYLHy.............................................gGDEFK..YLRALACF....Y...F.....RLTRQ........................AKDV....YE.MLE.....PF..LEDRR.KLRRRGRDG..............-----....-VALTYMDEFVD.DLL.......VKDRV...CG..T..SLWKMPKRETLEDL-e....................................................................
G3QMW7_GORGO/10-175                  ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
F9F8Y6_FUSOF/26-192                  .............................................ap---NGLNPATIMEKAVKDRIVD..S.YFYKEQCFALNE................................-ADIVDRVVEH..VNFIGG..............-TYG.VTQ.............................................KP.SPFLCLAFKL.LELSPSDA..........VLM.EYLKy.............................................gGEAFK..YLRALACF....Y...F.....RLTRQ........................AKDV....YE.MLE.....PF..LEDRR.KLRRRGRAG..............-----....-VVLTFMDEFVD.ELL.......TKERV...CG..T..SLWKMPKREVLEDL-e....................................................................
A0A0F4GLW9_9PEZI/19-186              .............................................tl--IRGDNPLKLFEKPVRDRIVD..S.YYWKEQCFGLNA................................-ATVLDRAVE-..LTFLGG..............-TYG.VAQ.............................................KP.TPFLCLAFKL.LQLTPEKE..........IIM.YYLEq.............................................aGEEFK..YLRALAAF....Y...V.....RMAWE.......................kDEDV....YT.TLE.....PY..LADFR.KLKRRTREG..............-----....-WALTHVDQFID.DLL.......VKSRV...CA..T..TLPKINPRTFLEDE-d....................................................................
Q9FHS8_ARATH/4-159                   .............................................iq--SNGRAYESLLEKVLSMNILS..S.DYFK-ELYGLKT................................YHEVIDEIYNQ..VNHVEP..............WMGG.NCR.............................................GP.STAYCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HTDSP..YIRAVGFL....Y...L.....RYVAD........................AKTL....WT.WYE.....PY..IKDDE.---------..............EFSPG...sNGRMTTMGVY--.---.......---YY...FD..T..LFPRIPVPVM-----rqiv.................................................................
N4VSA6_COLOR/24-191                  ............................................lap---NGENPATIMEKAVRERIIK..S.EYYLAQCFALNE................................-ADIVDRVVED..VTCVGG..............-TYG.VTQ.............................................KP.TTFLCLAFKL.LQLAPSDD..........VVQ.TYLAh.............................................gGDKFK..YLRALACF....Y...V.....RMTRR........................PKDV....YL.LLE.....PF..LEDRR.KLRKKGREQ..............-----....-TTLTYVDEFVD.DLL.......VKTRV...CA..T..SFRELPKRVDLVD--lg...................................................................
W9YRJ2_9EURO/20-185                  ..............................................l--VRGQNPALLFETPMRDRITD..S.LYWKEQCFGLNA................................-ATLCDRAIE-..LNYLGG..............-TYG.VAM.............................................KP.TPFICLAFKL.LTLVPDKE..........IIL.EYLNn.............................................gGEEWK..YLRALAAF....Y...V.....RLTFD........................PADV....YK.TLE.....PL..LEDLR.KLRLRRKET..............-----....-YELIHMDEFVD.NLL.......TKERV...CG..T..SLWKLPARQLLEDL-d....................................................................
W4ZDU0_STRPU/160-344                 ..............................................l-PLWGNQVSMNLNPLILTNIQS..S.PYFKNDLFKLKT................................YHEVIDEIYYK..VAHLEP..............WERG.SRQtsgqigmcg...........................gvrgvgaggIV.SSAYCLLYKL.YTLKLTRK..........QLN.GLLT...............................................HSDSS..YIRALGFL....Y...I.....RYSQP........................PQDL....WD.WYE.....EY..LNDEE.---------..............EVDTKa..gGGNCIPIGQMLM.HFL.......VKLEW...HS..S..LFPRIPVPVMKDI--er...................................................................
A0A0E0A4V7_9ORYZ/4-166               ........................................qssgrpi--------DVLMEKVLSVNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.SSAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAVGFL....Y...L.....RYVAE........................PKTL....WS.WYE.....PY..IKDDE.---------..............EFSPG...sNGKMTTMGVYVR.DLL.......LGQYY...FD..S..LLPRVPLPI------lrqvt................................................................
S3DD72_GLAL2/21-188                  ............................................lap---NGLNPATIMEKPVRERIID..S.YFWKDQCFAVNE................................-ADIVDRVVTH..VKFIGG..............-TYG.DAQ.............................................RP.SPFLCLAFKL.LQLGPGDD..........ILR.EYLEy.............................................gGEKFK..YLRALACF....Y...I.....RLTRQ........................AKDV....YL.FLE.....PY..LEDRR.KLKQKKRMG..............-----....-TALTYMDQFVD.DLL.......EKDRI...CA..T..TLWKMPKREVLEDL-e....................................................................
A9P852_POPTR/3-167                   .............................................vq--TNGKPIDSLFEKVLCMNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDNVEP..............WMTG.NCR.............................................GP.STSFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HKDSP..YIRAVGFL....Y...L.....RYAGD........................PKTL....WN.WFE.....PY..IKDDE.---------..............EFSPG...sSGRKTTIGIYVR.DLL.......LGQYY...FD..T..LFPRIPVPVLR----qita.................................................................
A0A0D3H3F8_9ORYZ/10-175              ...............................................KSIHGTNPQNLVEKIVRSKIYQ..S.TYWKEQCFGLTA................................-ETLVDKAME-..LDHTGG..............-TYG.GNR.............................................KP.TPFLCLALKM.LQIQPDKD..........IVV.EFIK...............................................NEDYK..YVRVLGAF....Y...L.....RLTAT........................VADV....YQ.YLE.....PL..YNDYR.KIRHKLSDG..............-----....KFTLIHVDEFID.DLL.......TKDYS...CD..T..ALPRIQKRWVLET--sg...................................................................
A0C3P9_PARTE/86-247                  ..............................................i-PIRGENAISNMNSLVRQNILT..C.PYYK-ELLQIRD................................INDIVTETDKI..VTSVGT..............WAG-.-PG.............................................VP.SSFFCILHKL.MSMNLNVK..........QLQ.ILCD...............................................WKLNP..YVRCLGLL....Y...L.....RYSLD........................PNFL....WG.WMK.....RY..ILDEQ.---------..............EFKPS....KDEDITIGDFCE.RLL.......TDLNY...YN..T..RLPRIPQQIDT----iiqa.................................................................
A0A024TF87_9STRA/1-98                ...............................................----------------------..-.------------................................-----------..------..............----.---.............................................--.-------MKF.CTMRLTIN..........QMQ.GLLK...............................................HVDSP..YIRCVGFL....Y...L.....RYTCD........................PELL....WE.WYE.....PY..LGDDE.---------..............EFNASs..nDAIRTTMGAWIR.SLL.......EDINY...FN..T..ILPRIPKKIQ-----dgik.................................................................
J3K8Q1_COCIM/21-209                  ..............................................l--VRGVNPATLFEKAVRDRITD..S.YYWKEQCFGLNA................................-ATLCDRAVE-..LGYIGG..............-TYG.ANQ.............................................KP.TPFLCLAFKL.LQLAPERE..........VVL.EYLNfhdpaeddddng......................dedggdgaavlksVGDFK..YLRALAAF....Y...I.....RLTFE........................PVEV....YN.VLE.....PL..LSDYR.KLKRRTKDG..............-----....-FVLTYMDQFVD.DLL.......NKDRV...CG..T..SLWKLPARRILEDL-d....................................................................
G0S1D3_CHATD/24-191                  ............................................lap---NGLNPATIMEKAVRERIVE..S.YFWKEQCFGVNE................................-ADIVDRVVEH..VRFVGG..............-VTG.VTQ.............................................KP.SPFLCLAFKL.LQLAPGDD..........ILK.EYLYf.............................................gGEKFK..YLRALAAF....Y...I.....RLTRP........................DKEV....YT.LLE.....PF..LEDRR.KLRRKGKNG..............-----....-TSLTYMDEFID.DLL.......TKDRV...CS..T..SLWKMRRRDILEDL-d....................................................................
H9JEJ8_BOMMO/23-207                  ..............................................l-PIWGNEQTMNLNPLILANIQG..S.SYFKVHLFKLKT................................YHEVVDEIYYQ..VKHLEP..............WERG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAFCLLYKL.YTLRLTRK..........QVN.GLLQ...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PADL....FD.WYV.....DY..FEDEE.---------..............EVDPRa..gGGASTTIGALVR.QML.......VKLDW...FS..T..LFPRIPVPIQKQIE-q....................................................................
J6E9Q7_SACK1/15-219                  ...............................................KQLNNQSVSLIIPRLTRDKIHN..S.MYYKVNLSNESLrg............................ntMLELLKVIIDA..LGTLRGqdg.......hlnmAVLG.GVE.............................................--.--FKCILMKL.VEIRPNLK..........QLA.FLLDvk..........................................nvkDFNSK..YIIALVLV....Y...A.....RLQYYylndq.............nknnsyENDL....IQ.LFKvq.lyKY..SQQFF.KLKSFPLQVdc..........faHSQNE....GLCIVHVDELVD.WLV.......TQDHI...WG..I..PLGKCQWSK------iydsee...............................................................
E3QPI7_COLGM/24-191                  ............................................lap---NGENPATIMEKAVRERIID..S.YFYKEQCFAVNE................................-ADIVDRVVEH..VSFIGG..............-TYG.VTQ.............................................KP.TPFLCLAFKL.LQLAPSDA..........VLE.TYLGf.............................................gGDKFK..YLRALACF....Y...I.....RMTRK........................PRDV....YL.LLE.....PF..LEDRR.KLRRKGRQG..............-----....-ASLTYMDDFVD.DLL.......TKTRV...CA..T..SFRELPKRSDLVD--ld...................................................................
R1EHA8_BOTPV/20-176                  .............................................al--IRGQNPALLFEKAVRDRIIE..S.YYWKEQCFGLNA................................-ATLCDRAAE-..LTFVGG..............-TYG.GLG.............................................KP.TPFLCLAFKL.LQLVPEKE..........IIL.AYLNwpedeeredg...........................esdeghapgvKGDFK..YLRALAAF....Y...I.....RLAWE........................PVDI....YK.TLE.....PL..LADYR.KLKRRMRDG..............-----....------------.---.......-----...--..-..---------------fvltplnll............................................................
G0VC19_NAUCC/15-211                  ...............................................KELNNQSVSLVIPRLTRDKIHN..V.LYYKVNLTSTSLrg............................ntMLQLSKIIIRD..LGQLKDsns........lknYLVG.GVE.............................................--.--FKCLLMKL.IEIRPTFD..........QIT.MLLEkkk........................................spddTFENK..YIVALILT....Y...L.....RIQYYylk..................lhdASHL....IN.LFR.....EY..INDYR.KLKGIDMDMdc..........wsMSQQL....KVEIIHIDELVD.RLA.......TNNNI...WG..I..PLGKCQWSNI-----feldd................................................................
A0A024W143_PLAFA/173-335             ............................................lem----TNTTTYNVNTLLRNNILS..S.EYFK-SLIPIKT................................FKEVVDEIHSY..ADHVEP..............YCIG.SNR.............................................AP.STLFCCLYKF.FTMQLSEK..........QLK.SLIE...............................................NKDSC..YIRACGFL....Y...L.....RYVHS........................PANL....WM.WFE.....PY..LLEED.---------..............EFSISc..dKRRKVTIGEYVQ.SLL.......SDDKY...FN..T..VLPRLPIKIK-----nvy..................................................................
W6UMV2_ECHGR/10-175                  ..............................................h-TLHGTNPQYLVEKIIRSRIYE..C.QFWKEHCFALTS................................-ELLVDKAVE-..LKYIGG..............-TYG.GLT.............................................KP.TPFICLVLKM.LQIQPDKD..........IVI.EFIK...............................................QEDYK..YARALGAF....Y...L.....RLVGE........................SVEI....YK.YLE.....AL..YNDFR.KLKQQDTTG..............-----....KFSIVRMDEFID.QLL.......NEERV...CD..V..ILPRLQKRSVLEDN-n....................................................................
Q0DKA8_ORYSJ/3-101                   ............................................iqt---SGKPIDLLMEKVLCMNIMS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAVS--....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------slp..................................................................
J9EVG5_WUCBA/10-175                  .............................................vt--VKGTNPQYLVEKIIRTRIYD..S.KYWKEECFALTA................................-ELLVDKGME-..LRYIGG..............-IYA.GNV.............................................KP.TPFLCLCLKM.LQIQPEKD..........IAV.EFIR...............................................QEEYK..YIRALGAM....Y...I.....RLTFT........................SIEV....YK.YLE.....PL..YNDYR.KLRIMNNEG..............-----....RFEIVHMDEFID.NLL.......RDERY...CD..I..HLPRIQKRITLEE--vg...................................................................
A0A096LYD0_POEFO/28-178              ..............................................l-PLWGNEKTMNLNPMILTNVLS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHIEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....LD.WYN.....DF..LDDEE.---------..............-----....------------.---.......-----...--..-..---------------mplvqqvnwil..........................................................
V4ZI95_TOXGO/10-175                  ..............................................q-QVHGCNPQTLVSRIIRRKIYE..S.AFWKEQCFALTA................................-ETVLEPCVG-..LTYVGG..............-TYG.GKR.............................................QP.APFLCLVLKL.LQIQPEPE..........IIL.EFIK...............................................QEQFK..YLRAVGAF....Y...L.....RLVGR........................ACEV....YT.HLE.....PL..LADYR.KLRLRLADG..............-----....KFTIVCMDEFVD.DCL.......RKTNF...LD..V..DLPVLPKREVLES--eg...................................................................
A0A044STF6_ONCVO/47-231              ..............................................l-PLWGNTQTMNLNALVLENIIQ..C.TYYKNYLSETTG................................FQQLTEEIYYS..VKHLEP..............WERG.TRKtqgmtgmcg...........................gvrgvgaggVV.STAFCLLYKL.FTIRLSRK..........QLV.SMIN...............................................NSNSP..YIRGIGFM....Y...I.....RFCQP........................PQDL....WA.WME.....PY..LDDEE.---------..............QIDPRs..gGGDVMAMAQVVK.MML.......TKLDW...YG..T..LFPRIPVPIQKEI--el...................................................................
A0A0L0CFU8_LUCCU/10-175              ...............................................KNIHGTNPQYLIEKIIRSRIYD..S.KYWKEQCFALTA................................-ELLVDKAME-..LRYIGG..............-VYG.GNI.............................................KP.TQFLCLTLKM.LQIQPEKD..........IVV.EFIK...............................................NEEFK..YVRALGAF....Y...L.....RLTGS........................ALDC....YK.YLE.....PL..YIDNR.KLRRQNRVG..............-----....QYEIVYMDEFID.ELL.......RSDRV...CD..I..ILPRIQKRSVLEEN-n....................................................................
M0W6M8_HORVD/1-69                    ...............................................----------------------..-.------------................................-----------..------..............----.---.............................................--.----------.--------..........---.----...............................................-----..--------....-...L.....RLTGT........................VADV....YQ.YLE.....PL..YNDYR.KIRQKLSDG..............-----....KFTLTHVDEFID.ELL.......TKDYS...CD..T..ALPRIQKRWVLEA--sg...................................................................
PR38A_PONAB/10-175                   ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
G0NBD0_CAEBE/55-239                  ..............................................l-PIWGNQVTMNLNTLVLENIRE..S.YYYKNNLVEIDS................................FQTLVEQIFYQ..VKHLEP..............WEKG.TRRlqgmtgmcg...........................gvrgvgaggVV.SSAYCLLFRL.FNLRISRK..........QLI.SMLN...............................................SRQSV..YIRGIGFM....Y...I.....RYTQP........................PADL....WY.WLE.....PY..LDDDS.---------..............EIDPRs..gGGDLMSFGQMVR.TMI.......NKLDW...YG..T..LFPRIPVPIQKEID-e....................................................................
PR38B_DANRE/25-209                   ..............................................l-PLWGNEKTMNLNPMILTNVLS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VNHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HSDSP..DIRALGFM....Y...I.....RYTQP........................PPDL....VD.WYD.....EF..LDDEE.---------..............ELDVKa..gGGCVMTVGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKAI--dq...................................................................
A0A085NTX6_9BILA/422-604             .............................................la--FWGNKQTMNLNHLVYENIMI..S.PYYKNTLSQVVT................................YHEVLDEIYYN..VDHLEP..............WERG.TRKttgqtgmcg...........................gvrgvgaggVV.SSAFCILYKL.FTLKLTRK..........QLI.SMLN...............................................HSDSC..YIRGLGFM....Y...V.....RYCLH........................PNSF....WY.WFE.....PY..LDDEE.---------..............EIDPKa..gGGEVMTIGDMIR.QML.......NKLEW...YT..T..LFPRIPVPIQV----rr...................................................................
Q6C616_YARLI/15-178                  ..............................................l-SIHGINPALLIEKIIRERIFE..T.LYWKELCFNLNA................................-ATLCDRAAT-..LTAIGG..............-QY-.ANQ.............................................KP.TPFLCLVFKL.LQIQPSHD..........IIM.EYLN...............................................QKEFK..YLRAVAAF....Y...I.....RLAYP........................PVKI....YT.LLE.....PL..LGDYR.KLRFRNMGG..............-----....-VTLTYMDQFID.DLL.......HEERV...CD..I..ALPRLPKRLTLEDA-e....................................................................
H2ZEL3_CIOSA/29-213                  .............................................lt--CWGNPRTMNLNHLVLTNVQN..S.PYFKVRLFELKT................................YHEVVDEIYYK..VDHLEP..............WERG.TRKtagqtgmcg...........................gvrgvgaggVV.STSFCILFKL.FTLKLTRK..........QVN.GLLN...............................................HTDSP..FIRGLGVM....Y...I.....RYTQA........................PKDL....WN.WYE.....PY..LEDEE.---------..............EIDVKa..gGGCVMTIGMMIR.TVL.......TKLDW...FS..T..LFPRIPVPIQKEID-e....................................................................
U6L8R2_EIMTE/10-173                  .............................................va--VHGKNPQLLFSRIVRRKVYE..S.FFWKEECFAATA................................-ATVAELAAA-..LQYVGG..............-TFG.GIR.............................................AA.SPFLCLVLKL.LQLQPEKE..........IIL.EFIK...............................................QEDFK..YLRAVAAF....Y...L.....RLVGP........................SAEV....YV.HLE.....PL..LADYR.KLRLRLRDG..............-----....SFRVSFMDEFVD.QCL.......RNNSL...FD..V..DFPPLVKR-------pvfvl................................................................
A0A0B1P5C4_UNCNE/21-188              ............................................lap---NGLNPATIMEKPVRERIVD..C.YFWKDQCFAVNE................................-ADVVNRVVQS..VNFIGG..............-TYG.DSQ.............................................RP.SPFLCLAFKL.LQLSPSDE..........ILQ.EYLQy.............................................gGEKFK..YLRALALF....Y...I.....RLTRQ........................PKNI....YE.ILE.....PY..LSDYR.KLRKRSRIG..............-----....-TSLTYMDVFVD.DLL.......TKDRV...CG..T..TLWKIPKRTVLEDL-e....................................................................
Q5KIE6_CRYNJ/9-172                   ..............................................t-AVHGSNPQYLIEKVIRARIYD..S.LYWKEHCFALTA................................-ESIIDKAID-..LRAIGG..............--VT.DRQ.............................................TP.TPFICLVLKL.LQLQPEKE..........ILI.EYLL...............................................AEEFK..YLRALAAF....Y...V.....RLTFR........................SLEV....YE.ILE.....PL..MKDYR.KLRVVHAGG..............-----....-YSLTHFDEFID.ELL.......TQERV...CD..I..ILPRLTQRSVLEET-e....................................................................
M4C7M0_BRARP/10-175                  ...............................................KNIRGTNPQNLVEKIVRTKIYN..H.TFWKEQCFGLTA................................-ETLVDKAME-..LDHVGG..............-TFG.GNR.............................................KP.TPFLCLILKM.LQIQPEKE..........IVV.EFIK...............................................NDDYK..YVRILGAF....Y...L.....RLTGS........................DVDV....YR.YLE.....PL..YNDYR.KVRQKLSDG..............-----....RFSLTHVDEVIE.ELL.......TKDYS...CD..I..AMPRLKKRWTLEQN-g....................................................................
A0A0N4VL93_ENTVE/10-174              ..............................................a-TVKGTNPQYLVEKIIRTRIYD..S.KYWKEECFALTA................................-ELLVDKGME-..LRYVGG..............-IYA.GNV.............................................KP.TPFLCLCLKM.LQIQPEKD..........IIV.EFLR...............................................QEEYK..YIRALAAM....Y...L.....RLTFS........................SIEV....YK.YLE.....PL..YNDYR.KLRYMDKNG..............-----....HFQLIHMDEFID.HLL.......RDERY...CD..I..QLPRLQRREALE---si...................................................................
M7YZV4_TRIUA/3-103                   ...........................................lqts----GRPIEVLMEKVLSMNIVS..S.DYFK-ELYKIKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKL.FTMKLTVN..........QMH.GLLK...............................................HPDSP..YIRAVTLM....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------eys..................................................................
B8B2Q7_ORYSI/4-173                   ........................................qssgrpi--------DVLMEKVLSVNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.SSAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAVGFL....Y...L.....RYVAE........................PKTL....WS.WYE.....PY..IKDDE.---------..............EFSPG...sNGKMTTMGVYVR.DLLlgqvhseQKRYY...FD..S..LLPRVPLPI------lrqvt................................................................
A0A094HRU1_9PEZI/22-189              ............................................lap---NGLNPATIFEKPVRERIID..C.YFWKDQCFALNE................................-ADIVSRVVEH..VHFVAG..............-TYG.DSQ.............................................RP.SPFLCLAFKL.LQLGPGDD..........ILK.EYLGy.............................................gGERFK..YLRALACF....Y...V.....RLTRP........................AKQV....YE.TLE.....PY..LEDGR.KLRRRGRQG..............-----....-TSLTFVDQFVD.ELL.......TKERI...CA..T..SLWKMPKREQLEDM-e....................................................................
E1GES1_LOALO/47-231                  ..............................................l-PLWGNTQTMNLNALVLENIIQ..C.TYYKNYLSETTG................................FQQLTEEIYYS..VKHLEP..............WERG.TRKtqgmtgmcg...........................gvrgvgaggVV.STAFCLLYKL.FTIRLSRK..........QLV.SMIN...............................................NSDSP..YIRGIGFM....Y...I.....RFCQP........................PQDL....WA.WME.....PY..LDDEE.---------..............QIDPRs..gGGDVMAMAQVVK.MML.......TKLDW...YG..T..LFPRIPVPIQKEI--el...................................................................
A0A0C2MT08_THEKT/43-227              ..............................................m-KTWGNEKTMNINSLLLSNIQS..S.LYFKGELAQLAC................................IEELIDQIYYK..VTHLEP..............WEKG.TRKtsgqfgmcg...........................gvrgvgaggVV.SSAYCILYKI.FLIKPTKS..........QIK.LMLN...............................................HRDSP..YIRGVGFM....F...I.....RYCAP........................PETL....WK.WFQ.....RY..LDDQE.---------..............EIDPRa..nGGRPMTIGTMIR.NML.......TELDW...YG..T..LFPRIPLQIQKQI--ds...................................................................
R1EST0_EMIHU/1-175                   ...............................................---------MNLNSMLIENIRS..H.DYFK-GLGELST................................FEEVVDQIYYD..CTYITP..............WRPG.THKaqraagmcs...........................glrgvsnagVP.STAYMLLFKL.YTLQLTRN..........QIL.RLVT...............................................HKDSP..YIRAIGLL....Y...L.....RYVCE........................PKEL....WG.WYE.....PY..VSDPE.-MWSQLG--..............----E....GGERSTLGSFVR.RLC.......TELEW...YD..T..MLPRLPVPVARDI--ek...................................................................
A0A060SR90_PYCCI/10-173              ..............................................v-AIHGQNPQYLVESVIRNRIYE..S.SYWKEHCFALTA................................-ETLIDKAIE-..LKAIGG..............-VYG.N-Q.............................................KP.TEFLCLLLKL.LQIQPEKE..........ILL.EYLQ...............................................ADEFK..YLRALAAM....Y...I.....RMTFR........................PAEV....YE.ILE.....PL..LKDYR.KLRHRGMNG..............-----....-YSIIHMDEFVD.SLL.......VEERV...CD..L..ILPRITKRDVLED--lg...................................................................
B3MXQ1_DROAN/35-219                  ..............................................l-PFWGNETSMNLNPLILANIQS..S.SYFKVHLFKLKT................................YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.YTLRLTRK..........QIN.GLLN...............................................HTDSA..YIRALGFM....Y...L.....RYTQP........................PGDL....YD.WYE.....DY..LQDEE.---------..............EIDVKa..gGGQVLTIGQMVY.QFM.......TKLDW...FS..T..LFPRIPVPIQKQIE-k....................................................................
A0A0J7L2G9_LASNI/10-175              ...............................................KSIRGTNPQYLVEKIIRSRIYD..S.KYWKEECFALTA................................-ELLVDKAME-..LRFLGG..............-VYG.GNV.............................................KP.TPFLCLILKM.LQIQPEKD..........IIV.EFIK...............................................NEEFK..YVRALGAL....Y...M.....RLTGS........................SLDC....YK.YLE.....PL..FNDNR.KLRIQNKQG..............-----....VFELVHMDEFID.NLL.......RDERS...CD..V..ILPRIQKRYVLEEN-n....................................................................
A0A0D1CL78_USTMA/10-174              ..............................................v-SIHGTNPQFLIEKPVRARIYE..S.PFWKEHCFALSA................................-ATILPLAVS-..LNHIGG..............-LVG.L-Q.............................................RP.SHFLCLLQKL.LQIQPEPA..........IIN.AYLE...............................................AREFK..YLGALTAF....Y...I.....RLTYT........................SKHV....YT.LLE.....PM..LEDGR.KLRWRSGDG..............-----....AYEILHMDEWVD.MLL.......REERV...CD..I..ILPRLTRRDVCET--rd...................................................................
W4KIC8_9HOMO/10-173                  ..............................................q-AIHGQNPQFLVETVIRNRIYE..S.SFWKEHCFALTA................................-ETLIDKSLE-..LRCIGG..............-VYG.NQR.............................................-P.TEFLCLLLKL.LQIQPEKE..........ILL.EYLQ...............................................ADEFK..YLRALTAI....Y...I.....RMTFG........................ASDV....YE.LLE.....PL..LKDFR.KLRYRNTTG..............-----....-NNITFIDDFVD.QLL.......NDERV...CD..I..ILPRIPKRQMLEE--ag...................................................................
A0A087STH6_AUXPR/10-175              ...............................................KSVHGTNPQNMVEYIIRQKIYD..S.VYWKAECFGLTA................................-ELLVDKGTV-..LRYAGG..............-MYG.EPQ.............................................RP.SEFLCLILKM.LQIQPDKD..........IIV.EFIK...............................................DDAFK..YLRLLGAF....Y...M.....RLVGR........................PVDV....YQ.YLE.....PL..YNDFR.KVRVRESKG..............-----....AFALSYVDQVVD.DML.......TRDYC...FD..I..ALPRLPARKVLEE--ag...................................................................
A0A0N5DGF6_TRIMR/10-175              ..............................................s-TVKGTNPQYLIEKVVRSRIYD..S.RYWKEECFALSA................................-ELLVDKGME-..LRFVGG..............-VFG.GNV.............................................KP.SPFLCLQLKM.LQIQPDKD..........IVI.EFIR...............................................QEDSK..YIRALGAM....Y...L.....RLTFT........................SVEI....YQ.YLE.....PL..LNDYR.KLRWMNKQG..............-----....KFELMHMDEFVD.RLL.......REERF...CD..I..QLPRLQKRDVLEE--tg...................................................................
H2S676_TAKRU/10-175                  ..............................................n-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LKFVGG..............-VYG.GNI.............................................KP.TPFICLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRLLGAM....Y...M.....RLTGT........................AVDC....YK.YLE.....PL..YNDYR.KVKTQNRNG..............-----....EFELMHVDEFID.ELL.......HSERM...CD..I..ILPRLQKRHVLEET-e....................................................................
A0A059B3E7_EUCGR/58-223              ...............................................KSIRGTNPQNLIEKIVRSKIYQ..N.TYWKEQCFGLTA................................-ETLVDKAME-..LDHIGG..............-TFG.GNR.............................................KP.TPFLCLVLKM.LQIQPEKD..........IVV.EFIK...............................................NEDYK..YVRVLGAF....Y...L.....RLTGI........................DMDV....YR.YLE.....PL..YNDYR.KVRQKLTGG..............-----....NFALTHVDEIID.ELL.......TKDYS...CD..I..AMPRIKKRWTLES--ag...................................................................
G1NFA1_MELGA/10-175                  ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LKYVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HEERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
F4WXJ8_ACREC/37-220                  ..............................................l-PLWGNERTMNLNPLILTNIQS..S.HYFKVNLYELKT................................YHEVIDEIYYK..VSHLEP..............WEKG.SRKtagqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.FTLRLTRK..........QLN.GLIN...............................................HPDSP..YIRALGFM....Y...I.....RYTQP........................PADL....FS.WYN.....DY..LEDEE.---------..............ELDVKa..gGGQVMKMGDILK.QFL.......TKLEW...FS..T..LFPRIPVPIQKD---le...................................................................
A7F153_SCLS1/21-188                  ............................................lap---NGLNPTTILEKPVRERIVD..C.YFWKDQCFALNE................................-ADIVSRVVSH..VTFIAG..............-TYG.DSQ.............................................RP.SPFLCLAFKL.LQLGPSDE..........ILQ.EYMGy.............................................gGEKFK..YLRALALF....Y...W.....RMTRQ........................AKDV....FM.VLE.....GY..LDDRR.KLRRKTRTG..............-----....-TTLTFMDQFVD.DLL.......TKDRV...CG..T..TLWKMPKREILEDL-e....................................................................
M2T688_COCH5/23-228                  .............................................al--IRGQNPALLFEKGVRERITE..S.YYWKEQCFGLNA................................-ATLCDRAAE-..LKFIGG..............-TTG.ITG.............................................KP.TPFLCLAFKM.LQLVPDKE..........IVL.EYLNfrdddddeedkaevkkengd......aaaddadqsankeldlnaagkLGCFK..YLRCLAAF....Y...I.....RLAWE........................PVEI....YK.TLE.....PL..LTDYR.KIKRRLKDT..............-----....-FTLTHVDQFID.DLL.......TKERI...CA..T..SLWKLPSRAILEDL-d....................................................................
G3R6P3_GORGO/47-231                  ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
L8X0R2_THACA/10-163                  ..............................................i-HIHGQNPQFLVEKVIRTRIWE..S.AYWKEQCFALTG...............................rPESLIDKAIE-..LNSIGG..............-VYG.NQR.............................................-P.TDFISLLLKL.LQIQPEKE..........ILI.EYLM...............................................VDEFK..YLRALAAM....Y...I.....RMTFP........................PVEV....YE.LLE.....PL..LKDYR.KLRLRNMDQ..............-----....------------.-LL.......TEERV...CD..I..ILPRLAKREVLEET-e....................................................................
A0A067P368_PLEOS/10-173              ..............................................k-AIHGQNPQFLVENVIRNRIYE..S.SYWKEYCFALTA................................-ETLIDKAIE-..IKFIGG..............-VYG.NQR.............................................-P.TEFLCLLLKL.LQIQPEKE..........ILI.EYLQ...............................................AEEFK..YLRALAAL....Y...V.....RMTFS........................AVDV....YE.ILE.....PL..LKDYR.KLRNRNMAG..............-----....-YSLTFMDEFVY.SLL.......TEERV...CD..I..ILPRLQKRSVLEER-g....................................................................
K3W962_PYTUL/10-174                  ..............................................q-SIHGVNPQHLIEKIMRNRIYA..S.VYWKEQCFGLTS................................-ETLVDKAIE-..LNYFGG..............-TFG.GNQ.............................................QP.TPFLCLLLKM.LQLQPELE..........VVR.EFIQ...............................................NEEYK..YVSVLGAV....Y...L.....RLVGK........................PLEI....YS.ILE.....PM..YSDYR.KIRKRNVIG..............-----....-WEITHIDEIVD.ALL.......FEEYY...ID..L..ALPRMVDREF-----yekng................................................................
M3Y690_MUSPF/10-175                  ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
B7QBZ1_IXOSC/10-175                  ..............................................h-SVRGTNPQYLIEKIIRSRIYD..S.RYWKEECFALTA................................-ELLVDKAME-..LKFIGG..............-VYG.GNV.............................................KP.TPFLCLLLKM.LQIQPEKD..........IVV.EFIR...............................................QEDFK..YVRALGAN....Y...M.....RLVGS........................SLDC....YK.YLE.....PL..YNDYR.KLRRQNRDG..............-----....TFAIVHMDELID.ELL.......REERA...AD..V..ILPRIQKRHVLEET-n....................................................................
A0A087SCL4_AUXPR/45-210              ............................................eqy----GNTSTYNLENVLRQNILT..S.TYYQKTAVPIEQ................................WQDLVDEIYYS..VDHVEP..............WMSG.NAR.............................................GP.STAFNLLYRL.GQLKPTPK..........ELR.MMLD...............................................HKDSP..YIRAVGFL....Y...L.....RYTCN........................PRYL....WE.WVK.....DY..LEDAE.---------..............EFTPSp.pgWGHSVTMGCFLR.DIL.......LDQYY...FE..T..IFPRIPTKVTD----evl..................................................................
A0A0E0LY62_ORYPU/10-175              ...............................................KSIHGTNPQNLVEKIVRSKIYQ..S.TYWKEQCFGLTA................................-ETLVDKAME-..LDHTGG..............-TYG.GNR.............................................KP.TPFLCLALKM.LQIQPDKD..........IVV.EFIK...............................................NEDYK..YVRVLGAF....Y...L.....RLTAA........................VADV....YQ.YLE.....PL..YNDYR.KIRHKLSDG..............-----....KFTLTHVDEFID.DLL.......TKDYS...CD..T..ALPRIQKRWVLEA--sg...................................................................
A2G7A6_TRIVA/40-204                  .............................................ky--VRGVAPQHLIDTSTRHRIYN..S.VYWQQHCFGVNL................................-LTLVDRAQS-..LKGVGG..............-VYG.LFR.............................................EP.CNFICLFLKL.LELEPSKK..........VIE.GFLNt.............................................kSWQMK..HLRLLAAL....Y...V.....RFVFP........................AEEV....YL.ILE.....GL..LGQYF.KVAVLREEG..............-----....-FKVEYFDTVIY.SFL.......HDKFW...CG..I..TFPPLTPRNNL----pp...................................................................
K4B140_SOLLC/10-175                  ...............................................KSIRGTNPQNLVEKILRSKIYQ..N.TYWKEQCFGLTA................................-ETLVDKAME-..LDHLGG..............-TFG.GNR.............................................KP.SPFICLVMKM.LQIQPEKD..........IVV.EFIK...............................................NEDYK..YVRVLGAF....Y...L.....RLTGT........................DIDI....YR.YLE.....PL..YNDYR.KLRRKSADG..............-----....QYALTHVDEYID.ELL.......TTDYS...CD..I..ALPRIKKRWILEQN-k....................................................................
A0A0K9PM83_ZOSMR/3-167               ............................................vqt---TGRSIDSVLERVLSMNILS..S.DYFK-EIHQLKT................................YHEVVDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKL.FTLKLTVK..........QMH.GLLK...............................................HRDSP..YIRAVGFL....Y...L.....RCVAE........................PKTL....WG.WCE.....HY..VKDDE.---------..............EFSPG...sNGRVSTMGVYVR.DLL.......LGQYY...FD..T..LFPRIPLPIVR----qivn.................................................................
T1I5E1_RHOPR/4-188                   ..............................................l-PLWGNERTMNLNPLILTNIQS..S.HYFKVNLYELKT................................YHEVIDEIYYK..VAHLEP..............WEKG.SRKtagqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.FTLKLTRK..........QLN.GLIT...............................................HPDSP..YIRALGFM....Y...I.....RYTQP........................PPDL....WD.WYD.....EY..LDDNE.---------..............ELDVKa..gGGQIMTIGNILK.NFL.......CKLEW...FS..T..LFPRIPVPIQQKIE-k....................................................................
A0A0B2X748_9HYPO/24-191              ............................................lap---NGLNPATIMEKAVKDRIVE..S.YFYMEQCFALNE................................-ADIIDRVVEH..VRFVGG..............-THG.DAQ.............................................KP.SPFLCLAFKL.LELAPSEA..........ILR.EYLSy.............................................gGEHFK..YLRALACF....Y...Y.....RLTRR........................AADV....HR.TLE.....PF..LADRR.KLRRKGRRG..............-----....-TTLTYVDEFVD.ELL.......TGERV...CA..T..SLWKMPGRDVLEDL-d....................................................................
E9QD55_DANRE/25-170                  ..............................................l-PLWGNEKTMNLNPMILTNVLS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VNHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HSDSP..YIRALGFM....Y...I.....RYTQP........................PPDL....VD.WYD.....EF..LDDEE.V--------..............-----....------------.---.......-----...--..-..---------------crhgs................................................................
A0A084W1A0_ANOSI/53-237              ..............................................l-PLWGNESSMNLNPLILANIQG..S.SYFKVSLFKLKT................................YHEVVDEIYYQ..VKHLEP..............WERG.SRKtagqtgmcg...........................gvrgvgaggIV.STAFCLLYKL.YTLRLTRK..........QVN.GLLT...............................................HGDSP..YIRALGFM....Y...L.....RYTQP........................PGDL....FD.WYE.....PY..LLDEE.---------..............VIDVKa..gGGQVLTIGHMIR.QWL.......TKLDW...FS..T..LFPRIPVPIQKQI--da...................................................................
Q8RUP2_ORYSJ/23-76                   ...........................................kkvv---------------LSVNILS..S.DYFK-ELYRLKT................................YHEVINVIYNQ..VDHVEQ..............WMTG.Q--.............................................--.----------.--------..........---.----...............................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------llwplqrll............................................................
A0A061J015_TRYRA/27-195              .............................................wn--LKGRSAVAALDPTTRHRILQ..S.HAMT-SCVHKPL................................-LATIEALIT-..LRCVGG..............-LSG.PLR.............................................RP.EPFICHVTRL.LQITPDPS..........VVL.AMLH...............................................QDVHK..YLRVAALF....V...I.....RLIGN........................DAMM....RE.AMR.....VG..WDDYR.KIRVYGYMEdwggttcakdsaapE----....------------.---.......-----...--..-..---------------eeeegfvpspsygimcvdqitdrlfnv..........................................
G3UEL4_LOXAF/10-175                  ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
W9RQ05_9ROSA/3-101                   .......................................iqtcgkpi--------DSLLEKVLCMNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HTDSP..YIRASLF-....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------lg...................................................................
F4K753_ARATH/1-113                   .............................................mg----------------------..-.------------................................-----------..------..............---G.NCR.............................................GP.STAYCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HTDSP..YIRAVGFL....Y...L.....RYVAD........................AKTL....WT.WYE.....PY..IKDDE.---------..............EFSPG...sNGRMTTMGVYVR.DLL.......LGLYY...FD..T..LFPRIPVPVMRQ---ivs..................................................................
A5K4Y5_PLAVS/10-175                  .............................................ik--IFGSNPQYLISNIIRSKIYE..S.PYWKEKCFALTS................................-ESIIDQAVN-..LKYVGG..............-TYG.GNR.............................................KP.TRFLCLVLKL.LQIQPDKD..........IIY.EYIK...............................................NEEFI..YLRALGIF....Y...L.....RLIGK........................SLEI....YQ.HLE.....PI..LFDYR.KMRIRLQNG..............-----....TFEKMYMDVFVD.NCL.......VMNNF...LD..V..DFPSLTKRQVLEDND.....................................................................
M8A466_TRIUA/3-166                   ............................................iqt---SGKPIDMLMEKVLCMNILS..S.DYFK-ELYRMKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKIL....WT.WYE.....PY..LKDDE.---------..............EFSPG...sNGRMTTMGVYVR.DLI.......LGQYY...FD..S..ILPRVPVPVV-----rqvt.................................................................
A0A0E9NPH2_9ASCO/27-194              .............................................ln--YHGINPALLIEKIIRERILD..S.LYYKDACFALTS................................-STILDRIVA-..LTYIGG..............-QYG.AQ-.............................................KP.TEFLCLVFKL.LQLQPEKE..........IVV.EMLKsd...........................................dgGEEWK..YLRAVAAF....Y...V.....RLTFP........................AREV....YE.LLE.....PF..YADYR.KLRVRHLGG..............-----....-WSLTTMDQFVD.ELL.......REERV...CD..I..ALPRIPTRMMLEE--ag...................................................................
A0A0D9ZUW6_9ORYZ/3-166               ............................................iqt---SGKPIDLLMEKVLCMNIMS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKIL....WT.WYE.....PY..LKDDE.---------..............EFSPG...sNGRMTTMGVYVR.DLI.......LGQYY...FD..S..LLPRVPLPV------irqvt................................................................
A0A061GA69_THECC/5-76                ............................................hig----------------------..-.------------................................-----------..------..............----.---.............................................--.----------.--------..........---.----...............................................-----..--------....-...L.....RLTGT........................DIDV....YR.YLE.....PL..YNDYR.KLRQKSPDG..............-----....NFSLTHVDEVID.ELL.......TRDYS...CD..I..ALPRIKKRWTLES--lg...................................................................
V5EEC2_PSEBG/10-174                  ..............................................h-SIHGTNPQFLIEKPVRARIYE..S.PYWKEHCFALSA................................-STILPLAVN-..LHHIGG..............-LVG.L-Q.............................................RP.SHFLCLLQKL.LQIQPEAE..........IIQ.AYLE...............................................AKEFK..YLRALTAF....Y...V.....RLTYK........................STDV....YT.LLE.....PI..LEDGR.KLRWRGSGG..............-----....EFEIVHMDEWVD.MLL.......REERV...CD..I..ILPRLTKRDVCET--rd...................................................................
A0A0E0PTE3_ORYRU/4-158               ........................................qssgrpi--------DVLMEKVLSVNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.SSAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAVGFL....Y...L.....RYVAE........................PKTL....WS.WYE.....PY..IKDDE.---------..............EFSPG...sNGKMTTMGVYVR.DLL.......L----...--..-..---------------gqcplvtqaplwa........................................................
A0A0B2V767_TOXCA/180-345             .............................................vt--VKGTNPQYLVEKIIRTRIYD..S.KYWKEECFALTA................................-ELVVDKGME-..LRYVGG..............-IYA.GNV.............................................KP.TPFLCLSLKL.LQIQPEKD..........IIV.EFIR...............................................QEDYK..YIRALGAM....Y...L.....RLTFS........................SIEV....YK.YLE.....PL..YNDYR.KLRYMNKEG..............-----....RFELIYMDEFID.NLL.......RQERY...CD..I..QLPRLQSRQALEE--ig...................................................................
N1JK20_BLUG1/21-188                  ............................................lap---NGLNPATIMEKPVRERIVD..C.YFWKDQCFALNE................................-ADIINRVVDH..VHFICG..............-TYG.DAQ.............................................RP.SPFLCLAFKL.LQLAPSDE..........IIQ.EYLGy.............................................gGEKFK..YLRALAVF....Y...V.....RLTRQ........................AKDI....YT.ILE.....PY..LADYR.KLKKRGRTA..............-----....-TSLTYMDVFVD.DLL.......VKDRI...CG..T..TLWKIPKRTILEDL-d....................................................................
S9XEH7_SCHCR/14-177                  .............................................dv--VHQMLPTFLVGKILRERIVE..S.FYWKEQCFGLNA................................-ASLIDRAVR-..LEYIGG..............-QFG.NQ-.............................................RP.TEFICLLYKL.LQVAPEKE..........IVL.EYLS...............................................IPEFK..YIRALAAF....Y...I.....RLTWP........................DPDV....YQ.ALE.....PL..LNDYR.KLRVRDHNG..............-----....-FYVSHMDEFID.DLL.......NEETV...CD..V..TLPPLMSRYQLEEL-d....................................................................
W4ZVL3_WHEAT/3-166                   ............................................iqt---SGKPIDMLMEKVLCMNILS..S.DYFK-ELYRMKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKIL....WT.WYE.....PY..LKDDE.---------..............EFSPG...sNGRMTTMGVYVR.DLI.......LGQYY...FD..S..ILPRVPVPVV-----rqvt.................................................................
E7KNP5_YEASL/15-219                  ...............................................KQLNNQSVSLVIPRLTRDKIHN..S.MYYKVNLSNESLrg............................ntMVELLKVMIGA..FGTIKGqng.......hlhmMVLG.GIE.............................................--.--FKCILMKL.IEIRPNFQ..........QLN.FLLNvk..........................................nenGFDSK..YIIALLLV....Y...A.....RLQYYylngn.............nkndddENDL....IK.LFKvq.lyKY..SQHYF.KLKSFPLQVdc..........faHSYNE....ELCIIHIDELVD.WLA.......TQDHI...WG..I..PLGKCQWNK------iynsde...............................................................
E9IDC1_SOLIN/82-265                  ..............................................l-PLWGNERTMNLNPLILTNIQS..S.HYFKVNLYELKT................................YHEVIDEIYYK..VSHLEP..............WEKG.SRKtagqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.FTLRLTRK..........QLN.GLIN...............................................HPDSP..YIRALGFM....Y...I.....RYTQP........................PADL....FS.WYS.....DY..LEDEE.---------..............ELDVKa..gGGQTMKMGDILK.QFL.......TKLEW...FS..T..LFPRIPVPIQKD---le...................................................................
A0A0N0P7I3_LEPSE/4-150               .............................................sl---KGRAPIAAFDPPTRHRILN..S.HIMT-RCTNKPL................................-LWVLEELCN-..LRSLGG..............-LTG.PLH.............................................SV.DYFICLVARL.LQICPAPA..........VVR.VMLE...............................................QEVHK..YMRAAALV....L...I.....RLIGS........................VDFQ....KE.ALR.....IG..WDDYR.KLCLYGKAP..............-----....------------.---.......-----...--..-..---------------aqewkestadaaaptataegh................................................
W7A7D1_9APIC/10-175                  .............................................ik--IFGSNPQYLISNIIRSKIYE..S.PYWKEKCFALTS................................-ESIIDQAVN-..LKYVGG..............-TYG.GNR.............................................KP.TRFLCLVLKL.LQIQPDKD..........IIF.EYIK...............................................NEEFI..YLRALGIF....Y...L.....RLIGK........................SLEI....YR.HLE.....PI..LYDYR.KMRIRLQNG..............-----....TFEKIYMDQFVD.NCL.......IMNNF...LD..V..DFPSLTKRQVLEDN-n....................................................................
A0A010R8A1_9PEZI/24-191              ............................................lap---NGENPATIMEKAVRERIID..S.YFYKEQCFAVNE................................-ADIVDRVVEH..VTFIGG..............-TSG.VTQ.............................................KP.TPFLCLAFKL.LQLAPSDE..........VLE.TYLGf.............................................gGDKFK..YLRALACF....Y...V.....RMTRK........................AKDV....YL.LLE.....PF..LEDRR.KLRRKGRAG..............-----....-TSLTFMDDFVD.DLL.......TKTRV...CA..T..SFRELPKRVDLVD--lg...................................................................
G0N8A9_CAEBE/10-175                  ..............................................k-TVKGTNPQFLVEKIIRQRIYD..S.MYWKEHCFALTA................................-ELVVDKGMD-..LRYIGG..............-IYA.GNI.............................................KP.TPFLCLALKM.LQIQPDKD..........IVL.EFIQ...............................................QEEFK..YIRALGAM....Y...L.....RLTFD........................STEI....YK.YLE.....PL..YNDFR.KLRYMNKMG..............-----....RFEAIYMDEFID.NLL.......REDRY...CD..I..QLPRLQKRWALEE--vd...................................................................
A0A0N0DS04_9TRYP/4-156               ..........................................nlkgr------AAIAAFDPPTRYRILN..S.HTMT-RCTNKPL................................-LWVLEELCN-..LRSLGG..............-LAG.PLH.............................................AA.DHFICLVARL.LQICPAPA..........IVR.VMLE...............................................QEVHK..YMRAAALV....L...I.....RLIGS........................ASFQ....KE.ALR.....IG..WDDYR.KLCLYGSDP..............-----....------------.---.......-----...--..-..---------------aqewaestttadadtatghantlsssl..........................................
A0A0K0FA69_9BILA/6-171               ..............................................k-TIRGTRSTFLIEKIIRTRINE..S.LYWKEECFGLSA................................-ETVIDKGAE-..LRYVGG..............-IYA.GNT.............................................RP.TPFLCLTLKL.LELAPEKD..........III.EYIQ...............................................QEEFK..YIRALGAM....Y...I.....RLTFP........................SVDV....YR.YLE.....PI..YNDYR.KLRYMNRMG..............-----....RFELMYMDQFID.RLL.......NEELF...CD..V..HLPKLQGRQLLEQN-d....................................................................
F7CZ30_MACMU/10-176                  ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTV................................FINVIDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A067MDA3_9HOMO/10-173              ..............................................l-SIHGTNPQFLIEKVIRSRIYE..L.PFWKEHCFTLTA................................-ESLIDKAIE-..LNSIGG..............-VYG.N-Q.............................................KP.TQFKCLLLKL.LQIQPEKE..........ILV.EYLQ...............................................AEEFK..YLRALVAM....Y...I.....RMTFR........................AVEV....FQ.LLE.....PL..PIDFR.KLRERSMAG..............-----....-YTLTYMDEFVY.ALL.......TEERI...CD..T..ILPRITKRGVLEET-e....................................................................
C9S9P5_VERA1/26-193                  ............................................lap---NGENPAKIMEKAVIGRIVD..A.QYFQYQCFALNE................................-AGIVDRVVND..VKFIGG..............-TYG.SAQ.............................................KP.TPFLCLAFKL.LQLAPSDA..........VLE.MYLSf.............................................gGDKFK..YLRALACF....Y...I.....RMTRR........................AKDV....YA.ILE.....RY..LVDRR.KLRRKGRQG..............-----....-TSLTFVDEFVD.DLL.......TKTRV...CA..T..SFRELPRRTDLVD--lg...................................................................
W9YWJ5_9EURO/19-185                  .............................................pl--IRGQNPALLFETPMRDRITD..S.LYWKEQCFGLNA................................-ATLCDRAVE-..LTYIGG..............-TYG.VAM.............................................KP.TPFICLAFKL.LTLVPDKE..........IIL.EYLKn.............................................gGEEWK..YLRALAAF....Y...V.....RLTFD........................PADI....YK.TLE.....PL..LEDYR.KLRLRRRET..............-----....-YELIHVDEFVD.NLL.......TKERV...CG..T..SLWKLPGRQLLEDL-d....................................................................
B6QEC1_TALMQ/21-208                  ..............................................l--VRGVNPVTLFEKAVRDRITD..S.YYWKEQCFGLNA................................-ATLCDRAIE-..LTSIGG..............-TYG.LSQ.............................................KP.TPFLCLAFKM.LQLAPEKD..........IVL.EYLNftdpgsgddenp.......................edaeingevvkgRGDFK..YLRALAAF....Y...I.....RLTFE........................AAEI....YK.YLE.....PL..LLDYR.KLKRRMREN..............-----....-YVLTNMDQFID.DLL.......TKDRV...CA..T..SLWKLPSRQMLEDL-d....................................................................
F4PZZ0_DICFS/118-283                 ...............................................KTIHGTHSRNLIEKILRIKIQS..H.PYWKEKCMGLNE................................-ETLVDRAMA-..LTSFGG..............-TWG.GMK.............................................QP.THFICLMLKM.LQIQPDKD..........III.EFIT...............................................NQDFK..YVRILGAF....Y...L.....RLVGK........................PVDI....YN.YLE.....PL..YNDYR.SVRMKNDLG..............-----....QFNKIHVDEFVQ.ELL.......TGNYA...CE..I..VLPNLPSRRTLEQQ-g....................................................................
B0D223_LACBS/10-173                  ..............................................q-AIHGQNPQFLVETVIRNRIYE..S.TYWKEHCFALTA................................-ESLIDKALQ-..VRFIGG..............-VYG.NQR.............................................-P.TEFLCLLLKL.LQIQPEKE..........ILV.EYLR...............................................ADEFK..YLRALAAL....Y...I.....RMTFR........................AVEV....YD.LLE.....PQ..LKDYR.KLRQRNMGG..............-----....-YALTFMDEFVY.ALL.......VEERV...CD..I..ILPRLIKRQVLEEN-g....................................................................
H3FY63_PRIPA/61-245                  ..............................................l-PVWGNQKTMNLNGLVLENVLQ..C.TYYKQVLAECST................................YQQIVDEIYMH..VRHLEP..............WEKG.TRKvqgmtgmcg...........................gvrgvgaggVI.SSAFCLLYKL.FNIRITRK..........QLV.SMIN...............................................SNQSA..YLRGMGFM....Y...I.....RFCQP........................PSDL....WN.WLE.....PY..LDDED.---------..............TVDPRs..gGGDELTFGQIAR.MML.......TKLDW...YG..T..LFPRIPVPIQKDID-e....................................................................
W1QC60_OGAPD/14-179                  ..............................................k-RVHGVHPVFLIEKILRERILD..S.QYWKRECQHADL................................-LVLLDRGVE-..LKQIGT..............YANA.GHT.............................................LP.SPFICLLLRL.LQLQPAAD..........IID.YLLV...............................................QTDFV..YLTALAAL....Y...V.....RITCD........................SVIV....YQ.KLE.....PL..LADHR.RINMIENQT..............-----....-VKSINLDEYID.KLL.......QGNKF...LD..M..VLPRLIDRLVLEDQ-e....................................................................
A0A0A0MRN0_HUMAN/2-120               .........................................cggvrg----------------------..-.------------................................-----------..------..............--VG.TGG.............................................IV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
Q8SUF7_ENCCU/2-164                   ...........................................qykg-----------INRMTREKILG..S.EEFK-RMRSFTH................................-ADVIQSICS-..LDSIGG..............LIRG.T--.............................................-P.HKFLCLVQKM.GATSLSED..........AVA.VDLAnlkplepk...............................plgspaemFHGNV..YFIAASLF....Y...L.....RLSKR........................FHKY....RP.LIG.....LF..LADFR.KIPVVDGQN..............-----....NRTFMYLDVLAD.DLL.......NKSRI...FN..V..HLSR-----------ad...................................................................
D8SIA1_SELML/5-138                   ...........................................vqtc----GKPIQTLVEHVVNVNILS..S.EYFK-ELYRLKT................................FHEVVDEIYNH..VAHVVP..............WMTG.NSR.............................................GP.SPAFCLLCKF.FTMKLTDE..........QVQ.EFLN...............................................HADSP..YVCALFSFvapvF...L.....RYYGD........................PSTL...fWQ.WFK.....PY..IEDDE.---------..............-----....------------.---.......-----...--..-..---------------myvnpikl.............................................................
M9LTE5_PSEA3/10-174                  ..............................................v-SIHGTNPQFLIEKPVRARIYE..S.PFWKEHCFALSA................................-ATLLPLAVD-..LHHVGG..............-LTG.-LQ.............................................RP.SHFLCLLQKL.LQIQPEPA..........IVD.AYLA...............................................AKEFK..YLRVLAAF....Y...V.....RLTFA........................SSEI....YA.RLE.....PM..LEDYS.KLRWRDAGG..............-----....AYSVVHVDEVVD.MLL.......REERV...CD..I..ILPRLTRRDVCET--rd...................................................................
A0A0K8L2H4_9EURO/21-209              ..............................................l--VRGVNPATLFEKAVRDRITD..S.YYWKEQCFGLNA................................-ATLCDRAVE-..LTSIGG..............-TYG.VAE.............................................KP.TPFLCLAFKL.LQLNPERD..........IIL.EYLNytdpgsdeetea......................aaedqarngvvgqRGDFK..YLRALAAF....Y...V.....RLTFD........................PVDV....YK.TLE.....PL..LLDYR.KLKRRVRDT..............-----....-FVLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKLPARQQLEDL-d....................................................................
I1HL97_BRADI/3-166                   .............................................iq--TSGKPINMLMEKVLCMNILS..S.DYFK-ELYRMKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKVL....WT.WYE.....PY..LKDDE.---------..............EFSPG...sNGHMTTMGVYVR.DLI.......LGQYY...FD..S..ILPRVPVPVI-----rqvt.................................................................
S9YKY6_9CETA/13-80                   ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRK.............................................TA.----------.--------..........---.----...............................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------gqtgmcg..............................................................
G3WWZ2_SARHA/30-174                  ............................................svq----------------------..-.------------................................-------VVQ-..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
D4AX30_ARTBC/21-222                  ..............................................l--IRGVNPATLFEKAVRDRITD..S.YYWKEQCFGLNA................................-ATLCDRAVE-..LTYIGG..............-TYG.VGQ.............................................KP.TPFLCLAFKL.LQLAPEKE..........VIL.EYLNfhdpeadeedsnirrdstd.........adggaedaqdradaailkaTGDFK..YLRALAAF....Y...I.....RLTFE........................PVEI....YK.TLE.....PL..LTDYR.KLKRRTKEG..............-----....-FLLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKIPTRTMLEDL-d....................................................................
A0A0N4UD64_DRAME/10-175              .............................................vt--VKGTNPQYLIEKIIRTRIYD..S.KYWKEECFALTG................................-ELLVDKGME-..IRFVGG..............-IYA.GNV.............................................KP.TPFLCLVLKM.LQIQPEKD..........IIV.EFIR...............................................QEEYK..YIRALGAI....Y...L.....RITFS........................SIEV....YK.YLE.....PL..YNDYR.KLRVMNKDG..............-----....RFEIIHMDEFID.SLL.......REERY...CD..V..HLPRLQKRMTLEE--ig...................................................................
M3XUF9_MUSPF/49-233                  ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
R4X9K4_TAPDE/21-184                  ..............................................t-TVHGVNPAFLIEKITRERILD..S.LYFKDQCFGLTA................................-STVLDRVVG-..LTYIGG..............-IYS.-IG.............................................RP.TEFICLVFKM.LQLAPEKD..........IIL.HYLH...............................................DDEFK..YLRALAAL....Y...V.....RLVFS........................PKDV....YL.TLE.....PL..LTDYR.KLKVRGQNG..............-----....-FRLDYMDNFID.QLL.......TEPRV...FD..I..ALPNLMSRPLLEDL-d....................................................................
U6JTB6_EIMAC/135-297                 ............................................vqm----TDSTTYNVNQLLRANILS..S.EYFK-SLHQLKS................................FHEVVAEVAAY..ADHAEP..............YCSG.STR.............................................AP.STLFCCLYKL.FTLKLTDK..........QMH.MLLN...............................................HRESP..YVRCTGFL....Y...L.....RYVHP........................ADQL....WK.WFE.....PF..FLDDE.---------..............QFTPGa..dPNRVVSIGEYAQ.SLL.......TEDKY...FS..T..VLPRLPVLVK-----nvy..................................................................
C3ZFR3_BRAFL/10-175                  ..............................................h-SVKGTNPQYLVEKIIRSRIYE..S.KYWKEECFGLTA................................-ELLVDKAME-..LKYIGG..............-VYG.GNI.............................................KP.TPFLCLVLKM.LQIQPEKD..........IIV.EFIK...............................................NDEFK..YVRCLGAM....Y...M.....RLTGS........................SLDV....FK.YLE.....PL..LNDYR.KVKWMDSMG..............-----....KLNLSHVDEFVD.NLL.......REERS...CD..T..ILPRIQGRHVLEES-n....................................................................
E2BCA0_HARSA/10-175                  ...............................................KSIRGTNPQYLVEKIIRSRIYD..S.KYWKEECFALTA................................-ELLVDKAME-..LRYIGG..............-VYG.GNV.............................................KP.TPFLCLILKM.LQIQPEKD..........IIV.EFIK...............................................NEEFK..YVRALGAL....Y...M.....RLTGS........................SLDC....YK.YLE.....PL..FNDNR.KLRMQNKQG..............-----....VYELIHMDEFID.NLL.......REERS...CD..V..ILPRIQKRHVLEEN-n....................................................................
E4XHG4_OIKDI/82-282                  ..............................................l-PVHGNERTMNLNHMVLANITE..S.AYFRCDLLQIKT................................YDEMIDEIYYK..VTHLEP..............WEKG.SRKhftgsatgaergmayss...........ipgvqnyvgvrgvgqggIV.STPFCCLYKL.WTIKLTRK..........QVE.LMCD...............................................HVDSP..FIRGLGFL....Y...L.....RFSLP........................PQNL....LE.FLQ.....PY..FNDQE.---------..............EVDPKa..gGGDPMTMGALIL.AML.......EENHW...YG..T..MLPRIPAKHLQEI--rr...................................................................
K3YT29_SETIT/10-175                  ...............................................KSIHGTNPQNLVEKIVRSKIYQ..S.TYWKEQCFGLTA................................-ETLVDKAME-..LDHTGG..............-TYG.GNR.............................................KP.TPFLCLALKM.LQIQPDKD..........IVV.EFIK...............................................NEDYK..YVRVLGAF....Y...L.....RLTGT........................VADV....YQ.YLE.....PL..YNDYR.KLRHKLSDG..............-----....QFALTHVDEFID.ELL.......TKDYS...CD..T..ALPRIQKRWVLEA--sg...................................................................
H3B6U1_LATCH/36-219                  ..............................................l-PLWGSEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VAHIEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....PF..LDDEE.---------..............ELDVKa..gGGCIMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKN---ld...................................................................
D8QUJ9_SELML/10-175                  ...............................................KSVHGTNPQNLVEKILREKIHQ..S.SFWKEQCFALTA................................-ETLVDKAME-..LDHIGG..............-TYG.GNR.............................................KA.TPFMCLTLKM.LQIQPEKE..........IVV.EFIK...............................................NQDYK..YVRVLGAF....Y...L.....RLVGK........................ATDV....YQ.YLE.....PL..YNDYR.KIRQRSADG..............-----....SFFLSHVDEFID.QLL.......TTDYC...CD..I..TLPRVPKRSVLEQN-n....................................................................
M4BZA9_HYAAE/9-147                   ..............................................q-SVHGVNPQTLIEKIMRNRIYA..S.IYWKEQCFGLTA................................-ETLVDKAVE-..LSEFGG..............-TFG.GNQ.............................................QP.THFLCLLLKM.LQLQPEIE..........VVQ.QFIE...............................................NEDYK..YVTILGAV....Y...L.....RLVGK........................PMEV....YQ.LLE.....PL..LSDYR.KIRKRNTAN..............-----....------------.---.......-----...--..-..---------------ldvglralvqp..........................................................
A0A0L7LKK1_9NEOP/22-89               ..............................................l-PVWGNEQSMNLNPLILANIQG..S.SYFKVHLFKLKT................................YHEVVDEIYYQ..VKHLEP..............WERG.SRK.............................................TA.----------.--------..........---.----...............................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------gqtgmcg..............................................................
H3ATS7_LATCH/10-175                  ..............................................h-SIHGTNPQYLVEKIIRTRVYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LKYVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRLLGAL....Y...M.....RLTGT........................SIDC....FK.YLE.....PL..YNDYR.KIKTQNRNG..............-----....EFELMHVDEFID.QLL.......HDERV...CD..I..ILPRLQKRHVLEEA-e....................................................................
PRP38_YEAST/15-219                   ...............................................KQLNNQSVSLVIPRLTRDKIHN..S.MYYKVNLSNESLrg............................ntMVELLKVMIGA..FGTIKGqng.......hlhmMVLG.GIE.............................................--.--FKCILMKL.IEIRPNFQ..........QLN.FLLNvk..........................................nenGFDSK..YIIALLLV....Y...A.....RLQYYylngn.............nkndddENDL....IK.LFKvq.lyKY..SQHYF.KLKSFPLQVdc..........faHSYNE....ELCIIHIDELVD.WLA.......TQDHI...WG..I..PLGKCQWNK------iynsde...............................................................
G4U7T3_NEUT9/24-191                  ............................................lap---NGLNPATIMEKAVRERIID..S.YFYKEQCFGVNE................................-ADIVDRVVEH..VDFIGG..............-VYG.TVQ.............................................KP.SPFLCLAFKL.LQLAPSDD..........ILN.EYLQf.............................................gGEKFK..YLRALALF....Y...I.....RLTRK........................DQDV....YK.TLE.....PF..LEDRR.KLRRKGRNG..............-----....-TSLTYMDVFVD.DLL.......TKDRV...CA..T..SLWKMRKRDILEDL-d....................................................................
I1F795_AMPQE/2-83                    .............................................lc----------------------..-.------------................................-----------..------..............----.---.............................................--.----------.--------..........---.----...............................................---SK..YVRALGAL....Y...L.....RIVGT........................SVEC....YK.YLE.....PL..YNEYR.KIKYKNRQG..............-----....KFELSHVDEFVD.SLL.......REDRV...CD..V..ILPRIQKRHILEET-e....................................................................
A0A096MBN3_POEFO/10-175              ..............................................n-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LKFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRLLGAM....Y...M.....RLTGT........................AVDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HAERV...CD..I..ILRMLQKRQVLEEA-e....................................................................
W6KQG9_9TRYP/3-189                   .............................................fn--LKGRQAVASLDPATRYRITR..S.QAMS-QCANKPL................................-LWVLEELTS-..VVAVGG..............-LSG.SLH.............................................KV.EYFLCLLTRL.LQIGPSPD..........IVL.AMLR...............................................QELHK..YVKVAALF....I...I.....RFIGN........................DIMV....QE.AVK.....LG..LDDYR.KIRVYGSDE..............-----....------------.---.......-----...--..-..---------------tpvtlfvtpgvkrprdmdesnhelpvgnqentdvmesrepphyfilkmdelterlfqlnq.........
A0A0G4IHW0_PLABS/154-314             ............................................cda--------HFNFNNILATNILS..S.EYFK-DLFQYRR................................FHEVLNEVRNK..VTHLEA..............LTIG.QTR.............................................LP.STAFCLLYKL.LTMKLTVR..........QMG.AMLS...............................................DTKPP..FMRGIALL....Y...L.....RFVHP........................PKKL....WA.WFA.....PL..LDDTT.---------..............EFSPSg..pSAPTCTLGEFAK.RLL.......LDLNY...PG..T..ILPRIPIPVHRE---ykk..................................................................
Q4Y906_PLACH/157-319                 ............................................iem----TNTSTYNVNNLLRNNILS..S.EYFR-SLINLKT................................FKEVLDEILSY..ADHVEP..............YCIG.STR.............................................AP.STLFCCLYKF.FTMQLTKK..........QLK.SLID...............................................NKESC..YVRACGFL....Y...L.....RYVHC........................PSNL....WM.WFE.....PY..MLDDD.---------..............EFTISa..dKRKLVTIGEYVQ.SLL.......YDDKY...FN..T..VLPRLPIKIK-----niy..................................................................
M0U4G2_MUSAM/3-166                   ..........................................iqtsg-----RPIDTLLEKVLSMNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKTL....WT.WFE.....PY..IKDGE.---------..............EISPG...sNGRLTTMGIYVR.DLL.......LGQYY...FD..T..LFPRIPIPVMR----qiv..................................................................
K4DTH9_TRYCR/9-176                   .............................................wn--LKGRSAVAALDPSTRHRIMQ..S.HAMASSFHKPLL................................-ATLE-VLIT-..TQYVGG..............-LTG.PLQ.............................................KP.EPFICHVTRL.LQITPDPS..........IVL.AMLH...............................................QDVHK..YLRVAALF....I...I.....RLIGN........................EAMM....RE.AMR.....VG..WEDYR.KIRVYGYVE..............-----....------------.---.......-----...--..-..---------------dlagtidskennapdeeegfvrapaygimcvdeitdrlfnv............................
A0A0N5CN93_THECL/1-176               ...............................................---------MNLNALVLENIIQ..C.TYYKNYLSDTTG................................FQQLTEEIYYN..VKHLEP..............WERG.TRKtqgmtgmcg...........................gvrgvgaggVV.STAFCLLYKL.FTIRLTRK..........QLV.SMIN...............................................NRDSP..YIRGIGFM....Y...I.....RFCQP........................PQDL....WA.WME.....PY..LDDEE.---------..............QIDPRs..gTGDMMAMAQVVK.MML.......TKLDW...YG..T..LFPRIPVPIQRID--eh...................................................................
M5XCM3_PRUPE/1-41                    ............................................mgv----------------------..-.------------................................-----------..------..............----.---.............................................--.----------.--------..........---.----...............................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------..............-----....NYALTHVDEVID.ELL.......TKDYS...CD..I..AMPRIKKRWTLEA--tg...................................................................
R4GD49_ANOCA/32-216                  ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
W5JA90_ANODA/10-175                  ...............................................KNVHGTNPQYLIEKIIRSRIYD..S.KYWKEQCFALTA................................-ELLVDKAME-..LRFVGG..............-VFG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IVV.EFIK...............................................NEEFK..YVRALGAF....Y...L.....RLTGS........................SLDC....YK.YLE.....PL..YNDNR.KLRKQNRMG..............-----....AYELIHVDEFID.ELL.......REERV...CD..I..ILPRIQKRHVLEEN-n....................................................................
B4GH52_DROPE/10-175                  ...............................................KNVHGTNPQYLIEKIIRSRIYD..S.KYWKEQCFALTA................................-ELLVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TQFLCLTLKM.LQIQPEKD..........IVV.EFIK...............................................NEEFK..YVRALGAF....Y...L.....RLTGV........................ALDC....YK.YLE.....PL..YIDNR.KLRRQNRAG..............-----....QFEIVYMDEYID.ELL.......RNDRV...CD..I..ILPRIQKRTILEEN-n....................................................................
A4RVT9_OSTLU/18-191                  ............................................naa---KTTGRTHGVEAVLRQNVVN..S.EYYRKLCRSATGtvdg........................egmdFMSLVDEIYEL..VDHVEP..............WMSG.NAR.............................................GA.STGFCILFRF.CEKELSDK..........EIW.HLLR...............................................HGDSP..YIRAIGFL....Y...V.....RYVKN........................GREL....LR.WCE.....EF..FDDAE.---------..............KFSPS...pGGKEVTMGTYVR.DLL.......LEQHY...FE..T..IFPRIPEVARRE---mvq..................................................................
D3ZGL5_RAT/10-175                    ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LKFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
E3LKU1_CAERE/55-239                  ..............................................l-PIWGNQVTMNLNTLVLENIRE..S.YYYKNNLVEIDS................................FQTLVEQIFYQ..VKHLEP..............WEKG.TRRlqgmtgmcg...........................gvrgvgaggVV.SSAYCLLYRL.FNLRISRK..........QLI.SMLN...............................................SRQSV..YIRGIGFM....Y...I.....RYTQP........................PADL....WY.WLE.....PY..LDDDS.---------..............EIDPRs..gGGDLMTFGQMVR.TMI.......NKLDW...YG..T..LFPRIPVPIQKEID-e....................................................................
A0A0E0PTE4_ORYRU/4-157               ........................................qssgrpi--------DVLMEKVLSVNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.SSAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAVGFL....Y...L.....RYVAE........................PKTL....WS.WYE.....PY..IKDDE.---------..............EFSPG...sNGKMTTMGVYVR.DLL.......L----...--..-..---------------gqcplvtqaplw.........................................................
A0A074SWX5_HAMHA/10-175              ..............................................q-QVHGCNPQTLVSRIIRRKIYE..S.VFWKEQCFALTA................................-ETVLEPCVG-..LTYVGG..............-TYG.GKR.............................................QP.APFLCLVLKL.LQIQPEPE..........IIL.EFIK...............................................QEQFK..YLRAVGAF....Y...L.....RLVGR........................ACEV....YT.HLE.....PL..LADYR.KLRLRLADG..............-----....KFTIVCMDEFVD.DCL.......RKTNF...LD..V..DLPVLPKREVLENE-g....................................................................
M4BIY1_HYAAE/37-168                  ..............................................l-PINGNDTTYNLNTLLHQNILQ..S.AYFH-ELYKLKT................................YHEVVDEIYYR..VDHAEP..............WSPG.TAR.............................................IP.SSCFCLLHKF.FLMRLTVK..........QMQ.GLLR...............................................HTDSS..YIRVIGFL....Y...L.....RYTCD........................PEKL....WT.WFE.....PY..LEDVE.E--------..............-----....------------.---.......-----...--..-..---------------fnasanpslk...........................................................
G3PQV1_GASAC/24-208                  ..............................................l-PLWGNEKTMNLNPMILTNVLS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHAEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QLM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PADL....ID.WYD.....GF..LDDEE.---------..............ELDVKa..gGGCVMTVGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKL---idq..................................................................
A0A078JU74_BRANA/10-175              ...............................................KNIRGTNPQNLVEKIVRTKIYN..H.TFWKEQCFGLTA................................-ETLVDKAME-..LDHVGG..............-TFG.GNR.............................................KP.TPFLCLILKM.LQIQPEKE..........IVV.EFIK...............................................NDDYK..YVRILGAF....Y...L.....RLTGS........................DVDV....YR.YLE.....PL..YNDYR.KVRQKLSDG..............-----....RFSLTHVDEVIE.ELL.......TKDYS...CD..I..AMPRLKKRWTLEQN-g....................................................................
H2TYE1_TAKRU/22-206                  ..............................................l-PLWGNEKTMNLNPMILTNVLS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QLM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PPDL....LE.WYD.....GF..LDDDE.---------..............ELDVKa..gGGCVMTVGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKSI--dq...................................................................
K7HSD9_CAEJA/1-166                   ..............................................k-TVKGTNPQFLVEKIIRQRIYD..S.MYWKEHCFALTA................................-ELVVDKGMD-..LRYIGG..............-IYA.GNI.............................................KP.TPFLCLALKM.LQIQPDKD..........IVL.EFIQ...............................................QEEFK..YIRALGAM....Y...L.....RLTFE........................STEI....YK.YLE.....PL..YNDFR.KLRFMNKMG..............-----....RFEAIYMDDFID.NLL.......REDRY...CD..I..QLPRLQKRWALEE--vd...................................................................
R9ACJ1_WALI9/10-173                  ..............................................s-SIHGRNPQHLIENVIRQRVYE..S.AFWKEQCFALTA................................-ETIIDKAVE-..MQSIGG..............-VYG.NAR.............................................-P.LPFMCLLLKL.LQLQPERE..........IIF.EYLQ...............................................AEEFK..YLRALAAM....Y...T.....RLCFK........................SFEV....FD.ILE.....PL..LQDYR.KLRLRNNSG..............-----....-YHITHMDQFID.ELL.......TEERV...CD..I..ILPRLTRRDVLEE--ve...................................................................
G1XLI7_ARTOA/22-185                  .............................................pt--IHSMNPLLLMEKIIRERIID..S.MYWKEQAWGLNA................................-ATLLDRAVE-..LQFIGG..............-QY-.ANQ.............................................KP.TPFICLILKM.LQLNPERE..........ILL.EYVQ...............................................DEDFK..YLRVLAAF....Y...I.....RLAWP........................AAEI....YK.TLE.....PL..MADYR.KIRLRTQSG..............-----....-YKLTFVDEFID.ELL.......TKERV...CD..I..ALPRMPTRAQLEDM-d....................................................................
A0A098E326_GIBZA/26-192              .............................................ap---NGLNPATIMEKAVRDRIVD..S.IYYKMQCFACNE................................-ADIVDRVVED..VKFIGG..............-TYG.TTQ.............................................VP.SPFLCLAFKL.LELSPSDA..........VLL.EYLKf.............................................gGEAFK..YLRALACF....Y...F.....RLTRQ........................AKNV....YE.MLE.....PF..LEDRR.KLRRRGREG..............-----....-VKLSYMDEFVD.DLL.......TKERV...CG..T..SLWKMPKREVLEDL-e....................................................................
A0A087XDU8_POEFO/25-209              ..............................................l-PLWGNEKTMNLNPMILTNVLS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHIEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....LD.WYN.....DF..LDDEE.---------..............ELDVKa..gGGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKAI--dq...................................................................
B8BCS7_ORYSI/10-175                  ...............................................KSIHGTNPQNLVEKIVRSKIYQ..S.TYWKEQCFGLTA................................-ETLVDKAME-..LDHTGG..............-TYG.GNR.............................................KP.TPFLCLALKM.LQIQPDKD..........IVV.EFIK...............................................NEDYK..YVRVLGAF....Y...L.....RLTAT........................VADV....YQ.YLE.....PL..YNDYR.KIRHKLSDG..............-----....KFTLTHVDEFID.DLL.......TKDYS...CD..T..ALPRIQKRWVLET--sg...................................................................
A0A0E0A4V5_9ORYZ/4-150               ........................................qssgrpi--------DVLMEKVLSVNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.SSAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAVGFL....Y...L.....RYVAE........................PKTL....WS.WYE.....PY..IKDDE.---------..............EFSPG...sNGKMTTMGVYVR.DLL.......L----...--..-..---------------gqcpl................................................................
C8VB07_EMENI/21-212                  ..............................................l--VRGLNPAMLFEKAVRDRITE..S.YYWKEQCFGLNA................................-ATLCDRAVE-..LTFIGG..............-TYG.VSE.............................................KA.SPFLCLAFKL.LQINPDRD..........IIM.EYLNfsdpenetdgaded...................ttaedraqrsvvkhRGDFK..YLRALAAF....Y...V.....RLTWE........................PVEI....YK.TLE.....PL..LLDYR.KLKRRVRDS..............-----....-FVLTYMDQFVD.DLL.......TKDRM...CG..T..SLWKLPSRQQLEDL-d....................................................................
A0A068RMB9_9FUNG/9-173               ..............................................l-ETWGNETTMNMNAILYQNILA..S.PYFK-SLYEKKT................................FHEIVDEIYNE..VTNLAP..............FIKG.TT-.............................................-V.STAFCCLFKF.WTLRLTVK..........QLE.NLID...............................................HRDSP..YIRAIGFL....Y...L.....RYVCA........................PAEL....WE.WLS.....YY..LEDEE.EI-------..............--ELSg.gpRPQKSTIGKLCR.MLL.......TEQKF...QG..T..MLPRIPVPIAR----dldk.................................................................
F4K754_ARATH/4-105                   .............................................iq--SNGRAYESLLEKVLSMNILS..S.DYFK-ELYGLKT................................YHEVIDEIYNQ..VNHVEP..............WMGG.NCR.............................................GP.STAYCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HTDSP..YIRAIF--....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------tttikv...............................................................
F7H0L0_MACMU/47-189                  ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.---------..............-----....------------.---.......-----...--..-..---------------fyt..................................................................
K0SGM5_THAOC/41-200                  ..........................................iplsc-----SDDTFNMHPMLLQNIAK..S.PYFHKCVDTLTD................................WNGLVDEIYYE..VKHLEP..............FTAV.SLD.............................................RVlSAATSLHF--.-EVYREAD..........ALD.---A...............................................GAYSP..YIRCIGFL....Y...L.....RYAAE........................PSTL....WT.WFE.....PY..LHDDE.PVQVRQ---..............-----....GRADTTVGEFVR.SLL.......EDMDY...HG..T..RLPRLPLTIER----qvk..................................................................
F6UKW2_XENTR/35-219                  ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PADL....WD.WYE.....DF..LDDEE.---------..............ELDVKa..gGGCIMTIGEMLR.SYL.......TKLEW...FS..T..LFPRIPVPVQKHI--dq...................................................................
Q4N084_THEPA/10-175                  .............................................hl--IHGTNPQFLFSKILRDKVYN..S.FYWKESCFGLTA................................-ESLIDKAVQ-..IKYVGG..............-TFG.GNR.............................................QP.SPFICLVLKM.LQIQPEME..........IVH.EYIK...............................................NEDYK..YLRALGIY....Y...M.....RLVGT........................AVEV....YR.TLE.....PI..LGDYR.KLRFRNIDG..............-----....SYVIKYMDEFVD.DCL.......TNTTY...LD..V..DLPPLSKRMNLEA--tk...................................................................
L8H6U6_ACACA/87-250                  ..............................................l-ELHGDLEKMNLSALIYNNILG..S.TYFK-GLYKLKT................................YHEIVDEIYYS..VEHLEP..............FMP-.NSK.............................................MA.SQAWCLMYKC.FTIKLTKK..........QVT.GMLD...............................................HADSP..YIRGIGFL....Y...L.....RMCTN........................PKLL....WD.WFE.....PY..LADEE.---------..............EITIR...yKGKPTTIGSLVE.DLL.......TTIKF...VD..A..IMPRFPALVGKEI--nd...................................................................
A0A0D9S6K8_CHLSB/47-231              ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
J3P436_GAGT3/24-191                  ............................................lap---NGLNPARIMEKAVVDRIVD..S.YFWKEQCFGLNE................................-ADIVDRVVDH..VHFVGG..............-ITG.ASQ.............................................KP.TPFLCLALKL.LQLAPGDD..........VLA.EYLHf.............................................gGDKFK..YLRALALF....Y...V.....RLTRT........................PKDV....YA.TIE.....PF..LEDYR.KLRRKGRAG..............-----....-TSLTYVDDFAD.DLL.......VKDRV...CA..T..SLYKLTKRDVLEDL-d....................................................................
W5FVI4_WHEAT/10-175                  ..............................................r-SIHGTNPQNLVEKIVRAKIYQ..S.NYWKEQCFGLTA................................-ETLVDKAME-..LDHTGG..............-THG.GNR.............................................RP.TPFLCLALKM.LQIQPDKE..........IVV.EFIK...............................................NEDYK..YVRVLGAF....Y...L.....RLTGT........................VADV....YQ.YLE.....PL..YNDYR.KIRQKLSDG..............-----....KFTLTHVDEFID.ELL.......TKDYS...CD..T..ALPRIQKRWILEA--sg...................................................................
F2SN07_TRIRC/21-222                  ..............................................l--IRGVNPATLFEKAVRDRITD..S.YYWKEQCFGLNA................................-ATLCDRAVE-..LTYIGG..............-TYG.VGQ.............................................KP.TPFLCLAFKL.LQLAPEKE..........VIL.EYLNfhdpeadeedlkvrgdstd.........adggagdaqdradaailkaTGDFK..YLRALAAF....Y...I.....RLTFE........................PVEI....YK.TLE.....PL..LTDYR.KLKRRTKEG..............-----....-FLLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKIPTRTILEDL-d....................................................................
G5C765_HETGA/10-78                   ..............................................h-SIHGTNPQHLVEMIIRTQIYE..S.KYWKEECFGLMA................................-ELVVDKAME-..LRFMGG..............----.---.............................................--.----------.--------..........---.----...............................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------gchprllgprrsagpstqk..................................................
W5EZF1_WHEAT/1-99                    ...............................................----------------------..-.------------................................-----------..------..............----.---.............................................--.---------M.LQIQPDKE..........IVV.EFIK...............................................NEDYK..YVRVLGAF....Y...L.....RLTGT........................VADV....YQ.YLE.....PL..YNDYR.KIRQKLSDG..............-----....KFTLTHVDEFID.ELL.......TKDYS...CD..T..ALPRIQKRWILEA--sg...................................................................
H0V3G0_CAVPO/48-232                  ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
S9WYR5_9TRYP/4-144                   .............................................nl---KGRSAVAALDPSTKGRILK..S.HTMN-SCLNKPL................................-LWVLEELID-..LEAVGG..............-VSG.PLK.............................................RV.EYFLCLLTRL.LQITPAPG..........IVL.TMLR...............................................QDVHK..YLRVGALF....L...I.....RLIGN........................PAMQ....RE.AMK.....IG..FDDYR.KIRVYGNEE..............ERE--....------------.---.......-----...--..-..---------------tsstkrpreeee.........................................................
A0A0L7L5T5_9NEOP/10-175              ...............................................KSIRGTNPQYLIEKIIRARIYD..S.KFWKEECFALTA................................-ELLVDKAME-..LRYVGG..............-VHG.GFI.............................................YP.TPFLCLVLKM.LQIQPEKD..........IVV.EFIK...............................................NEEFK..YVRALGAF....Y...M.....RLTGT........................SVDC....YK.YLE.....PL..YNDNR.KLRRQNREG..............-----....QFEIVHVDEFID.ELL.......REERL...CD..I..ILPRIQKRFVLEEN-n....................................................................
E0VHT3_PEDHC/1-176                   ...............................................---------MNLNPLILTNIQS..S.YYFKVNLYELKT................................YREVIDEIFYK..VNHLEP..............WEKG.SRKtagqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.FTLHLTRK..........QLN.GLIN...............................................HRDSP..YIRALGFM....Y...I.....RYTQP........................PADL....YD.WFE.....NY..LEDAE.---------..............EMDVKa..gGGQIMTIGDMLR.HFL.......TKLEW...FS..T..LFPRIPVPIQQKIE-r....................................................................
T0KFN0_COLGC/1-66                    ..............................................m----------------------..-.------------................................-----------..------..............----.---.............................................--.----------.--------..........---.----...............................................-----..--------....-...-.....--TRK........................AKDV....YL.LLE.....PF..LEDRR.KLRRKGRAG..............-----....-TSLTYMDEFVD.DLL.......TKTRV...CA..T..SFRELPKRVDLVD--lg...................................................................
F6I4Q5_VITVI/10-175                  ...............................................KSIRGTNPQNLVEKILRSKIYQ..N.TYWKEQCFGLTA................................-ETLVDKAME-..LDHLGG..............-TFG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKD..........IVV.EFIK...............................................NEEYK..YVRILGAF....Y...L.....RLTGI........................DTDV....YQ.YLE.....PL..YNDYR.KLRRKLSDG..............-----....NYSLTHVDEVID.ELL.......TKDYS...CD..V..ALPRIKKRWTLES--lg...................................................................
A0A024WI92_PLAFA/173-335             ............................................lem----TNTTTYNVNTLLRNNILS..S.EYFK-SLIPIKT................................FKEVVDEIHSY..ADHVEP..............YCIG.SNR.............................................AP.STLFCCLYKF.FTMQLSEK..........QLK.SLIE...............................................NKDSC..YIRACGFL....Y...L.....RYVHS........................PANL....WM.WFE.....PY..LLEED.---------..............EFSISc..dKRRKVTIGEYVQ.SLL.......SDDKY...FN..T..VLPRLPIKIK-----nvy..................................................................
B0WP85_CULQU/10-175                  ..............................................r-NVHGTNPQYLIEKIIRSRIYD..S.KYWKEQCFALTA................................-ELLVDKAMD-..IRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IVV.EFIK...............................................NEEFK..YVRALGAF....Y...L.....RLTGS........................SQDC....YK.YLE.....PL..YNDNR.KLRRQNRMG..............-----....HYELVHMDEFID.ELL.......REERG...CD..I..ILPRIQKRHVLEEN-n....................................................................
C0PCD4_MAIZE/3-167                   ...........................................iqts----GKPIDVLMEKVLSMNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNT..VKHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..HIRAIGFL....Y...L.....RYVAD........................PKVL....WM.WYE.....PY..LRDDE.---------..............EFSPG...sNGRKTTMGVYVR.DLI.......LGQYY...FD..S..LLPRIPLPVTRQ---ita..................................................................
F0VCL2_NEOCL/132-293                 ............................................emt-----DSTTYNVNALLRSNILA..S.EYFK-SLHELKT................................VPEVVDEIAQY..AQHAEP..............YCSG.SSR.............................................AP.STLFCCLYKL.FTMKLTTK..........QVE.QLLD...............................................YSDSP..YVRCAGFL....Y...L.....RYVHP........................PEKL....WK.WYE.....AY..FLDDE.---------..............EFAASa..dAKRTTTVGEYVE.SLI.......MEDKY...FN..T..VLPRLPVKVK-----nly..................................................................
A0A068XDW1_HYMMI/27-211              ..............................................l-KLWGNQVTMNINPMIHTNIIQ..S.PYFKTNLIELKT................................YHEVIDEIYYK..VTHLEP..............WERN.SRRvggqtgmcg...........................gvrgvgaggIV.STAYCLLFKL.FTLKLTRK..........QLK.GLLE...............................................HPDSP..YIRSLGFM....Y...I.....RYCLP........................PEDL....WM.WFS.....PY..LDDEE.---------..............EVDVRa..gGGCTMTIGAMLE.QFL.......TKLDW...FT..T..LFPRIPVPVQKKIE-e....................................................................
W9C3G0_9HELO/21-188                  ............................................lap---NGLNPATILEKPVRERIVD..C.YFWKDQCFALNE................................-ADIVSRVVSH..VTFIAG..............-TYG.DSQ.............................................RP.SPFLCLAFKL.LQLGPSDE..........ILQ.EYMGy.............................................gGEKFK..YLRALALF....Y...W.....RMTRQ........................AKDV....FM.VLE.....GY..LEDRR.KLRRKTRTG..............-----....-TTLTFIDQFVD.ELL.......TKDRV...CG..T..TLWKMPKREILEDL-e....................................................................
Q4U8Q2_THEAN/128-301                 ............................................ipm----TNSVTYNMNDLLRSNILS..S.EYYK-SL-SVKN................................FYQVFDELVQF..ASHCEP..............YCST.ATR.............................................AP.STIFCCLYRF.LVLKLTEKqvifslievvQMN.FLLE...............................................NNKSP..YARCCGFL....Y...L.....RYVLP........................PDKVtkikFI.CFS.....SG..IDDEF.--------F..............TVSAD....GNKQITMGEYAE.SLL.......MDDKY...YH..T..ILPRLPVRVK-----nl...................................................................
R7Z359_CONA1/20-205                  .............................................al--IRGQNPALLFEKAVRDRITE..S.YYWKEQCFGLNA................................-ATLCNRAVE-..LTFIGG..............-TYG.GMG.............................................KP.TPFLCLAFKL.LQLVPERD..........IIL.EYLNwsdeegeqge..........................eeenegitlgrPGEFK..YLRALAAF....Y...I.....RLAWE........................PVEI....YR.TLE.....PL..LADYR.KLKRRTREG..............-----....-FTLTFMDQFID.DLL.......TKDRV...CA..T..SLWKLPPRTHLEDL-e....................................................................
PR38B_MOUSE/48-232                   ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
B9PT26_TOXGO/142-303                 ............................................emt-----DSTTYNVNALLRSNILS..S.EYFK-SLHELKT................................VPEVVDEITQY..AQHAEP..............YCSG.SSR.............................................AP.STLFCCLYKL.FTMKLTTK..........QLE.QLLD...............................................YSDSP..YVRCTGFL....Y...L.....RYVHP........................PEKL....WK.WYE.....QY..FLDDE.-VFAASSD-..............-----....TKRTTTMGEYVE.SLI.......MEDKY...FN..T..VLPRLPVKVK-----nly..................................................................
A0A0E0PTE5_ORYRU/4-166               ........................................qssgrpi--------DVLMEKVLSVNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.SSAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAVGFL....Y...L.....RYVAE........................PKTL....WS.WYE.....PY..IKDDE.---------..............EFSPG...sNGKMTTMGVYVR.DLL.......LGQYY...FD..S..LLPRVPLPI------lrqvt................................................................
M0Z3R7_HORVD/3-165                   ...........................................lqts----GRPIEVLMEKVLSMNIVS..S.DYFK-ELYKIKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKL.FTMKLTVN..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYAAD........................PKTL....WT.WYE.....PY..IQDDE.---------..............EFSPG...sNGKMTTMGVYVR.DVI.......LGQYY...FD..S..LLPRVPL--------lilrqv...............................................................
J4W4G8_BEAB2/24-191                  ............................................lap---NGLNPANIMEKAVKDRITD..S.YFYKEQCFALNE................................-ADIVDRVVEH..VRFIGG..............-TSG.TAQ.............................................KP.SPFLCLAFKL.LELSPSDA..........VLA.EYLAy.............................................gGEHFK..YLRALACF....Y...L.....RLTRQ........................AKDV....YE.TLE.....PF..LADRR.KLRRKGRER..............-----....-TTLTYMDEFVD.DLL.......SKDRV...CA..T..SLWKMPKREILEDL-e....................................................................
A0A061EDX2_THECC/3-165               ........................................iqtcgkp-------INSLLEKVLCMNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYAAD........................PKTL....WT.WFE.....PY..IKDEE.---------..............EFPPG...sNGRMTTMGVYVR.DLL.......LGQYY...FD..T..LFPRIPVPV------lrqv.................................................................
D2V594_NAEGR/1-165                   ..............................................t--VHSTNSQNLIEQITRNKIFN..S.IYYKEECFGLNA................................-ATVIDKAEN-..LDSIGG..............-TFG.GLR.............................................KP.TNFLSLLMKM.LQIEVDLE..........STV.AYIH...............................................NGEFK..YLTALGAL....Y...L.....RLVGN........................AVDV....YE.QLE.....PL..YSDYR.KLRLRLIDG..............-----....SCKILHMDEFIE.MLL.......TSDSF...CD..V..KLPFLLSRKVLEK--ng...................................................................
M3VYN3_FELCA/10-175                  ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
H0V990_CAVPO/21-205                  ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
A0A0D2XW34_FUSO4/26-192              .............................................ap---NGLNPATIMEKAVKDRIVD..S.YFYKEQCFALNE................................-ADIVDRVVEH..VNFIGG..............-TYG.VTQ.............................................KP.SPFLCLAFKL.LELSPSDA..........VLM.EYLKy.............................................gGEAFK..YLRALACF....Y...F.....RLTRQ........................AKDV....YE.MLE.....PF..LEDRR.KLRRRGRAG..............-----....-VVLTFMDEFVD.ELL.......TKERV...CG..T..SLWKMPKREVLEDL-e....................................................................
W9S3F4_9ROSA/21-93                   .............................................id----------------------..-.------------................................-----------..------..............----.---.............................................--.----------.--------..........---.----...............................................-----..----IGFL....Y...L.....RYAAD........................PKTL....WT.WFE.....PY..VRDEE.---------..............EFSPG...sSGRMSTMGAYVR.DLL.......LGQYY...FD..T..LFPRIPVPVMRQ---iva..................................................................
A0A0N4UBE8_DRAME/12-155              ............................................lif----------------------..-.------------................................---------FQ..VKHLEP..............WERG.TRKtqgmtgmcg...........................gvrgvgaggVV.STAFCLLYKL.FTIRLSRK..........QLV.SMIN...............................................NRDSP..YIRGLGFM....Y...I.....RFCQP........................PCDL....WA.WME.....PY..LDDEE.---------..............QIDPRs..gGGDVTTIAQIVK.MML.......TKLDW...YG..T..LFPRIPVPIQKEI--ei...................................................................
A0A090MUW1_STRRB/13-194              ...........................ndsaipniqkitrgnntlpe--------------------YE..S.VYWKEYLHSLTT................................FHQVQDEIIKK..VKYLEP..............WEHG.SRNpnsscig..............................vrgvsaggRV.TTAFCLLYKL.FTLKLTRK..........QIV.SMIN...............................................NDQNT..YLRAIGFL....Y...I.....RYCQP........................PKDL....YD.WFE.....PY..LHDKD.VILIRSRNK..............-----....--GEITIGEMLK.NLL.......TNLDF...YG..T..LLPRIPIPIQTSI--dk...................................................................
PR38A_XENTR/10-175                   ..............................................h-SVHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LKYVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRTLGAL....Y...M.....RLTGT........................ATDC....YK.YLE.....PL..YNDYR.KVKVQNRNG..............-----....EFELMHVDEFID.QLL.......HEERV...CD..V..ILPRLQKRFVLEET-e....................................................................
A0A024W6R0_PLAFA/11-175              ............................................knf----GSNPQYLISNIIRSKIYD..S.PYWKEKCFALTS................................-ESIIDQAIN-..LKYVGG..............-TYG.GNR.............................................KP.TRFLCLILKL.LQIQPDKD..........IIY.EYIK...............................................NEDFV..YLRALGIF....Y...L.....RLIGK........................SLEV....YN.HLE.....PI..LFDYR.KIRMRLQNG..............-----....TFEKIYMDVFVD.NCL.......ILNNF...LD..V..DFPTLTKRQVLEEN-n....................................................................
V4TZ97_9ROSI/4-144                   .......................................iqtcgkpi--------DSLLEKVLCMNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYAAD........................PKTL....WN.WFE.....QY..LKDEE.---------..............-----....------------.---.......-----...--..-..---------------lnpyrfgnsnvgsyfqllli.................................................
A0A022RAJ0_ERYGU/10-174              ...............................................KSIRGTNPQNLVEKILRTKIYQ..N.TYWKEQCFGLTA................................-ETLVDKAME-..LDHLGG..............-TNG.GNR.............................................RP.TPFMCLVMKM.LQIQPDKE..........IVV.EFIK...............................................NPDYK..YVRVLGAF....Y...L.....RLTGT........................DVDV....YR.YLE.....PL..YNDYR.KLRLQLNDG..............-----....KFTLTHVDEYID.ELL.......TKDYS...CD..I..ALPRIKKRWTLE---ai...................................................................
H0V4L8_CAVPO/10-175                  ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
G0RPR5_HYPJQ/26-193                  ............................................lap---NGLNPATIMEKAVKDRIVD..S.YFYKEQCFALNE................................-ADIVDRVVEH..VTFIGG..............-THG.ASQ.............................................KP.SPFLCLAFKL.LELAPSDA..........ILQ.EYLSy.............................................gGEHFK..YLRALACF....Y...V.....RLTRQ........................AKDV....YL.TLE.....PF..LEDRR.KLRRKARTG..............-----....-TTLTFVDEFVD.DLL.......TKDRV...CA..T..SLWKMPKRETLEDL-e....................................................................
T0RRR2_9STRA/9-173                   ..............................................t-HVHGVNPQHLVEKILRNRIYD..C.MYWKEHCFGLTE................................-ETLVEKAID-..LSYIAG..............-HFG.GNQ.............................................QP.SPFLCLLLKM.LQMQPDMD..........VVM.TFIE...............................................NGDYK..YVTALGAM....Y...L.....RLTGK........................PVEI....YP.VLE.....NL..LSDYR.KVRFRKTMG..............-----....-WDVLHMDEVAD.LLL.......REEYF...CN..I..ALPRLVDRFQLES--mn...................................................................
A0A015N4G5_9GLOM/7-171               ..............................................l-ETWGSETTMNLNNILYQNIQA..S.PYFK-HLYELKT................................YHEVIDEIFNH..VESLEP..............FLKG.TTA.............................................--.STAFCLLYKL.WTLRLTVK..........QVN.GLIE...............................................HTDSP..HIRALGFL....Y...L.....RYVCK........................PIHL....WE.WFE.....EY..LDDEE.E--------..............-VQIQg.gpRPVIITIGKMCR.QLL.......TEQKW...LG..T..ILPRIPVPIAREIE-q....................................................................
M2Z5Y8_PSEFD/16-183                  .............................................vl--IRGDNPLKLFEKPVRDRIVD..S.YYWKEQCFGLNA................................-ATLLDRAVE-..LTFIGG..............-TYG.VAQ.............................................KP.TPFLCLAFKL.LQLTPERE..........IIM.FYLEk.............................................gGEEYK..YLRALAAF....Y...I.....RIAWE.......................kDEEV....YT.TLE.....PY..LADSR.KLKRRTREG..............-----....-WALTHVDEFID.DLL.......TKSRV...CA..T..TLPKINPRLWLEDE-d....................................................................
A0A0N4Z164_PARTI/30-211              ............................................lpe---YGNRQTMNLNNLVYTNIIE..S.VYWKEYLHSLTT................................FHQVQDEIIKK..VKYLEP..............WEYG.SRNhnsscig..............................vrgvsaggRI.TSAFCLLYKL.FTLKLTRK..........QIV.AIIN...............................................NEQNT..YLRVMGFL....Y...I.....RYCQP........................PKDL....YD.WYE.....PY..LNDKA.FVT------..............-IKSK....NGHDVTIGEILK.HLL.......TNLDW...YG..T..LLPRIPVPIQN----iidk.................................................................
B3L5D4_PLAKH/10-175                  .............................................ik--IFGSNPQYLISNIIRSKIYE..S.PYWKEKCFALTS................................-ESIIDQAVN-..LKYVGG..............-TYG.GNR.............................................KP.TRFLCLVLKL.LQIQPDKD..........IIY.EYIK...............................................NEEFI..YLRALGIF....Y...L.....RLIGK........................SLEI....YR.YLE.....PI..LFDYR.KMRIRLQNG..............-----....TFEKIYMDVFVD.NCL.......VMNNF...LD..V..DFPSLTKRQVLEDN-n....................................................................
A0A0D9XBE9_9ORYZ/10-175              ...............................................KSIHGTNPQNLVEKIVRSKIYQ..S.TYWKEQCFGLTA................................-ETLVDKAME-..LDHTGG..............-TYG.GNR.............................................KP.TPFLCLTLKM.LQIQPDKD..........IVV.EFIK...............................................NEDYK..YVRVLGAF....Y...L.....RLTGT........................VADV....YQ.YLE.....PL..YNDYR.KIRHKLSDG..............-----....KFTLTHVDEFID.DLL.......TKDYC...CD..T..ALPRIQKRWVLEA--sg...................................................................
W4ZSU7_WHEAT/50-203                  ............................................gri----GANPQMLVENTVRSGIYR..S.SYWRERCFGLTA................................-ETLVGRAVE-..LDHVGG..............-TFG.RNG.............................................-P.TPFLCLALKM.LQMQPDRE..........TVV.GFIS...............................................NEEHR..YLRALGAF....Y...L.....RLTGT........................GADV....RR.YLE.....PL..SNDHR.EIRERISDE..............-----....EFTLTDVGYFID.KLL.......TQDSC...CD..T..ALPRI----------.....................................................................
H2ZEL4_CIOSA/4-188                   .............................................lt--CWGNPRTMNLNHLVLTNVQN..S.PYFKVRLFELKT................................YHEVVDEIYYK..VDHLEP..............WERG.TRKtagqtgmcg...........................gvrgvgaggVV.STSFCILFKL.FTLKLTRK..........QVN.GLLN...............................................HTDSP..FIRGLGVM....Y...I.....RYTQA........................PKDL....WN.WYE.....PY..LEDEE.---------..............EIDVKa..gGGCVMTIGMMIR.TVL.......TKLDW...FS..T..LFPRIPVPIQKEID-e....................................................................
F0YB92_AURAN/58-222                  .............................................fd--LHGNPDTFNLHPMLHEKIDE..S.EYYK-CLFVFKT................................FDKVVDVIYEK..VTYVEP..............WAAG.STR.............................................SP.SSAYCLLLKL.FHLRLTEI..........QVK.ALLD...............................................HGDSP..YIRALGAL....Y...V.....RYGCA........................PERT....WH.WLG.....HY..ADDLE.---------..............EFAPGl..nPNQTTTFGAYCV.KLM.......TDLQY...FS..T..MLPRIPVAIE-----rrlk.................................................................
I4Y8C3_WALMC/10-173                  ..............................................s-SVHGRNPQHLIENVIRQRIYE..S.AYWKEQCFALTA................................-ETIIDKAVE-..MQSIGG..............-VYG.NLR.............................................-P.LPFICLLLKL.LQLQPEPE..........IIL.EYLQ...............................................AVEFK..YLRALAAM....Y...T.....RLCFN........................SYQV....FD.ILE.....PL..LQDYR.KLRLRNNSG..............-----....-YHITHMDEFVD.ELL.......TEERV...CD..I..ILPRLTKRDVLEQ--vh...................................................................
D3BAL0_POLPA/67-160                  ...............................................KTVHGKNPTSLVEKIVRIKIQS..H.PYWKEKCMGLNE................................-STLVDRAMS-..LNSFGG..............-TFG.GNK.............................................QP.THFLCLMLKM.LQIQPSMD..........IVV.EFIT...............................................NEDFK..YLE-----....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------ply..................................................................
Q4UCH1_THEAN/10-175                  .............................................hl--IHGTNPQFLFSKILRDKVYN..S.FYWKESCFGLTA................................-ESLIDKAVQ-..IKYVGG..............-TFG.GNR.............................................QP.SPFICLVLKM.LQIQPEME..........IVH.EYIK...............................................NEDYK..YLRALGIY....Y...M.....RLVGT........................AVEV....YR.TLE.....PF..LADYR.KLRFRNIDG..............-----....SYVIKYMDEFVD.DCL.......TNSTY...LD..V..DLPPLSKRMNLEA--tk...................................................................
M0X6G7_HORVD/3-166                   ............................................iqt---SGKPIDMLMEKVLCMNILS..S.DYFK-ELYRMKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKIL....WT.WYE.....PY..LKDDE.---------..............EFSPG...sNGRMTTMGVFVR.DLI.......LGQYY...FD..S..ILPRVPVPVV-----rqvt.................................................................
B4F7Y9_MAIZE/3-166                   ...........................................iqss----GRSIEGLMEKVLSVNILS..S.DYFK-ELFKYKT................................YHEVVDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.SSAFCLLYKL.FTMKLTVK..........QMH.GLLK...............................................HQDSP..YIRAIGFL....Y...L.....RYVAE........................PKTL....WT.WYE.....PY..IKDDE.---------..............EFAPG...sNRKVTTMGVYVR.DLL.......LGQYY...FD..S..LLPRVPLPI------lrqvt................................................................
I3JLV3_ORENI/10-175                  ..............................................n-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LKFVGG..............-VFG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRLLGAM....Y...M.....RLTGT........................AVDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFEVMHVDEFID.GLL.......QSERM...CD..V..ILPRLQKRQVLEEA-e....................................................................
V4AYJ2_LOTGI/4-188                   ..............................................l-AVWGNEKTMNLNNLILTNIQS..S.PYFKINLFNLKT................................YHEVIDEIYYK..VSHLEP..............WEKG.SRKtagqtgmcg...........................gvrgvgaggIV.SSAYCLLYKL.YTLKLTRK..........QLN.GLLT...............................................HSDSP..YIRGLGFM....Y...I.....RYTQP........................PADL....WE.WYE.....PY..FDDDE.---------..............EVDVKa..gGGHVMLIGEMIR.QWL.......VKLEW...YS..T..LFPRIPVPIQKDI--ds...................................................................
G0PED8_CAEBE/1-148                   ...............................................----------------------..-.------------................................--TLVEQIFYQ..VKHLEP..............WEKG.TRRlqgmtgmcg...........................gvrgvgaggVV.SSAYCLLFRL.FNLRISRK..........QLI.SMLN...............................................SRQSV..YIRGIGFM....Y...I.....RYTQP........................PADL....WY.WLE.....PY..LDDDS.---------..............EIDPRs..gGGDLMSFGQMVR.TMI.......NKLDW...YG..T..LFPRIPVPIQKEID-e....................................................................
M3D6M0_SPHMS/19-186                  .............................................tl--IRGDNPLKLFEKAVRDRIID..S.YYWKEQCFGLNA................................-ATLLDRAVE-..LSFIGG..............-TYG.AAQ.............................................KP.TPFLCLAFKL.LQLTPERE..........IIT.FYLEk.............................................aGDEFK..YLRALAAF....Y...I.....RLAWE.......................kDEEV....YT.TLE.....PF..LADGR.KLKRRVREG..............-----....-WALTHMDEFID.DLL.......TKTRV...CA..T..TLPKINTRLHLEDA-d....................................................................
U6MUF7_9EIME/120-282                 ............................................vqm----TDSTTYNVNQLLRGNIMS..S.EYFK-SLHQFKS................................FNEVVDELAAF..ADHAEP..............YCSG.STR.............................................AP.STLFCCLYKL.FTLKLTEK..........QMH.MLLN...............................................HRESP..YVRCTGFL....Y...L.....RYVHP........................PDQL....WK.WYE.....PY..FLDDE.---------..............QFTPGa..dPNRVISMGEYVQ.SLL.......TEDKY...FS..T..VLPRLPVLVK-----nvy..................................................................
X6N3G1_RETFI/102-235                 ..........................................lpveh------DTHYNMQQLLAENILS..S.DYFK-SLYRYKT................................YHEVIEEVKNH..CKNLEP..............RMSG.FSR.............................................KP.STAFCILYKF.FTMNLTVR..........QVK.GLLD...............................................DYENP..FVRGIGFL....Y...L.....RYLLN........................AKDL....WK.WFE.....PY..FDDNQ.---------..............-----....------------.---.......-----...--..-..---------------lfqpfdngdsivph.......................................................
A0A0F0ILI8_ASPPA/21-209              ..............................................l--VRGVNPATLFEKAVRDRITD..S.YYWKEQCFGLNA................................-ATLCDRAVE-..LTSIGG..............-TYG.VSE.............................................KP.TPFLCLAFKM.LQLNPDRD..........IVL.EYLNftdpvndeegeq......................tateqaengvvkqQGDFK..YLRALAAF....Y...V.....RLTFD........................AVDV....YK.TLE.....PL..LLDYR.KLKRRVRDS..............-----....-VVLTYVDQFVD.DLL.......TKDRV...CG..T..SLWKLPSRQQLEDL-d....................................................................
G3IJU9_CRIGR/2-120                   .........................................cggvrg----------------------..-.------------................................-----------..------..............--VG.TGG.............................................IV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDST..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....PF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
H3ERC6_PRIPA/1-44                    ...............................................----------------------..-.------------................................-----------..------..............----.---.............................................--.----------.--------..........---.----...............................................-----..-------M....Y...V.....RLTMT........................SVEQ....YK.LLE.....PL..YNDYR.KLRWMNKMG..............-----....------------.---.......-----...--..-..---------------nrrdrrdergg..........................................................
U6J7B2_ECHGR/27-211                  ..............................................l-KLWGNQVTMNINPMIHTNIIQ..S.PYFKTNLIELKT................................YHEVIDEIYYK..VTHLEP..............WERN.SRRmggqtgmcg...........................gvrgvgaggIV.STAYCLLFKL.FTLKLTRK..........QLK.GLLE...............................................HPDSP..YIRALGFM....Y...I.....RYCLP........................PEDL....WM.WFA.....PY..LDDEE.---------..............EIDVRa..gGGCSMTIGAMLG.QWL.......TKLDW...FS..T..LFPRIPVPVQKKID-e....................................................................
M7BW90_CHEMY/1-176                   ...............................................---------MNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
G1NUQ8_MYOLU/10-176                  ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............----V....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
C0NU08_AJECG/21-213                  ..............................................l--IRGVNPATLFEKAVRDRITE..S.YYWKEQCFGLNA................................-ATLCDRAAE-..LSYIGG..............-TYG.LAQ.............................................KP.TPFLCLAFKL.LQLAPEKE..........IVL.EYLNfhdpenghvegsem..................ngleeeqggasvvkaVGDFK..YLRALAAF....Y...I.....RLTFD........................AADI....YK.SLE.....PL..LTDYR.KLKRRMKDG..............-----....-FVLTYIDQFVD.DLL.......TKDRV...CG..T..SLWKLPSRHQLEDL-d....................................................................
B4JL98_DROGR/29-213                  ..............................................l-PLWGNETSMNLNPLILANIQS..S.SYFKVHLFKLKT................................YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.YTLRLTRK..........QVN.GLLN...............................................HTDSA..YIRALGFM....Y...L.....RYTQP........................PGDL....YD.WYE.....DY..LQDEE.---------..............EIDVKa..gGGQVVTIGQMVY.QFM.......TKLDW...FS..T..LFPRIPVPIQKQIE-k....................................................................
A0A0P7UMF5_9TELE/30-214              ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VSHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PADL....WD.WFE.....SF..LDDEE.---------..............ELDVKa..gGGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKAI--dq...................................................................
S8D204_9LAMI/10-175                  ...............................................KSIRGTNPQNLVEKILRSKIYQ..N.TFWKEQCFGLTA................................-ETLVDKAME-..IDHLGG..............-TFG.GNR.............................................KP.TPFMCLVMKM.LQIQPDKE..........IVV.EFIK...............................................NPEYK..YVRALGAF....Y...L.....RLTGT........................DVDV....YR.YLE.....PL..YNDYR.KLRIKANDG..............-----....KFALTHVDEFID.DLL.......TKDYS...CD..I..ALPRIKKRWTLEN--lg...................................................................
A0A0B2V767_TOXCA/10-175              .............................................vt--VKGTNPQYLVEKIIRTRIYD..S.KYWKEECFALTA................................-ELVVDKGME-..LRYVGG..............-IYA.GNV.............................................KP.TPFLCLSLKL.LQIQPEKD..........IIV.EFIR...............................................QEDYK..YIRALGAM....Y...L.....RLTFS........................SIEV....YK.YLE.....PL..YNDYR.KLRYMNKEG..............-----....RFELIYMDEFID.NLL.......RQERY...CD..I..QLPRLQSLTKM----anrt.................................................................
L8GYB7_ACACA/10-175                  ...............................................KTVHGTNPQFLLEKILRNRIYN..N.PYWKGDCFGLTA................................-EGLAEKAME-..LKNFGG..............-TYG.GNR.............................................KP.THFMCLVLKM.LQIQPERE..........IVH.EFIK...............................................NEEHR..YVRMLGAF....Y...L.....RLVGK........................PQEI....YN.LLE.....PL..YVDWR.KVRKKVESG..............-----....GSQITHVDEFID.ELL.......HANYS...CD..V..VLPFLPKRYTLEQQ-e....................................................................
F4X868_ACREC/10-175                  ...............................................KSIRGTNPQYLIEKIIRSRIYD..S.KYWKEECFALTA................................-ELLVDKAME-..LRFLGG..............-VYG.GNV.............................................KP.TPFLCLILKM.LQIQPEKD..........IIV.EFIK...............................................NEEFK..YVRALGAL....Y...M.....RLTGS........................SLDC....YK.YLE.....PL..FNDNR.KLRIQNKQG..............-----....VFELVHMDEFID.NLL.......RDERC...CD..V..ILPRIQKRHVLEEN-n....................................................................
A0A0A1NVB9_9FUNG/9-173               ..............................................l-ETWGNETTMNMNAIIYQNILS..S.PYFR-SLYEKKT................................FHEIVDEIYNE..VTVLTP..............FIKG.-N-.............................................QP.STAFCLLFKL.WTIRLTIR..........QIE.NLVE...............................................HGDSP..YIRAIGFL....Y...L.....RYVCA........................PAKL....WD.WFQ.....YY..LEDDE.EIAI-----..............----Ss.glHPTKVTVGNLIR.MLI.......TELKF...QG..T..MLPRIPIPIAR----dlek.................................................................
A9RTY4_PHYPA/10-175                  ..............................................r-SVHGTNPQNLVEKILRSKIYQ..N.TYWKEQCFGLTA................................-ETLVDKAME-..LDHFGG..............-TYG.GNR.............................................KA.TPFMCLTLKM.LQIQPEKE..........IVV.EFIK...............................................NEDYK..YVRILGAF....Y...L.....RLVGK........................PTDV....YQ.YLE.....PL..YNDYR.KLRRRTSEG..............-----....GYILARVDEFID.ELL.......TTEYS...CD..I..ALPRVPKRWTLET--tg...................................................................
A0A0A8L5Y3_9SACH/14-213              ..............................................k-RLNHQSASLVVPQIFRNKVSS..C.MYYKVNLTAASLrg............................dtIVQLIPVIVRD..LGTLNDrkr........phlTVLG.GVE.............................................--.--FKCLLMKL.INLRPPWE..........QLK.VLLEp............................................hePFNNK..YVAALILT....Y...L.....RVSYYfltetn...........pseqdisFSLL....HG.LMK.....TY..IRDHR.KLKGYPLNIdc..........wsSSV-K...kEIKLIHFDELID.WLC.......EKNEI...WG..I..PLGKCNWCKIWE---dee..................................................................
Q2H4I5_CHAGB/24-112                  ............................................lap---NGLNPATIMEKAVRERIVD..S.YFYKEQCFGVNE................................-ADIVDRVVEH..VDHIGG..............-VAG.IVQ.............................................KP.TPFLCLAFKL.LQLAPADD..........ILD.EY--...............................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------prlwrre..............................................................
Q9VYE9_DROME/24-208                  ..............................................l-PFWGNESSMNLNALILANIQS..S.SYFKVHLFKLKT................................YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.YTLRLTRK..........QIN.GLLN...............................................HTDSA..YIRALGFM....Y...L.....RYTQP........................PGDL....YD.WYE.....DY..LQDEE.---------..............EIDVKa..gGGQVLTIGQMVY.QFM.......TKLDW...FS..T..LFPRIPVPIQKQIE-k....................................................................
A0A077ZK60_TRITR/10-192              ..............................................s-TVKGTNPQYLIEKVVRSRIYD..S.RYWKEECFALSA................................-ELLVDKGME-..LRFVGG..............-VFG.GNV.............................................KP.SPFLCLQLKM.LQIQPDKE..........IVI.EFIR...............................................QEDSK..YIRALGAM....Y...L.....RLTFS........................SIEV....YQ.YLE.....PL..LNDYR.KLRWMSKQGsqlrff..tatkhaQL--El..iEFELMHMDEFVD.RLL.......REERF...CD..I..QLPRLQKRDVLEE--tg...................................................................
A0A0D2VQS3_CAPO3/6-173               ..............................................l-ELWGNQQTMNLNLLLHQNILS..A.RYYKEDLSELNT................................YQELIDEIFNS..VSDLEP..............FMPG.GGT.............................................KA.SSAFCLLYKL.FVLRLTEN..........QLT.AMLN...............................................HADSP..FIRAIGFL....Y...L.....RYCTP........................PKDL....WD.WFE.....PY..LEDQE.PIKLQWAAS..............-----....-AQPTTIGEFVR.GLL.......VDSKF...LG..T..LLPRIPVPITKEIQ-a....................................................................
M7BDA2_CHEMY/30-111                  ..............................................y----------------------..-.------------................................-----------..------..............----.---.............................................--.----------.--------..........---.----...............................................--ESK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
D8QIS6_SCHCM/10-173                  ...............................................KQIHGQNPQFLVETVIRNRIWE..S.SYWKEHCFALTA................................-ESLIDKAIS-..LRAIGG..............-VYG.NQR.............................................-P.TEFLCLLLKL.LQIQPEKE..........ILV.EYLQ...............................................ADEFK..YLRALAAM....Y...I.....RMTFR........................AVDV....YE.LLE.....PL..LKDYR.KIRYRDMGG..............-----....-YRLTFIDEFVD.SLL.......TEERV...CD..I..ILPRLQKREILEEN-g....................................................................
U6LVE5_9EIME/1-146                   ...............................................---------------------E..S.FFWKNDCFAATA................................-ESLVEIAIKN..LFYVGG..............-TFG.GIR.............................................TP.APFLCLVLKL.LQLQPDKM..........IVL.EYIK...............................................QEDFK..YLRAVGAF....Y...F.....RLVAP........................SDEV....YV.HLE.....PL..LTDYR.KLRLRKNDG..............-----....TFILTYMDVFID.DCL.......RKHNL...FD..V..DLPPLTKRNV-----fvqqn................................................................
A0A094HRM8_9PEZI/22-189              ............................................lap---NGLNPATIFEKPVRERIID..C.YFWKDQCFALNE................................-ADIVSRVVEH..VHFISG..............-TYG.DSQ.............................................RP.SPFLCLAFKL.LQLGPGDD..........ILK.EYLGy.............................................gGERFK..YLRALACF....Y...V.....RLTRP........................AKEV....YE.TLE.....PF..LEDGR.KLRRRGRQG..............-----....-TSLTFVDQFVD.ELL.......TKERI...CA..T..SLWKMPKREVLEDL-e....................................................................
A0A0M3K6D9_ANISI/10-174              .............................................vt--VKGTNPQYLVEKIIRTRIYD..S.KYWKEECFALTA................................-ELIVDKGME-..LRYVGG..............-IYA.GNV.............................................KP.TPFLCLSLKL.LQIQPEKD..........IIV.EFIR...............................................QEDYK..YIRALGAM....Y...L.....RLTFS........................SIEV....YK.YLE.....PL..YNDYR.KLRYMNKEG..............-----....RFELIYMDEFVD.NLL.......REERY...CD..I..QLPRLQGRQALE---qi...................................................................
N4U2P3_FUSC1/26-192                  .............................................ap---NGLNPATIMEKAVKDRIVD..S.YFYKEQCFALNE................................-ADIVDRVVEH..VNFIGG..............-TYG.VTQ.............................................KP.SPFLCLAFKL.LELSPSDA..........VLM.EYLKy.............................................gGEAFK..YLRALACF....Y...F.....RLTRQ........................AKDV....YE.MLE.....PF..LEDRR.KLRRRGRAG..............-----....-VVLTFMDEFVD.ELL.......TKERV...CG..T..SLWKMPKREVLEDL-e....................................................................
E7Q418_YEASB/15-219                  ...............................................KQLNNQSVSLVIPRLTRDKIHN..S.MYYKVNLSNESLrg............................ntMVELLKVMIGA..FGTIKGqng.......hlhmMVLG.GIE.............................................--.--FKCILMKL.IEIRPNFQ..........QLN.FLLNvk..........................................nenGFDSK..YIIALLLV....Y...A.....RLQYYylngn.............nkndddENDL....IK.LFKvq.lyKY..SQHYF.KLKSFPLQVdc..........faHSYNE....ELCIIHIDELVD.WLA.......TQDHI...WG..I..PLGKCQWNK------iynsde...............................................................
N1PRZ9_DOTSN/19-186                  ..............................................k-LIRGDNPLKLFEKPVRDRIVD..S.YYWKEQCFGLNA................................-ATLLDRAME-..LSFIGG..............-TYG.IAQ.............................................RP.TAFLCLAFKL.LQLTPEKD..........IIL.FYLQq.............................................aGEEFK..YLRALAAF....Y...I.....RLAWE.......................kDEEV....YT.TLE.....LY..MSDGR.KLKRRTRES..............-----....-FGLIHIDEFID.DLL.......LKTRV...CA..T..TLPKINPRTFLEDE-d....................................................................
Q4CZI2_TRYCC/9-176                   .............................................wn--LKGRSAVAALDPSTRHRIMQ..S.HAMASSFHKPLL................................-ATLEVLITP-..-QYVGG..............-LTG.PLQ.............................................KP.EPFICHVTRL.LQITPDPS..........IVL.AMLH...............................................QDVHK..YLRVAALF....I...I.....RLIGN........................EAMM....RE.AMR.....VG..WEDYR.KIRVYGYVE..............-----....------------.---.......-----...--..-..---------------dlegtidskennapdeeegfvrapaygimcvdeitdrlfnv............................
B4KQL3_DROMO/10-175                  ...............................................KNVHGTNPQYLIEKIIRSRIYD..S.KYWKEQCFALTA................................-ELLVDKAME-..LRFIGG..............-VYG.GNI.............................................KP.TQFLCLTLKM.LQIQPEKD..........IVV.EFIK...............................................NEEFK..YVRALGAF....Y...L.....RLTGA........................AIDC....YK.YLE.....PL..YIDNR.KLRRQNRAG..............-----....QFEIVYMDEYID.ELL.......RNDRV...CD..I..ILPRIQKRSILEEN-n....................................................................
G1PFY0_MYOLU/28-212                  ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
G0QNU7_ICHMG/10-175                  ..............................................n-SIRGQNPQSLIEAVIRQKIYQ..N.RYWKESLTGLTA................................-ESIIDEAIK-..LQYIAG..............-TYG.GSR.............................................KP.SKFLMLSLKL.LQISPSKE..........IVI.EYIR...............................................QEEYK..YLTALGCF....H...L.....RLVGQ........................PEHV....YN.YLE.....PL..YQDYR.KLRFRNLNG..............-----....SFCIFYMDEFVE.SLI.......NQEVY...ID..T..LLPHIIKRHILEE--tg...................................................................
D8LWJ8_BLAHO/10-174                  ..............................................d-KVRGQNPQNVIEKITRMKIYD..C.DYWKERCFGLSA................................-VTILDRMIE-..LDHIGG..............-AYS.GVF.............................................RP.TPFICLVLKL.LQIGPDKE..........IVY.SFID...............................................NDDYK..YITAVGLF....Y...L.....RLVGT........................SLEI....YK.HLE.....PY..YNDYR.KLRLLTPTG..............-----....-WSIIHMDEFVE.MLL.......EDEIA...LD..I..SLPHLDKRHVLEA--rg...................................................................
C5MCZ6_CANTT/17-194                  ............................................dkr---YTQNKGNLIEPIIRHRIQD..S.IFYKQHLYLTNE................................-STILPVIIDH..VKYISG..............--TD.SSN.............................................RP.SNFICCLFRL.LELEPTKE..........IIN.VYLTq............................................lnFNEFK..YLTALTLI....Y...I.....RLVFK........................NEDI....YT.IFD.....SY..FKDFR.KIRMKLKNPif..........dsNQIPK....NYKISYIDEWVD.DLL.......TKDRV...ID..L..ILPRLVPRLTLV---qrg..................................................................
A0A072NZS4_9EURO/19-185              .............................................pl--IRGQNPALLLETAMRDRITD..S.LYWKEQCFGLNA................................-ATLCDRAVE-..LTYIGG..............-TYG.VAM.............................................KP.SPFICLAFKL.LTLVPDKE..........IIL.EYLNt.............................................gGEEWK..YLRALAAF....Y...A.....RLTFD........................PVDI....YK.TLE.....PF..LEDSR.KLRQRRKES..............-----....-YVLIHMDEFVD.NLL.......TKDRV...CG..T..TLWKLSARQLLEDL-d....................................................................
A0A090N2S3_OSTTA/10-175              ..............................................k-SVRGTDPQNLMERITRDKVYA..M.TYWKEKCFGVSA................................-EALVDLAVD-..LRSVGG..............-IYG.GNN.............................................RA.TEFLCLTLKL.LQIQPEKE..........IVL.EFIK...............................................NEDHK..YVRLLGAF....Y...L.....RLVGK........................PTDV....YR.YLE.....PL..LNDYR.KVRYRTRDG..............-----....KYALTHVDEFVN.NLL.......TKDMF...CD..V..TLPRVPHRQVLEA--ag...................................................................
M5W7Z5_PRUPE/24-176                  ..............................................i----------------------..-.----EQCFGLTA................................-ETLVDKAME-..LDHIGG..............-TFG.GNR.............................................KP.TPFMCHVMKM.LQIQPAKE..........IVI.EFIKnddyni..................................fpkvniyYVHFK..YVWILGAF....Y...L.....RLTGT........................ETDV....YQ.YLE.....PL..YNDYR.KLRRNLADG..............-----....NYALTHVDEVID.ELL.......TKDYS...CD..I..AMPRIKKRWTLEA--tg...................................................................
W7TQL1_9STRA/10-174                  ..............................................t-TVHGTNPQFLIEKILRQKIYN..S.LYWKEHCFGLTA................................-ETLVDKAVG-..LKAYGG..............-QYG.GMQ.............................................KP.TKFMCLVLKM.LQLQPEKE..........IVV.EFIK...............................................NEDYK..YLRVLGAF....Y...L.....RLVGK........................PLDI....YQ.YLE.....PL..YNDYR.KLRFRGVAG..............-----....-WALKHMDEFIE.ELL.......TSDYC...CD..V..ALPHLPKRHLLEDQ-k....................................................................
A4I1H4_LEIIN/271-441                 .fdaelwgvleskltdelveqvrrsgaapnggrlftafeqheqnvka----------------------..-.------------................................---VLRYCEQN..VRYAGV..............--FD.DNE.............................................EA.SPFLLAMGLC.WRLGLTMD..........DVC.RHFA...............................................RHPRR..VVRALALY....L...A.....RYTLA........................PEDY....VY.FFI.....PS..LCDEV.IIACTEDAQ..............-----....--VTFSMKDLSR.QLL.......TKNDV...VD..A..WLPILSKHWQ-----edv..................................................................
I6ND91_ERECY/14-229                  ...............................................KQLNHQSTSLVIPKITRLRIHN..S.MYYKVNLHPASLrg............................etMKHVSKVMIRE..LGTCKNr............sTVSG.TAC.............................................GT.VEFQCLLMKM.VEIRPTWS..........QLH.LMLQlddc......................................sekagPFNNK..YIVVLILV....Y...L.....RIQYYylvnkgteeik.plsnldttgdidAGKI....KT.LFA.....HF..LRDCR.KIKSINLHDdp..........wsTSIQK....RVDIYHIDEIVD.WLC.......TNDSI...WG..V..PLGKCPWLIEI----leae.................................................................
W4XFI6_STRPU/10-175                  ..............................................r-SIKGKNPQYLVEKITRSRIYE..S.RYWKEECFALSA................................-ELLVDKAME-..LRFIGG..............-TYG.GNI.............................................KP.SPFLCLLLKM.LQIQPEKD..........IVI.EFIK...............................................NEDFK..YVRCLGAL....Y...I.....RLVGE........................GLDV....YK.YLE.....PL..YNDYR.KIRRQDKIG..............-----....GYFLSHVDEFID.ELL.......NEERV...CD..I..ILPRVQKRHILEET-e....................................................................
R1CRP3_EMIHU/49-231                  ..........................................dpvhg------APAFNINPMLLEGIRM..GdRFWE--LAKLTT................................FGEVVDAIFYE..VKYVTP..............WVPG.THGkrssgmqs............................avrgvsnagTP.GIAYTMLLKL.FLLRLTRD..........QVR.SLLR...............................................HPDSP..YIRAIGFL....Y...L.....RLGLY.......................dFKEL....WA.WFQ.....PY..LGDDD.-------QF..............FIDGT....PATATTIGEFVR.RLM.......TDQDF...FG..D..RLPRLPVLVSRQI--ed...................................................................
C5DED7_LACTC/14-227                  ...............................................KQLNHQSTSLVIPQLARTRIHN..S.MYYKINLDPASLrg............................dtMVQLSKTMMRD..FGTCRDnar........rmaLVCG.GVE.............................................--.--FKCLLMKL.VHLRPQWG..........QIV.TILQkgn........................................erssKFDNK..YLVVLVLV....Y...L.....RIQYYflpdtsdeekvtgvlnlnkrgsvsSGTL....RG.LFR.....IY..LSDYR.KVKSINLETdy..........wyNSASK....VPKTLHIDEVVD.WLC.......TQDQI...WG..I..PLGRCQW-CNI----fket.................................................................
B8MD54_TALSN/21-183                  ..............................................l--VRGVNPVTLFEKAVRDRITD..S.YYWKEQCFGLNA................................-ATLCDRAIE-..LTSIGG..............TIVL.EYL.............................................NF.TDPGSG----.DEENPEDT..........EIN.GEVVk.............................................gRGDFK..YLRSLAAF....Y...I.....RLTFE........................AAEI....YK.YLE.....PL..LLDYR.KLKRRMREN..............-----....-YVLTTMDQFID.DLL.......TKDRV...CA..T..SLWKLPSRQMLEDL-d....................................................................
A0A0N4T6E4_BRUPA/10-175              .............................................vt--VKGTNPQYLVEKIIRTRIYD..S.KYWKEECFALTA................................-ELLVDKGME-..LRYIGG..............-IYA.GNV.............................................KP.TPFLCLCLKM.LQIQPEKD..........IAV.EFIR...............................................QEEYK..YIRALGAM....Y...I.....RLTFT........................SIEV....YK.YLE.....PL..YNDYR.KLRMMNNEG..............-----....RFEIVHMDEFID.NLL.......RDERY...CD..I..HLPRIQKRITLEE--vg...................................................................
M3XER9_FELCA/48-232                  ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
J9J8A1_9SPIT/306-471                 ..............................................h-QVHGTNPQFLIDKIIRLKIHN..D.PYYKEKCFALTA................................-ETLVDRAIE-..LKYVGG..............-TYG.GVR.............................................RP.SKFLCLILKM.LQIQPDTD..........IIL.EFIK...............................................NEDYK..YIRALGAF....Y...W.....RLTAQ........................GKDV....YK.VLE.....PL..YKDYR.RIAFRKEEG..............-----....RFEVMHIDEYID.HLI.......RDEIF...CE..V..QLPRINKRYVFEE--dg...................................................................
R0F627_9BRAS/1-113                   .............................................mg----------------------..-.------------................................-----------..------..............---G.NCR.............................................GP.SSAYCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HTDSP..YIRAVGFL....Y...L.....RYVAD........................SKTL....WT.WYE.....PY..INDDE.---------..............EFSPG...sNGRMTTMGVYIR.DLL.......LGLYY...FD..T..LFPRIPVPVMRQ---ivs..................................................................
G5AUI5_HETGA/10-175                  ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A084W0J8_ANOSI/10-175              ...............................................KNVHGTNPQYLIEKIIRSRIYD..S.KYWKEQCFALTA................................-ELLVDKAME-..LRFVGG..............-VFG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IVV.EFIK...............................................NEEFK..YVRALGAF....Y...L.....RLTGS........................SLDC....YK.YLE.....PL..YNDNR.KLRKQNRMG..............-----....AYELTHMDEFID.ELL.......REERV...CD..I..ILPRIQKRHVLEEN-n....................................................................
A0A087H484_ARAAL/10-175              ...............................................KNIRGTNPQNLVEKIVRTKIYQ..H.TFWKEQCFGLTA................................-ETLVDKAME-..LDHVGG..............-TFG.GNR.............................................KP.TPFLCLILKM.LQIQPEKD..........IVV.EFIK...............................................NDDYK..YVRILGAF....Y...L.....RLTGS........................DIDV....YR.YLE.....PL..YNDYR.KVRQKLSDG..............-----....RFSLTHVDEVIE.ELL.......TKDYS...CD..I..AMPRLKKRWTLEQN-a....................................................................
E9DBR1_COCPS/21-209                  ..............................................l--VRGVNPATLFEKAVRDRITD..S.YYWKEQCFGLNA................................-ATLCDRAVE-..LGYIGG..............-TYG.ANQ.............................................KP.TPFLCLAFKL.LQLAPERE..........VVL.EYLNfhdpaeddddng......................deddgdgaavlksVGDFK..YLRALAAF....Y...I.....RLTFE........................PVEV....YN.VLE.....PL..LSDYR.KLKRRTKDG..............-----....-FVLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKLPARRILEDL-d....................................................................
A0A090M5Y6_OSTTA/20-189              ...........................................aats------GKSHGVEEVLRQNIAH..S.EYFR-KLRRADDlgr.........................paydFMALVDEIYEL..VDHCEP..............WMCG.NAR.............................................GA.STGFCILFQF.CEMELSDG..........NVW.HLLR...............................................HGDSP..FIRALGFL....Y...V.....RYVKN........................GREL....LK.WCE.....EF..FGDEE.---------..............KFKPS...pDGKEVTMGAFVR.DLL.......LEQRY...FE..T..ILPRIPEVARRE---ive..................................................................
A8NG64_COPC7/10-173                  ..............................................k-AIHGQNPQFLVETVIRNRIYD..S.SYWKEHCFALTA................................-ESIIDKAIE-..VKYIGG..............-VYG.NQR.............................................-P.TEFVCLLLKL.LQIQPEKE..........ILI.EYLR...............................................ADEFK..YLRALAAL....Y...I.....RMTFR........................PVEV....YE.LLE.....PL..LKDYR.KLRQRTMTG..............-----....-YTLTFIDEFVY.ALL.......TEERV...ID..L..ILPRLPKREILEEN-g....................................................................
B4J994_DROGR/10-175                  ...............................................KNVHGTNPQYLIEKIIRSRIYD..S.KYWKEQCFALTA................................-ELLVDKAME-..LRFVGG..............-VYG.GNI.............................................RP.TQFLCLTLKM.LQIQPEKD..........IVV.EFIK...............................................NEEFK..YVRALGAF....Y...L.....RLTGA........................AIDC....YK.YLE.....PL..YIDNR.KLRRQNRAG..............-----....QFEIVYMDEYID.ELL.......RNDRV...CD..I..ILPRIQKRAILEEN-n....................................................................
F1Q7F0_DANRE/25-209                  ..............................................l-PLWGNEKTMNLNPMILTNVLS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VNHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HSDSP..YIRALGFM....Y...I.....RYTQP........................PPDL....VD.WYD.....EF..LDDEE.---------..............ELDVKa..gGGCVMTVGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKAI--dq...................................................................
G6CYI7_DANPL/22-206                  ..............................................l-PIWGNEQTMNLNPLILANIQG..S.SYFKVHLFKLKT................................YHEVVDEIYYQ..VKHLEP..............WERG.SRKtagqtgmcg...........................gvrgvgaggIV.STAFCLLYKL.YTLRLTRK..........QVN.GLLQ...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PADL....FD.WYV.....DY..LDDEE.---------..............EVDPRa..gGGGSTTIGALVR.QML.......IKLDW...FS..T..LFPRIPVPIQKQIE-q....................................................................
S2JQG7_MUCC1/11-174                  ..............................................a-SIHGRHPLHLIEKIIRERIQN..S.LYWKEKCYGLSA................................-ATLMDRAFE-..LEYIGG..............-MYG.NHQ.............................................-P.TEFLCLTLKL.LTLLPEKD..........III.ELIK...............................................QEDVK..YLRALGAF....Y...L.....RLTGK........................SKEI....YQ.YLE.....PL..LNDYR.KLRVRAGDG..............-----....-YSLTHMDSFID.DLL.......HKDRV...CD..I..ILPRLTSRYVLEQN-d....................................................................
A0A067LVA7_9HOMO/10-173              ..............................................l-SIHGTNPQFLIEKVIRSRIYE..S.PFWKEHCFALTA................................-ESLIDKAIE-..LNSIGG..............-VYG.N-Q.............................................KP.TQFMCLLLKL.LQIQPEKE..........ILV.EYLQ...............................................AEEFK..YLRALAAM....Y...I.....RMTFR........................AVEV....FQ.LLE.....PL..LTDFR.KLRERSMAG..............-----....-YTLTYMDEFVY.ALL.......TEERV...CD..T..ILPRITKREVLEET-e....................................................................
A0A0G2H3B7_9PEZI/20-207              .............................................al--IRGQNPALLFEKAVRDRITE..S.YYWKEQCFGLNA................................-ATLCDRAAE-..LTFVGG..............-TYG.GLG.............................................KP.TPFLCLAFKL.LQLVPEKE..........IIL.AYLNwpgdeeegmeg........................dededesrapgvKGEFK..YLRALAAF....Y...I.....RLAWE........................PPEI....YK.TLE.....PL..LADYR.KLKRRMRDG..............-----....-FTLTYVDQFVD.DLL.......TKDRV...CA..T..SLWKMPSRTLLEDL-d....................................................................
A0A0E0PI94_ORYRU/3-166               ............................................iqt---SGKPIDLLMEKVLCMNIMS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKIL....WT.WYE.....PY..LKDDE.---------..............EFSPG...sNGRMTTMGVYVR.DLI.......LGQYY...FD..S..LLPRVPLP-------vfrqvt...............................................................
W4FS00_9STRA/9-173                   .............................................fs--VHGVNPQHLVEKILRNRIYD..S.MYWKEQCFGLTA................................-ETLVDKAIE-..LTHIGG..............-HFG.GNQ.............................................QP.TPFLCLLLKM.LQIQPDME..........IVV.EFIK...............................................NGDYK..YVTMLGAF....Y...L.....RLVGK........................PTDV....YP.ILE.....EL..LADYR.KIRKRNTLG..............-----....-WEMLHVDEVAD.ILL.......KEEYF...CD..I..ALPHLVDRYQLEA--sn...................................................................
G5A621_PHYSP/9-173                   ..............................................q-SVHGVNPQTLVEKIMRNRVYA..S.VYWKEQCFGLTA................................-ETLVDKAVE-..LTEFGG..............-TFG.GNQ.............................................QP.THFLCLLLKM.LQLQPELE..........VVR.QFIE...............................................NDDYK..YVTVLGAV....Y...L.....RLVGK........................PREV....YE.LLE.....PL..LSDYR.KIRKRNVIG..............-----....-WEITHVDEIAD.ALL.......NEEYY...VD..L..ALPRLVDRELLER--ne...................................................................
T1JA16_STRMM/13-197                  ..............................................l-PLWGNDKSMNLNSLILTNIQS..S.HYFKVNLFDLKT................................YHEVIDEIYYK..VTHLEP..............WEKG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAFCLLYKL.FTLKLTRK..........QVN.GLIT...............................................HCDSA..YIRALGFM....Y...I.....RYTQP........................PQDL....WD.WFE.....SY..LDDDE.---------..............ELDVKa..gGGCMMSIGEMLR.HYL.......TKLEW...YS..T..LFPRIPVPIQKEIE-k....................................................................
A0A094I083_9PEZI/22-189              ............................................lap---NGLNPATIFEKPVRERIID..C.YFWKDQCFALNE................................-ADIVSRVVEH..VHFISG..............-TYG.DSQ.............................................RP.SPFLCLAFKL.LQLGPGDD..........ILK.EYLGy.............................................gGERFK..YLRALACF....Y...V.....RLTRP........................AKEV....YE.TLE.....PF..LEDGR.KLRRRGRQG..............-----....-TSLTFVDQFVD.ELL.......TKERI...CA..T..SLWKMPKREVLEDL-e....................................................................
S2JJG8_MUCC1/10-170                  ..............................................l-ETWGNETTMNLNAIIYQNILS..S.PYFR-SLYNKKT................................FHEIVDEIYNE..APFVKG..............----.-T-.............................................QP.STAYCCLFKM.WTLRLTIK..........QIE.NMID...............................................HVDSP..YIRAIGFL....Y...L.....RYVCA........................PAQL....WD.WFQ.....YY..LEDEE.EITI-----..............----Ss.gvNPTKITIGKLCR.MLI.......TEQKF...QN..T..MLPRIPVPIAR----dlek.................................................................
G9N2S0_HYPVG/26-193                  ............................................lap---NGLNPATIMEKAVKDRIVD..S.YFYKEQCFALNE................................-ADIIDRVVEH..VNFIGG..............-THG.ASQ.............................................KP.SPFLCLAFKL.LELAPSDA..........ILD.EYLSy.............................................gGEHFK..YLRALACF....Y...V.....RLTRQ........................PKDV....YQ.TLE.....PF..LEDRR.KLRRKARTG..............-----....-TSLTYVDEFVD.DLL.......TKDRV...CA..T..SLWKMPKRETLEDL-e....................................................................
G9NT24_HYPAI/26-193                  ............................................lap---NGLNPATIMEKAVKDRIVD..S.YFYKEQCFALNE................................-ADIIDRVVEH..VSFIGG..............-THG.ASQ.............................................KP.SPFLCLAFKL.LQLAPSDA..........IIQ.EYLSy.............................................gGEHFK..YLRALACF....Y...V.....RMTRQ........................AKDV....YT.TLE.....PF..LEDRR.KLRRKARAG..............-----....-TSLTFVDEFVD.DLL.......NKDRV...CA..T..SLWKMPKREVLEDL-e....................................................................
M9PHQ4_DROME/24-177                  ..............................................l-PFWGNESSMNLNALILANIQS..S.SYFKVHLFKLKT................................YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.YTLRLTRK..........QIN.GLLN...............................................HTDSA..YIRALGFM....Y...L.....RYTQP........................PGDL....YD.WYE.....DY..LQDEE.EIDVK----..............-----....------------.---.......-----...--..-..---------------agggqvsql............................................................
M2S990_COCSN/23-231                  .............................................al--IRGQNPALLFEKGVRERITE..S.YYWKEQCFGLNA................................-ATLCDRAAE-..LKFIGG..............-TTG.ITG.............................................KP.TPFLCLAFKM.LQLVPDKE..........IVL.EYLNfrddeddeddkddkaevkreng...dtaadddddsakkeldlnaagkLGCFK..YLRCLAAF....Y...I.....RLAWE........................PVEI....YK.TLE.....PL..LTDYR.KIKRRLKDT..............-----....-FTLTHVDQFID.DLL.......TKDRI...CA..T..SLWKLPSRAILEDL-d....................................................................
M5XBU6_PRUPE/4-166                   ........................................qtcgkpi--------DSLLEKVLCMNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HEDSP..YIRAVGFL....Y...L.....RYAAD........................PKTL....WN.WVE.....PY..IKDEE.---------..............EFSPG...sNGRTTTMGVYVR.DLL.......LGQYY...FD..T..LFPRIPVPVL-----rqiv.................................................................
W7MMC8_GIBM7/26-192                  .............................................ap---NGLNPATIMEKAVKDRIVD..S.YFYKEQCFALNE................................-ADIVDRVVEH..VNFIGG..............-TYG.VTQ.............................................KP.SPFLCLAFKL.LELSPSDA..........VLM.EYLKy.............................................gGEAFK..YLRALACF....Y...F.....RLTRQ........................AKDV....YQ.MLE.....PF..LEDRR.KLRRRGRAG..............-----....-VVLTFMDEFVD.ELL.......TKERV...CG..T..SLWKMPKREVLEDL-e....................................................................
G2WYK7_VERDV/26-193                  ............................................lap---NGENPAKIMEKAVIGRIVD..A.QYFQYQCFALNE................................-AGIVDRVVND..VKFIGG..............-TYG.SAQ.............................................KP.TPFLCLAFKL.LQLAPSDD..........VLE.TYLSf.............................................gGDKFK..YLRALACF....Y...I.....RMTRR........................ARDV....YA.ILE.....RY..LVDRR.KLRRKGRQG..............-----....-TSLTFVDEFVD.DLL.......TKTRV...CA..T..SFRELPRRTDLVD--lg...................................................................
Q8RWB1_ARATH/4-168                   .............................................iq--SNGRAYESLLEKVLSMNILS..S.DYFK-ELYGLKT................................YHEVIDEIYNQ..VNHVEP..............WMGG.NCR.............................................GP.STAYCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HTDSP..YIRAVGFL....Y...L.....RYVAD........................AKTL....WT.WYE.....PY..IKDDE.---------..............EFSPG...sNGRMTTMGVYVR.DLL.......LGLYY...FD..T..LFPRIPVPVMR----qivs.................................................................
B4R4A9_DROSI/197-381                 ..............................................l-PFWGNESSMNLNALILANIQS..S.SYFKVHLFKLKT................................YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.YTLRLTRK..........QIN.GLLN...............................................HTDSA..YIRALGFM....Y...L.....RYTQP........................PSDL....YD.WYE.....DY..LRDEE.---------..............EIDVKa..gGGQVLTIGQMVY.QFM.......TKLDW...FS..T..LFPRIPVPIQKQIE-k....................................................................
J9HJD8_AEDAE/67-225                  ..............................................n----------------------..-.----VSLFKLKT................................YHEVVDEIYYQ..VKHLEP..............WERG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAFCLLYKL.YTLRLTRK..........QVN.GLLT...............................................HGDSP..YIRALGFM....Y...L.....RFTQP........................PADL....YD.WYE.....PY..LLDEE.---------..............EIDVKa..gGGQTMTIGQMIR.QWL.......TKLDW...FS..T..LFPRIPVPIQKQNE-s....................................................................
Q0U5G5_PHANO/25-223                  .............................................al--IRGQNPALLFEKGVRERITE..S.YYWKEQCFGLNA................................-ATLCDRAAD-..LKFIGG..............-TTG.ITG.............................................KP.TPFLCLAFKM.LQLVPEKA..........IVL.EYLNfggdeeeedeeggvkke.............eeedgdekpqdpnaagkLGQFK..YLRCLAAF....Y...I.....RLAWE........................PVEI....YK.TLE.....PL..LTDYR.KIKRRLKDA..............-----....-FTLTYVDQFID.DLL.......TKDRM...CA..T..SLWKLPSRANLEDL-d....................................................................
A0A067H243_CITSI/1-124               ..............................................m----------------------..-.------------................................----------E..LDHLGG..............-TFG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKD..........IVV.EFIK...............................................NDDYK..YVRVLGAF....Y...L.....RLTGT........................DIDI....YR.YLE.....PL..YNDYR.KLRQKSGDG..............-----....RFILTHVDEVID.ELL.......TKDYS...CD..I..ALPRIKKRWNLET--vg...................................................................
L5LXA6_MYODS/1-171                   ...............................................--------------MILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrevltggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
F8Q691_SERL3/10-173                  ..............................................q-AIHGQNPQFLVETVIRNRIYE..A.TYWKEHCFALTA................................-ETLIDKAIE-..VRFIGG..............-VYG.NQR.............................................-P.TEFLCLLLKL.LQIQPEKE..........ILV.EYLQ...............................................ADEFK..YMRALAAM....Y...I.....RMTFA........................AVDV....YE.MLE.....PL..LKDYR.KLRYRDMAG..............-----....-YSLTFMDEFIY.SLL.......TEERV...CD..I..ILPRIARRQTLEEN-g....................................................................
G8C0B1_TETPH/14-216                  ...............................................KQLNNQSVSLVIPRLTRDKIHN..S.MYYKVNLTDNSLrg............................ntVLQLSKVIVRD..LGTLLNgss........qqlNVIG.GVE.............................................--.--FKCILMKL.VEMRPTWE..........QLL.SLLNidndfn...................................svgtvgEFDNK..YITALVLT....Y...I.....RIQYHfins................dhqlFNKC....KK.LFK.....LY..MNDYR.KLKSIAFGTnc..........wsMSQAI....DVGIGHIDELVE.WLA.......TKNDI...WG..L..PLAMCSW-CNLD---eas..................................................................
A0A067R513_ZOONE/39-223              ..............................................l-PLWGNERTMNLNPMILTNIQS..S.HYFKVNLYELKT................................YHEVIDEIYYK..VTHLEP..............WEKG.SRKtagqtgmcg...........................gvrgvgaggIV.STAFCLLYKL.FTLKLTRK..........QVN.GLLT...............................................HPDSP..YIRGLGFM....Y...I.....RYTQP........................PADL....WD.WYD.....AY..LEDPE.---------..............EMDVKa..gGGQVMTIGEMLR.AFL.......TKLEW...FS..S..LFPRIPVPIQQK---lek..................................................................
C5Z170_SORBI/3-167                   ...........................................iqts----GKPIDVLMEKVLRMNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNT..VEHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HLDSP..YIRAIGFL....Y...L.....RYVAD........................PKIL....WT.WYE.....PY..LRDDE.---------..............EFSPG...sNGRKTTMGVYVR.DLI.......LGQYY...FD..S..LLPRIPLPVTRQ---ita..................................................................
S3BY96_OPHP1/26-192                  .............................................ap---NGLNPATIMEKAVRERIIE..S.YFWKEQCFGVNE................................-ADIVDRVVDH..VSCIGG..............-TTG.TSQ.............................................KP.TPFLCLAFKL.LQLAPSDE..........ILA.AYLSq.............................................gGEKFK..YLRALALF....Y...V.....RLTRP........................AADV....FK.TLE.....PF..LADKR.KLRRKGRAG..............-----....-TQLTFVDDFVD.DLL.......TKSRV...CA..T..SLWKLPQREDLED--vg...................................................................
A0A0H5S0N7_BRUMA/37-84               ..............................................l-PLWGNTQTMNLNALVLENIIQ..C.IYYKNYLAETIG................................FQQLTEEIYY-..------..............----.---.............................................--.----------.--------..........---.----...............................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------set..................................................................
G3GW00_CRIGR/10-175                  ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
I0YZI6_9CHLO/10-175                  ..............................................r-SVHGTNPQNLVEKILRMKIYS..S.MYWKEHCFALTA................................-ESLVDKAVD-..LKYVGG..............-TFG.GQR.............................................AP.TQFMCLMLKL.LQLQPEKE..........IIV.EFIK...............................................NEDYK..YVRILGAF....Y...L.....RLVGR........................PLEV....YQ.YLE.....PL..YNDYR.KVRLRNADG..............-----....NFALTHMDEIID.QML.......YSEYL...FD..V..AMPRIPNRVTME---rls..................................................................
M5ELW3_MALS4/10-174                  ..............................................l-AIHGTNPQFLVERVIRTRIYD..S.TYWKQDCFALNA................................-ASLVDKAVE-..LTYVGG..............-TYG.ALR.............................................-P.SPFLCLVCKL.LQLQPDRD..........IVL.EYLA...............................................AEDLK..YLRALAAM....Y...I.....RLTFP........................SLEV....YE.LLE.....PL..LNDYH.KLRWRDMTG..............-----....QYSLSYMDEFID.QLL.......TEERV...CD..L..ILPRLTKRAVLERK-e....................................................................
B8C9N6_THAPS/41-204                  .........................................placpd-------DTFNIHPMLLQNIAK..S.PYFQKCCEKLGD................................WNTLVDEIYYE..VKHMEP..............WTAG.ASK.............................................SP.STAFCLLLRL.FTLRCTEK..........QMS.LMLE...............................................HVDSP..YIRCIGFL....Y...L.....RYAAE........................PSTL....WS.WYE.....QY..LYDEE.PVQIRQG--..............-----....-KADTTVGEYIR.SLL.......EDLEY...YG..T..RLPRLPLTL------erqfk................................................................
M3ZTE6_XIPMA/10-175                  ..............................................n-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LKFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRLLGAM....Y...M.....RLTGT........................AVDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HAERV...CD..I..ILPRLQKRQVLEEA-e....................................................................
V6U1Q1_GIAIN/1-137                   ...............................................-----------MEHTTRRAILN..S.PLYLMEFKHLGV................................IGLLKDVLLT-..-RNIDL..............-KYG.--R.............................................EP.SRFLCALVRL.YMLHPDRS..........IVN.EMLS...............................................VRNFA..YANAFAAI....H...V.....RCYWP........................SLDI....HK.ALT.....PL..MSNYT.KIHVSGLES..............-FG--....LQGHIPLDVLIE.ALL.......-----...--..-..---------------wqsta................................................................
T0QUG7_9STRA/50-213                  ..............................................l-PVHGNATTYNLNKMLFDNIMQ..S.VYFG-QLYALKT................................YHEVVDEIYYR..VDHAEP..............LSPG.TAR.............................................IP.SSCFCLLLKF.CTMRLTQN..........QMQ.GLLK...............................................HVDSP..YIRCVGFL....Y...L.....RYTMD........................PEEL....WS.WFE.....PY..LDDAE.---------..............EFNASa..nDKIVTTTGAWLR.TLL.......EEINY...FG..T..ILPRIPKKI------ldgi.................................................................
Q7RC31_PLAYO/10-175                  ...........................................iksf----GSNPQFLISNIIRNKIYD..S.PYWKEKCFALTS................................-ESIIDQAVN-..LKYVGG..............-TYG.GNR.............................................KP.TRFLCLVLKL.LQLQPDKD..........IIY.EFIK...............................................NEEFI..YLRALGIF....Y...L.....RLIGK........................GIDI....YK.NIE.....PI..LFDYR.KIRIRLQDG..............-----....SFQKIYMDVFAD.NCL.......VFSNF...LD..V..DFPPLTKRVVLEEN-h....................................................................
I1IIQ1_BRADI/10-175                  ..............................................r-SIHGTNPQNLVEKIVRSKIYQ..S.TYWKEQCFGLTA................................-ETLVDKAME-..LDHTGG..............-THG.GNR.............................................RP.TPFLCLTLKM.LQIQPDKD..........IVV.EFIK...............................................NEDYK..YVRVLGAF....Y...L.....RLTGT........................IADV....YQ.YLE.....PL..YNDYR.KIRQKLNDG..............-----....KFMLTHVDEFID.ELL.......TKDYC...CD..T..ALPRIQKRWVLEA--sg...................................................................
F0VM92_NEOCL/10-175                  ..............................................q-QVHGCNPQTLVSRIIRRKIYE..S.VYWKEQCFALTA................................-ETVLEPCVA-..LTYVGG..............-TYG.GKR.............................................QP.APFLCLVLKL.LQIQPETE..........VVL.EFIK...............................................QEQFK..YLRAVGAF....Y...L.....RLVGR........................ASEV....YT.HLE.....PL..LADYR.KLRFRLPDG..............-----....KFAIVCMDEFVD.DCL.......RKTNF...LD..V..DLPVLPKREVLENE-g....................................................................
K0SK04_THAOC/10-174                  ..............................................a-AVHGTNPQNLVEYITRQKIYD..S.LYWKEECFGLSA................................-SDVATKAVE-..LKALGG..............-SYG.GNS.............................................KP.TRFLCLILKM.LQIQPEEG..........IVE.QFLE...............................................NEDFK..YVRALGAF....Y...L.....RLTGR........................PSEI....FE.LIE.....PL..FNDHR.KLRYRTPTG..............-----....-WVITYMDQLAD.ELL.......HQDRY...CG..I..ALPHLPKRDVLE---tag..................................................................
M5G439_DACSP/10-173                  ..............................................t-SVHGTNPQHLIETVIRSRIYE..S.LYWKEHCFALTA................................-ETLIDKAIE-..LNCIGG..............-MYG.NQR.............................................-P.THFMCLLLKL.LQIQPEKE..........ILI.EYLL...............................................VEEFK..YLRALAAL....Y...I.....RLVFR........................PAEV....YE.LLE.....PL..LKDYR.KIRLRNMSG..............-----....-YVLTYMDEYID.ELL.......REERV...CD..I..ILPRMTKRDILEE--ve...................................................................
A0A0G2FQ87_9PEZI/23-190              ............................................ltp---NGLNPANVMEKAVRERIVD..S.YFFKEQCFGVNE................................-ADIVNRVVDH..VYFIGG..............-TYG.STQ.............................................KP.TPFLCIAFKL.LQLAPGDD..........ILK.EYLEy.............................................gGEKFK..YLRALAAF....Y...I.....RLTRR........................AKDV....YL.MLE.....PY..LEDKR.KLRRKGRAG..............-----....-TSLTYIDEFVD.DLL.......VKERV...CG..T..SLLKMPSRDLLEDL-d....................................................................
A0A0G4GZA6_9ALVE/10-175              ..............................................q-TVHGTNPQFLVSRIVRMKIYQ..N.QYWKEHCFGLTA................................-ETIVDKAVE-..LQYVGG..............-TYG.GSR.............................................KP.SPFICLVLKL.LQIQPDKD..........IVL.EYVR...............................................NEEFK..YLRALGAF....Y...L.....RLTGT........................AMDV....YS.NLE.....PM..LSDYR.KLRLRGFDG..............-----....KFTVRHMDEFVD.DLL.......RQEHL...LD..V..DFPQLQNRQILEE--gg...................................................................
A0A0D2VLI7_GOSRA/2-93                ..........................................kitmi----------------------..-.------------................................-----------..------..............----.---.............................................--.----------.--------..........---.NYYG...............................................EINFR..YVRVLGAF....Y...L.....RLTGI........................DSDI....YR.YLE.....PL..YNDYR.KVRRKSPDG..............-----....NFMLTHVDEVID.ELL.......TRDYS...CD..I..ALPRIKKRWTLES--lg...................................................................
M4EH49_BRARP/4-168                   ..............................................i-QTNGRAYESLLEKVLSMNIVS..S.DYFK-ELYGLKT................................YHEVIDEIYNQ..VSHVEP..............WMGG.NCR.............................................GP.STAYCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HTDSP..YIRAVGFL....Y...L.....RYVAD........................AKTL....WT.WYE.....PY..IKDDE.---------..............EFAPG...sNGRTTTMGVYVR.DLL.......LGLYY...FD..T..LFPRIPVPVMR----qivs.................................................................
A0A0K0ER33_STRER/30-211              ............................................lpe---YGNRQTMNLNNLLYTNIVE..S.VYWKEYLHSLTT................................FHQVQDEIIKK..VKYLEP..............WEHG.SRAqnsscig..............................vrgvsaggRV.TTAFCLLYKL.FTLKLTRK..........QIV.SMIN...............................................NDQNT..YLRAIGFL....Y...I.....RYCQP........................PKDL....YD.WFE.....PY..LYDKD.VLLIKSRN-..............-----....-RNEVTIGEMLK.HLL.......TNLDF...YG..T..LLPRIPIPIQISI--dk...................................................................
F4RZW6_MELLP/10-173                  ..............................................l-SIHGTNPQFLIDKVVRSRIYD..S.QYWKETCFALTA................................-ESIIDCAIS-..LKYVGG..............-TYA.NVR.............................................-P.TEFMCLALKL.LQLQPEKE..........IIL.EYLR...............................................AEEFK..YLRALAAF....Y...V.....RLTFT........................PLNV....YQ.TLE.....PL..LTDFR.KLRFRHMNG..............-----....SYSLVTFDDFVD.SLL.......VEERV...FE..I..VLPRLTMRK------vwkrl................................................................
F0XXJ0_AURAN/10-174                  ..............................................q-EVHGTNPQRIVEKILRMKVYA..T.QYWKEYCFGLTA................................-ETLVDRAIE-..IDHVGG..............-TYG.GIR.............................................KP.TKFMCLLLKM.LQIQPDLE..........IIV.EFIK...............................................NEEYK..YVRALGAL....Y...L.....RCVGR........................PPEV....YK.YLE.....PL..YVDYS.KLRVRTFEG..............-----....-WTITHVDEFVD.ELL.......TEDYS...CD..I..ALPHLPKRWHLEQQ-n....................................................................
U5FGX6_POPTR/3-167                   ..............................................i-QTNGKPIDSLLEKVLCMNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STSFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HKDSP..YIRAVGFL....Y...L.....RYAGD........................PKTL....WN.WFE.....PY..IKDDE.---------..............EFSPG...tSGRKTTMGVYVR.DLL.......LGQYY...FD..T..LFPRIPVPVMRQ---its..................................................................
A0A0G2HNQ7_9EURO/21-214              ..............................................l--IRGVNPATLFEKAVRDRITE..S.YYWKEQCFGLNA................................-ATLCDRAAE-..LTYIGG..............-TYG.LAQ.............................................KP.TPFLCLAFKL.LQLAPEKE..........IVL.EYLNfhdpendgdedgdrn.................gleeehdgdsgvvkaVGDFK..YLRALAAF....Y...I.....RVTFD........................AAEI....YR.TLE.....PL..LADYR.KLKRRTKDG..............-----....-FTLTYIDQFVD.DLL.......TKDRV...CG..T..SLWKLPSRTQLEDL-d....................................................................
K0KUA6_WICCF/15-175                  ............................................sth---KGQNSILLIEKIIRERIFD..S.LYWKQYCFNVNA................................-ALILDRCVE-..IRCVGG..............--LE.TSG.............................................KP.MGFICLLVKL.IQLMPQRE..........IIE.FYLN...............................................QGKFK..YLKVLAMV....F...I.....RLVYR........................DGGL....--.-LK.....KQ..LNDYR.KVRLYEHGE..............-----....-YKLSYVDEIAD.KLL.......NDEMF...IG..L..NLPYMKTNGDD----esdd.................................................................
I1H1P3_BRADI/3-165                   ........................................iqssgrp-------IEVLMEKVLSMNIVS..S.DYFK-ELYKIKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKL.FTMKLTMN..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYVAE........................PKTL....WT.WYE.....PY..IQDDE.---------..............EFSPG...sNGKMTTMGVYVR.DVL.......LGQYY...FD..S..LLPRVPL--------lilrqv...............................................................
U5GDA8_POPTR/33-124                  ............................................ysm----------------------..-.------------................................---------E-..LDHLGG..............-TYG.GNR.............................................KP.TPFMCLITKV.LQIQPEKD..........IVV.EFIK...............................................YEDYK..YVRVLGAF....Y...L.....RLTGT........................DIDV....YR.YLE.....PL..YNDYR.KLRQKLTDG..............-----....------------.---.......-----...--..-..---------------nysc.................................................................
H2N7E1_PONAB/19-176                  ..................................kylvekdhsnaks--------------------MS..S.KYWKEECFGLTA................................-ELVVDKL-E-..LRFVGGv...........ygWAII.KTQ.............................................--.HPFLCLTL-M.LQIQPE-D..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
K7H0X5_CAEJA/52-236                  ..............................................l-PIWGNQVTMNLNTLVLENIRE..S.YYYKNNLIEIDS................................FQALVEQIFYQ..VKHLEP..............WEKG.TRRlqgmtgmcg...........................gvrgvgaggVV.SSAFCILYRL.FNLRMTRK..........QLI.SMLN...............................................SRQSV..YIRGIGFM....Y...I.....RYTQP........................PSDL....WY.WLE.....PY..LDDES.---------..............EIDPRs..gGGDCMTFGMMVR.TMI.......NKLDW...YG..T..LFPRIPVPIQKEID-e....................................................................
U6MKH2_9EIME/136-300                 ..............................................l-AVHGKNPQLLFSRIVRRKVYE..S.FFWKEECFAATA................................-ATVVELAAA-..LQYVGG..............-TFG.GIR.............................................AA.SPFLCLVLKL.LQLQPEKQ..........IIL.EFIK...............................................QEDFK..YLRAVGAF....Y...F.....RLVGP........................SAEV....YV.HLE.....PL..LADYR.KLRLRLPDG..............-----....SFRVSFMDEFVD.DCL.......RKRSL...FD..V..DLPPLVQRQ------vfvlq................................................................
F0ULM3_AJEC8/21-214                  ..............................................l--IRGVNPATLFEKAVRDRITE..S.YYWKEQCFGLNA................................-ATLCDRAAE-..LSYIGG..............-TYG.LAQ.............................................KP.TPFLCLAFKL.LQLAPEKE..........IVL.EYLNfhdpenghvegsemn.................gleeeqggasgvvkaVGDFK..YLRALAAF....Y...I.....RLTFD........................AADI....YK.SLE.....PL..LTDYR.KLKRRMKDG..............-----....-FVLTYIDQFVD.DLL.......TKDRV...CG..T..SLWKLPSRHQLEDL-d....................................................................
A0A024VIV8_PLAFA/160-331             .........lhfvkrkytkrklmasniqnicnfitdknknensrtkk----------------------..-.---------VE-................................TESIIDQAIN-..LKYVGG..............-TYG.GNR.............................................KP.TRFLCLILKL.LQIQPDKD..........IIY.EYIK...............................................NEDFV..YLRALGIF....Y...L.....RLIGK........................SLEV....YN.HLE.....PI..LFDYR.KIRMRLQNG..............-----....TFEKIYMDVFVD.NCL.......ILNNF...LD..V..DFPTLTKRQVLEEN-n....................................................................
A0A0N4ZGG7_PARTI/6-171               ..............................................k-TIRGTRSTFLIEKIIRTRINE..S.LYWKEECFGLSA................................-ETVIDKGAD-..LRYVGG..............-IYA.GNT.............................................KP.TPFLCLMLKL.LELAPEKE..........IIV.EYIE...............................................QEDFK..YIRALGAM....Y...I.....RLTFP........................SVEV....YK.YLE.....PI..YSDYR.KLRYMNRMG..............-----....RFELMYMDEFID.RLL.......NEELF...CD..I..HLPKLQGRQLLEQN-d....................................................................
M0T4J1_MUSAM/3-166                   ..........................................iqtsg-----KPIDSLLEKVLSMNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKTL....WT.WYE.....PY..IKDDE.---------..............EFSPG...sNGRLTTMGVYVR.DLL.......LGQYY...FD..T..LFPRVPVPVVR----qiv..................................................................
A0A084QD51_9HYPO/25-192              ............................................lap---NGLNPANIMEKAVKDRITE..S.YFYKEQCFALNE................................-ADIVDRVIEH..VNYIGG..............-THG.AAQ.............................................KP.SPFLCLAFKL.LELAPSDA..........ILH.EYLQy.............................................gGEHFK..YLRALACF....Y...I.....RLTRQ........................SKDV....YQ.TLE.....PF..LEDRR.KLRRKGRAG..............-----....-TSLTFLDEFVD.DLL.......TKERV...CA..T..SLWKLPSREILEDQD.....................................................................
W9WA46_9EURO/19-185                  .............................................pl--IRGQNPALLLETAMRDRITD..S.LYWKEQCFGLNA................................-ATLCDRAVE-..LTYIGG..............-TYG.VAM.............................................KP.TPFICLAFKL.LTLVPDRE..........IVL.EYLKn.............................................gGEEWK..YLRALAAF....Y...V.....RLTFN........................AADV....YK.TLE.....PL..LEDSR.KLRQRRKEE..............-----....-YVLIHMDEFVD.NLL.......TKDRV...CG..T..TLWKLPARQVLEDL-d....................................................................
A0A0E0A4V4_9ORYZ/4-150               ........................................qssgrpi--------DVLMEKVLSVNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.SSAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAVGFL....Y...L.....RYVAE........................PKTL....WS.WYE.....PY..IKDDE.---------..............EFSPG...sNGKMTTMGVYVR.DLL.......L----...--..-..---------------gqcpl................................................................
H3CJ03_TETNG/10-177                  ..............................................n-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LKFVGG..............-VFG.GNI.............................................KP.TPFICLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRLLGAM....Y...M.....RLTGT........................AVDC....YK.YLE.....PL..YNDYR.KVKTQNRNG..............---DS....EFELMHVDEFID.QLL.......HSERI...CD..I..ILPRLQKRHVLEET-e....................................................................
A0A0A1TWQ7_ENTIV/2-162               .........................................tgverr-----------VETILRNKIYN..S.VYWKERCFGLTS................................-DTILDEMVG-..LKEVGG..............-TYG.VMK.............................................KP.TKYITLVLKL.LTIRPDRK..........IVY.EMLR...............................................NANFK..YVRAVAAL....Y...L.....RLVSS........................SEEC....YL.FLE.....PL..YYDYR.PLKVRTGAR..............-----....SFEIITMDQFAW.NLL.......HLDYY...CD..I..SMPVLAPRSLL----saqk.................................................................
Q18942_CAEEL/10-175                  ..............................................k-TVKGTNPQFLVEKIIRQRIYD..S.MYWKEHCFALTA................................-ELVVDKGMD-..LRYIGG..............-IYA.GNI.............................................KP.TPFLCLALKM.LQIQPDKD..........IVL.EFIQ...............................................QEEFK..YIRALGAM....Y...L.....RLTFD........................STEI....YK.YLE.....PL..YNDFR.KLRYMNKMG..............-----....RFEAIYMDDFID.NLL.......REDRY...CD..I..QLPRLQKRWALEE--vd...................................................................
F7GLJ8_MONDO/12-196                  ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
A0A0L1JFH0_ASPNO/21-209              ..............................................l--VRGVNPATLFEKAVRDRITD..S.YYWKEQCFGLNA................................-ATLCDRAVE-..LTSIGG..............-TYG.VSE.............................................KP.TPFLCLAFKM.LQLNPDRD..........IVL.EYLNftdpvndeegeq......................tateqaengvvkqQGDFK..YLRALAAF....Y...V.....RLTFD........................AVDV....YK.TLE.....PL..LLDYR.KLKRRVRDS..............-----....-VVLTYVDQFVD.DLL.......TKDRV...CG..T..SLWKLPSRQQLEDL-d....................................................................
A0A096MRX0_PAPAN/10-175              ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
C5DR46_ZYGRC/14-208                  ...............................................KQLNHQSVSFVIPRILRDRIHN..A.MYYRVNLNTASLrg............................dtMNCLSRILVRD..LGALKDgsv........nqvNVLG.GVE.............................................--.--FQCLLMKL.VEIKPTFD..........QLT.TMLQd............................................deNFNNK..YIVGLILT....Y...L.....RIQYYylpv................ddpwARRC....QS.FFR.....QY..YNDYR.KLKSVQLDQdc..........wsKSQTI....NVDILHTDELVD.WLL.......VKDDI...WG..I..PLGKCQWTEIND---ddd..................................................................
A0A024TH67_9STRA/55-219              ..............................................l-PIHGNQSTYNFNTLLYDNVMN..S.DYFR-KLYELTT................................YHEVVDEIYYR..VDHAEP..............WAAG.TSR.............................................IP.STCFCLLMKF.CTMRLTIN..........QMQ.GLLK...............................................HVDSP..YIRCVGFL....Y...L.....RYTCD........................PELL....WE.WYE.....PY..LGDDE.---------..............EFNASs..nDAIRTTMGAWIR.SLL.......EDINY...FN..T..ILPRIPKKIQ-----dgik.................................................................
PR38A_MOUSE/10-175                   ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LKFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFVLMHVDEFIY.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
F4PGM1_DICFS/1-133                   ............................................mrg----------------------..-.------------................................VNEVIDEIYNK..VEYLCP..............YIPG.T-K.............................................TP.SSAYCLLYKL.YTLKLTEE..........HME.TLIF...............................................HGDSP..YIRAIGFL....F...L.....RYAHP........................PASL....WD.WFN.....EC..LDDQE.---------..............LIAIS...pKSKPITMELFLL.GLL.......KEQKF...AE..T..ILPRIPVKVMKEL--eq...................................................................
A0A094CWW4_9PEZI/22-189              ............................................lap---NGLNPATIFEKPVRERIID..C.YFWKDQCFALNE................................-ADIVSRVVEH..VQFVAG..............-TYG.DSQ.............................................RP.SPFLCLAFKL.LQLGPGDD..........ILK.EYLEy.............................................gGEKFK..YLRALACF....Y...V.....RLTRP........................AKEV....YE.TLE.....PF..LEDAR.KLRRRGRQG..............-----....-TSLTFMDQFVD.ELL.......TKERV...CA..T..SLWKMPKREVLEDL-e....................................................................
M1VHD9_CYAME/26-187                  .............................................ar---------------LREQTRH..C.TFYRTYCFKASL................................-KQLEEVTEEH..VTYVGD..............--CA.ALP.............................................-P.SPFLCVLLAY.DCCSPSRE..........EVA.AHLD...............................................CSKNV..YWRAIVAT....W...I.....RWKES.......................rAEQV....YQ.LLD.....PL..YRDYR.PIKVRQKDN..............-----....SYHNSYLDVFID.QLL.......R----...--..-..---------------yrcalvsleepfvldvipfphlppryelear......................................
A0A0N5BNF5_STREA/30-211              ............................................lpe---YGNRQTMNLNNLLYTNIIE..S.VYWKEYLHSLTT................................FHQVQDEIIKK..VKYLEP..............WEHG.SRNqssscig..............................vrgvsaggRV.TTAFCLLYKL.FTLKLTRK..........QIV.SMIN...............................................NEQNT..YLRAIGFL....Y...I.....RYCQP........................PKDL....YD.WFE.....PY..LDDKN.TIVIKSR--..............-----....NGSEVTIGEMVT.QLL.......TNLDF...YG..T..LLPRIPVPIQN----iidk.................................................................
M7TF93_EUTLA/22-189                  ............................................lap---NGLNPATIMEKAVRERIVD..S.YFYKEQCFGLNE................................-ADVVDRVVEH..VSFIGG..............-TYG.STQ.............................................KP.SPFLCLAFKL.LQLAPDDA..........VLQ.EYLAf.............................................gGERFK..YLRVLAAF....Y...V.....RLTRR........................AEHV....YA.ILE.....PF..LEDRR.KLRRKARAG..............-----....-TSLTFVDQFVD.ELL.......TKERV...CA..T..SLWQMPKREILEDL-d....................................................................
A0A0K0FMJ1_9BILA/30-211              ............................................lpe---YGNRQTMNLNNLLYTNIIE..S.VYWKEYLHSLTT................................FHQVQDEIIKK..VKYLEP..............WEHG.SRNqssscig..............................vrgvsaggRV.TTAFCLLYKL.FTIKLTRK..........QIV.SMIN...............................................NEQNT..YLRAIGFL....Y...I.....RYCQP........................PKDL....YD.WFE.....PY..LDDKN.TIVIKSR--..............-----....NGSEVTIGEMVT.QLL.......KNLDF...YG..T..LLPRIPVPIQN----iidk.................................................................
W5DV57_WHEAT/3-53                    .............................................iq--TSGKPIDMLMEKVLCMNILS..S.DYFK-ELYQMKT................................YHEVIDEIYNQ..VDHVEP..............----.---.............................................--.----------.--------..........---.----...............................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------.....................................................................
A0A086TDT6_ACRCH/24-191              ............................................lap---NGLNPATIMEKAVRDRIVD..S.YFYKEQCFALNE................................-ADIVDRVVEH..VRFIGG..............-THG.ASQ.............................................RP.SPFLCLAFKL.LELAPSDA..........ILD.AYLRh.............................................gGEHFK..YLRALACF....Y...L.....RLTRP........................GKDV....YE.MLE.....PY..LEDRR.KLRRKGRQG..............-----....-TSLTYVDEFVD.DLL.......TKDRV...CA..T..SLWKMPKREVLEDL-e....................................................................
K6VGZ7_9APIC/165-327                 ............................................lem----TNTTTYNVNTLLRNNILS..S.EYFR-SLVPMKT................................FKEVVDEIHLY..ADHVEP..............YCIG.STR.............................................AP.STLFCCLYKL.FTMHLSEK..........QMK.VLIE...............................................SRDSC..YIRACGFL....Y...L.....RYVHS........................PANL....WM.WFE.....PY..LLDED.-LFVTSAD-..............-----....KRKKQTIGEYIQ.CLL.......ADDKY...FN..T..VLPRMPIKIK-----nty..................................................................
Q2U457_ASPOR/21-209                  ..............................................l--VRGVNPATLFEKAVRDRITD..S.YYWKEQCFGLNA................................-ATLCDRAVE-..LTSIGG..............-TYG.VSE.............................................KP.TPFLCLAFKM.LQLNPDRD..........IVL.EYLNftdpvndeegeq......................taaeqaengvvkqRGDFK..YLRALAAF....Y...V.....RLTFD........................AVDV....YK.TLE.....PL..LLDYR.KLKRRVRDS..............-----....-VVLTYVDQFVD.DLL.......TKDRV...CG..T..SLWKLPSRQQLEDL-d....................................................................
B7P4Y8_IXOSC/14-198                  ..............................................l-PLWGNEKTMNLNNLILTNILS..S.PYFKVNLYKLKT................................YHEVVDEIYYN..VQHLEP..............WEKG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAFCILYKL.FTLKLTRK..........QLN.GLMN...............................................HCDSP..YIRALGFM....Y...I.....RFTQP........................PADL....VD.WYE.....PY..LDDEE.---------..............ELDVKa..gGGQTLRMGDMLR.HFL.......TKLEW...FA..T..LFPRIPVPIQKEIE-r....................................................................
E9GQD3_DAPPU/32-216                  ..............................................l-PIWGNERTMNLNPLILTNIQT..S.HYFKTNLSELKT................................YHEVVDEIYYK..VQHLEP..............WEKG.SRKtsgqtgmcg...........................gvrgvgaggIV.STPYCLLYKL.FTLKLTRK..........QLI.GLIT...............................................HCDSP..YIRGLGFM....H...I.....RYTQP........................PADL....FG.WFQ.....PY..LEDEE.---------..............EIDPKa..gGGHPMTIGTMVR.QLL.......TKLDW...YD..S..LFPRIPVPIQINI--dr...................................................................
J4DQ33_THEOR/129-289                 ............................................lpm----TNSMTYNMNDLLRNNILT..S.EYYK-SL-SVKT................................FYDVVNELVQF..GSHCEP..............YCST.STR.............................................AP.STMFCCLYKF.FTLKLTEK..........QMV.TLLD...............................................HNKSP..YPRCCGFL....Y...L.....RYVLP........................PDKL....WS.WYE.....PY..FLDEE.---------..............EFTVSs..dGNKKTTVGEFAE.SLI.......MDDKY...YN..T..VLPRLPVRVK-----nl...................................................................
C5L5B5_PERM5/95-139                  .............................................ag--AHGGNPQFLISQIVRDRVYS..L.RYWKEECFGLNA................................-ETILDKAAE-..------..............----.---.............................................--.----------.--------..........---.----...............................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------l....................................................................
F0ZBH7_DICPU/5-166                   ..............................................l-EIHGNEKTMNLDNILLSNIQS..S.LYFK-NLYSKKT................................YHEVLDEIKKN..VDCLSP..............YISN.-TK.............................................NP.STAFCLLYKF.FLMKLTVK..........QME.GLLG...............................................-QDSP..YARGIGIL....Y...L.....RYSYP........................PSKI....WE.WYI.....DY..LDDHD.---------..............TVLIS....KNSEVTIQKLML.DLL.......KENKF...SG..T..ILPRIPTKIQQD---ldk..................................................................
B6TYH0_MAIZE/10-175                  ...............................................KSIHGTNPQNLVEKIVRSKIYQ..S.TYWKEQCFGLTA................................-ETLVDKAME-..LDHTGG..............-TYG.GNR.............................................KP.TPFLCLALKM.LQIQPDKD..........IVV.EFIK...............................................NEDYK..YVRVLGAF....Y...L.....RLTGT........................IADV....YQ.YLE.....PL..YNDYR.KIRHKLSDG..............-----....QFTLTHVDEFID.ELL.......TKDYS...CD..T..AMPRIQKRWVLEA--sg...................................................................
A0A0A0LFY3_CUCSA/10-175              ...............................................KSIRGTNPQNLVEKILRSKIYQ..N.TYWKEQCFGLTA................................-ETLVDKAME-..LDHLGG..............-TYG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKE..........IVI.EFIK...............................................NEDYK..YVRVLGAF....Y...L.....RLTGT........................DVDV....YR.YLE.....PL..YNDYR.KLRRKLADG..............-----....CFSLSHVDEVID.ELL.......TKDYS...CD..V..ALPRVKKRWTLES--ag...................................................................
A0A0N4TPH1_BRUPA/47-231              ..............................................l-PLWGNTQTMNLNALVLENIIQ..C.TYYKNYLAETTG................................FQQLTEEIYYS..VKHLEP..............WERG.TRKtqgmtgmcg...........................gvrgvgaggVV.STAFCLLYKL.FTIRLSRK..........QLV.SMIN...............................................NSDSP..YIRGIGFM....Y...I.....RFCQP........................PQDL....WA.WME.....PY..LDDEE.---------..............QIDPRs..gGGDVMVMAQVVK.MML.......TKLDW...YG..T..LFPRIPVPIQKEI--el...................................................................
S9XCT7_9CETA/1-124                   .............................................me----------------------..-.------------................................-----------..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IVV.EFIR...............................................NEDFK..YVCMLGAL....Y...M.....RLTGT........................AVDY....YK.YLE.....PL..YSNYR.KIKSQNRNG..............-----....EFELVRVDEFID.ELL.......HSERV...CD..I..ILPQLQKRYVLEEA-e....................................................................
A0A017SNM0_9EURO/21-202              ..............................................l--VRGVNPATLFEKAVRDRITD..S.YYWKEQCFGLNA................................-ATLCDRAIE-..LSSIGG..............-TYG.VSE.............................................KP.TAFLCLAFKM.LQLNPTRD..........IVL.EYLNfsdpgsdde.............................dqdnevlqnRGDFK..YLRALAAF....Y...V.....RLTFD........................AVDV....YK.TLE.....PL..LLDYR.KIKRRVRDS..............-----....-FVLTYMDQFVD.DLL.......TKERM...CG..T..SLWKLPSRQQLEDL-e....................................................................
G5AX24_HETGA/10-161                  ..............................................h-SIRGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLILKM.FQIQPEKD..........IIV.EFIK...............................................NEDFK..YARMLGSL....Y...M.....RLTGT........................AIDC....FK.YLE.....PL..YNDYW.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HKRYL...--..-..---------------leea.................................................................
E1GF58_LOALO/10-175                  .............................................vt--VKGTNPQYLVEKIIRTRIYD..S.KYWKEECFALTA................................-ELLVDRGME-..LRYIGG..............-IYA.GNV.............................................KP.TPFLCLCLKM.LQIQPEKD..........IAV.EFIR...............................................QEEYK..YIRALGAM....Y...I.....RLTFT........................SIEV....YK.YLE.....PL..YNDYR.KLRIMNNDG..............-----....RFEIVHMDEFID.SLL.......REERY...CD..I..HLPRIQKRITLEE--ig...................................................................
A0A068XCD3_HYMMI/10-175              ..............................................h-TLHGTNPQYLIEKIIRSRIYE..C.QFWKEHCFALTS................................-ELLVDKAVE-..LKYIGG..............-TYS.GLT.............................................KP.TPFICLVLKM.LQIQPDKD..........IVI.EFIK...............................................QEDYK..YARALGAF....Y...L.....RLVGE........................SVEI....YK.YLE.....AL..YNDFR.KLKQQDTTG..............-----....KFSIIRMDEFID.QLL.......NEERA...CD..V..ILPRLQKRSVLEDS-n....................................................................
A0A077Z5Z3_TRITR/438-620             .............................................la--FWGNKQTMNLNHLVYENIMI..S.PYYKNTLSQVVT................................YHEVLDEIYYN..VDHLEP..............WERG.TRKttgqtgmcg...........................gvrgvgaggVV.SSAFCILYKL.FTLKLTRK..........QLI.SMLN...............................................HSDSC..YIRGLGFM....Y...V.....RYCLH........................PNSF....WY.WFE.....PY..LDDEE.---------..............EIDPKa..gGGEVMTIGDMIR.QML.......NKLEW...YT..T..LFPRIPVPIQ-----svl..................................................................
A0A0F2MLM3_SPOSC/26-192              .............................................ap---NGLNPATIMEKAVRERIVD..S.YFWKEQCFGVNE................................-ADIVDRVVEH..VSCIGG..............-TTG.TTQ.............................................KP.TPFLCLALKL.LQLAPDDA..........ILQ.AYLSq.............................................gGDKFK..YLRALALF....Y...I.....RLTRP........................AADV....YT.TLE.....PY..LADRR.KLRRKGRAG..............-----....-TQLTFVDEFVD.DLL.......VKTRV...CA..T..SLWKLPQREDLED--lg...................................................................
E9GW90_DAPPU/10-175                  ..............................................i-SVKGTNPQYLVEKIIRTRIYD..S.KYWKEECFALTA................................-ELMVDKAME-..LRYIGG..............-IFG.GNV.............................................KP.TPFLSLTLKM.LQIQPEKD..........IVV.EFIK...............................................NEDFK..YVRALGAF....Y...M.....RLVGT........................SVEI....YK.YLE.....PL..YNDYR.KIRFQNKEG..............-----....NFELLYMDDFID.SLL.......REERF...CD..V..ILPRLQKRQILEE--an...................................................................
Q6BW00_DEBHA/13-188                  ..........................................ksnvi------RKAYLVEPIIRHRIQD..S.LFYKQYLYLTNE................................-ATILPVITSQ..VKYIGS..............--TN.ANG.............................................KP.TPFVCCFLRL.LELEPSRD..........IIE.MCLHq............................................lgTKEFK..YLTALIML....Y...I.....RVVWP........................YEDV....IT.TLE.....PF..YSDYR.KLRFQLKSPi...........mvKGMPI....LYKLSHMDVWCD.ELL.......NNERV...VD..L..ILPRMVPRHVLFE--rg...................................................................
I1BHD0_RHIO9/11-174                  .............................................tg--IHGRHPLHLVEKIIRERIQE..S.IYWKEKCYGLTA................................-ATLTERAVD-..VDYIGG..............-MYG.NLQ.............................................-P.TEFICLLLKL.LQLLPEKE..........III.EFVK...............................................QEDFK..YLRALGAF....Y...L.....RLTGK........................SKEI....YQ.YLE.....PL..LNDYR.KLRARGKEG..............-----....-FSLTYMDVFVD.DLL.......TKDRV...CD..I..ILPRIMARHVLEQN-d....................................................................
A0A061GG73_THECC/10-175              ...............................................KSIRGTNPQNLVEKIVRSKIYQ..N.TYWKEQCFGLTA................................-ETLVDKAME-..LDHIGG..............-TYG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKD..........IVV.EFIK...............................................NDDYK..YVRILGAF....Y...L.....RLTGT........................DIDV....YR.YLE.....PL..YNDYR.KLRQKSPDG..............-----....NFSLTHVDEVID.ELL.......TRDYS...CD..I..ALPRIKKRWTLES--lg...................................................................
F6UK93_HORSE/47-231                  ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
M2XT21_GALSU/10-174                  .............................................ih--AHGFDPQFLIDKITREKIYQ..C.AYWKAECFGLTA................................-ETLVDKAAE-..LTYVGG..............-LYG.PLK.............................................KP.TPFICLILKL.LQLSPDKE..........IIH.QYLQ...............................................QKKFK..YLTALAAF....Y...W.....RLVGN........................GTDV....YR.WLE.....PL..YEDFR.KLRIRRENK..............-----....-YELIHVDECID.ELL.......QKEDV...CD..I..KLPRLPNRNVLME--dr...................................................................
A7TN57_VANPO/14-211                  ...............................................KQLNNQSVSLVIPRITRDKIHN..S.IYYKANLDNSSLrg............................lnMLQLIEVIVRD..LGTLKDksv........nqvCFLG.GVE.............................................--.--FKCILMKL.IEICPTWE..........QLM.TIIQmqd........................................nvidNFDNK..YLVALVLT....Y...I.....RIQYYydn.................devnSKKY....RE.LFS.....KC..ISDYR.KLKSVAMDTdc..........wsMSQSI....EIKIIHLDELVD.WLC.......SEDEI...WG..I..PLGHCQWS-------dlnasde..............................................................
W4WLI1_ATTCE/10-175                  ...............................................KSIRGTNPQYLIEKIIRSRIYD..S.KYWKEECFALTA................................-ELLVDKAME-..LRFLGG..............-VYG.GNV.............................................KP.TPFLCLILKM.LQIQPEKD..........IIV.EFIK...............................................NEEFK..YVRALGAL....Y...M.....RLTGS........................SLDC....YK.YLE.....PL..FNDNR.KLRIQNKQG..............-----....VFELVHMDEFID.NLL.......RDERC...CD..V..ILPRIQKRHVLEEN-n....................................................................
T1EDF2_HELRO/10-175                  ..............................................a-TVKGTNPQYLIEKIIRTRIYE..S.KFWKEECFALSA................................-ELLVDKAME-..LKYLGG..............-VYA.GNV.............................................KV.SPFLCLILKM.LQIQPEKD..........IIV.EFIT...............................................QPDFK..YVRALGAL....Y...M.....RLTGT........................SLDC....YK.YLE.....PL..YLDYR.KLKRMDRNG..............-----....LFDLVHMDEYVD.DLL.......REERI...LD..I..ILPRIQKRHVLEE--mn...................................................................
A0A0M0KXG3_9EUKA/15-172              ..............................................v-SVHGTNPQNLVEKILRAKIYN..H.AYWKEHCFGLTA................................-ESLVDKAME-..VEAIGG..............-TYG.GIR.............................................EP.TSFIQLTLKM.LQIQPEKE..........IVV.EFIK...............................................NEDYK..YVRALGAY....Y...M.....RLTGK........................AVEV....YQ.YLE.....PL..YNDYR.KLRRRQVDG..............-----....SYTLTRMDEFID.ELL.......RAD--...--..-..---------------ygatasvsvpvr.........................................................
A7SXQ7_NEMVE/10-175                  ...............................................KNIKGTNPQYLVEKIIRTRIYE..S.KYWKEQCFALTA................................-ELLVDKAME-..LDHIGG..............-TFG.GNI.............................................KP.TPFLCLLLKM.LQIQPEKE..........IIV.EFIK...............................................NDDYK..YVRALGAM....Y...M.....RLVGT........................ALDC....YN.YLE.....PL..FNDYR.KLKRMSQTG..............-----....VYEVVHMDEFID.DLL.......REDRV...ND..I..ILPRIQARHILEA--tn...................................................................
H1VMK2_COLHI/24-191                  ............................................lap---NGENPATIMEKAVRERIVD..S.YFYKEQCFAVNE................................-ADIVDRVVEH..VTFVGG..............-TYG.VTQ.............................................KP.TPFLCLAFKL.LQLAPSDD..........VLE.AYLGl.............................................gGEKFK..YLRALACF....Y...V.....RMTRK........................ARDV....YL.LLE.....PF..LEDRR.KLRRKGRQG..............-----....-TSLTYMDDFVD.DLL.......TKTRV...CA..T..SFRELPKRSDLVD--ld...................................................................
B7S4A9_PHATC/10-166                  .............................................ss--VSGSDPQNLLEYITRQKIYD..S.RFWKEECFGLTV................................-ADVLEKSTS-..LQCIGA..............----.---.............................................LP.AHFLALCLKL.LQLHPETE..........LVTeTFVD...............................................QEDFK..YTRVLGCL....Y...L.....RLTGR........................PTEI....YE.RLE.....PL..YRDRR.KLRVWTPPC..............-----....-WGLKHVDDFIH.ECL.......TEPRI...LN..L..SLPRLPSRRSL----q....................................................................
A0A0E0L7N7_ORYPU/101-262             ........................................qssgrpi--------DVLMEKVLSVNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.SSAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAVGFL....Y...L.....RYVAE........................PKTL....WS.WYE.....PY..IKDDE.---------..............EFSPG...sNGKMTTMGVYVR.DLL.......LGQYY...FD..S..LLPRVPL--------lilrqv...............................................................
A0A067CBH5_SAPPC/9-173               ..............................................t-HVHGVNPQHLVEKILRNRIYD..C.MYWKEHCFGLTE................................-ETLVEKAIE-..LSYIAG..............-HFG.GNQ.............................................QP.SPFLCLLLKM.LQMQPDMD..........VVM.TFIE...............................................NGDYK..YVTALGAM....Y...L.....RLTGK........................PVEI....YP.VLE.....NL..LSDYR.KVRFRKTMG..............-----....-WDVLHMDEVAD.LLL.......REEYF...CN..I..ALPRLVDRFQLET--mn...................................................................
E3N791_CAERE/10-175                  ..............................................k-TVKGTNPQFLVEKIIRQRIYD..S.MYWKEHCFALTA................................-ELVVDKGMD-..LRYIGG..............-VYA.GNI.............................................KP.TPFLCLALKM.LQIQPEKD..........IVL.EFIQ...............................................QEEFK..YIRALGAM....Y...L.....RLTFD........................STEI....YK.YLE.....PL..YNDFR.KLRYMNKMG..............-----....RFEAIYMDDFID.NLL.......REDRY...CD..I..QLPRLQRRWALEE--ve...................................................................
A0A0L0BU41_LUCCU/26-210              ..............................................l-PLWGNESTMNLNPLILANIQS..S.SYFKVHLFKLKT................................YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.YTLRLTRK..........QVN.GLIN...............................................HTDSP..YIRALGFM....Y...L.....RYTQP........................PADL....YD.WYE.....DY..LQDEE.---------..............EIDVKa..gGGQTITMGQMVY.QFL.......TKLDW...FS..T..LFPRIPVPIQKQIE-k....................................................................
G1LRX0_AILME/10-175                  ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
E7KCV7_YEASA/15-219                  ...............................................KQLNNQSVSLVIPRLTRDKIHN..S.MYYKVNLSNESLrg............................ntMVELLKVMIGA..FGTIKGqng.......hlhmMVLG.GIE.............................................--.--FKCILMKL.IEIRPNFQ..........QLN.FLLNvk..........................................nenGFDSK..YIIALLLV....Y...A.....RLQYYylngn.............nkndddENDL....IK.LFKvq.lyKY..SQHYF.KLKSFPLQVdc..........faHSYNE....ELCIIHIDELVD.WLA.......TQDHI...WG..I..PLGKCQWNK------iynsde...............................................................
D8R3L1_SELML/5-169                   ...........................................vqtc----GKPIQTLVEHVVNVNILS..S.EYFK-ELYRLKT................................FHEVVDEIYNH..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMQ.GLLN...............................................HADSP..YIRAIGFL....Y...L.....RYCGE........................PRTL....WQ.WFE.....PY..IEDDE.---------..............EFSPG...tNGRVTKMGVYIR.DLL.......LHQHY...FD..T..IFPRIPVPVARQ---ias..................................................................
Q17D08_AEDAE/10-175                  ...............................................KNVHGTNPQYLIEKIIRSRIYD..S.KYWKEQCFALTA................................-ELLVDKAMD-..IRYLGG..............-VFG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IVV.EFIK...............................................NEEFK..YVRALGAF....Y...L.....RLTGS........................SLDC....YK.YLE.....PL..YNDNR.KLRRQNRLG..............-----....HYELVHMDEFID.ELL.......REERA...CD..I..ILPRIQKRHVLEEN-n....................................................................
J3MB67_ORYBR/4-166                   ........................................qssgrpi--------DVLMEKVLSVNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.SSAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYVAE........................PKTL....WS.WYE.....PY..IKDDE.---------..............EFSPG...sNGKMTTMGVYVR.DLL.......LGQYY...FD..S..LLPRVPLPI------lrqvt................................................................
S9WUU7_9TRYP/1-95                    ...............................................----------------------..-.------------................................-----------..------..............----.---.............................................--.----------.--------..........---.-MLR...............................................QDVHK..YLRVGALF....L...I.....RLIGN........................PAMQ....RE.AMK.....IG..FDDYR.KIRVYGNEE..............ERET-....------------.---.......-----...--..-..---------------sstkrpreeeekdakewdstyapiihphyfimrldeiterlfl..........................
A0A0D3C5H0_BRAOL/10-175              ...............................................KNIRGTNPQNLVEKIVRTKIQN..H.TFWKEQCFGLTA................................-ETLVDKAME-..LDHVGG..............-TFG.GNR.............................................KP.TPFLCLVLKM.LQIQPEKE..........IVV.EFIK...............................................NDDYK..YVRVLGAF....Y...L.....RLTGS........................DVDV....YR.YLE.....PL..YNDYR.KVRQKLADG..............-----....RFSLTHVDEVIE.ELL.......TKDYS...CD..I..AMPRLKKRCTLEQN-g....................................................................
E7LUN2_YEASV/15-219                  ...............................................KQLNNQSVSLVIPRLTRDKIHN..S.MYYKVNLSNESLrg............................ntMVELLKVMIGA..FGTIKGqng.......hlhmMVLG.GIE.............................................--.--FKCILMKL.IEIRPNFQ..........QLN.FLLNvk..........................................nenGFDSK..YIIALLLV....Y...A.....RLQYYylngn.............nkndddENDL....IK.LFKvq.lyKY..SQHYF.KLKSFPLQVdc..........faHSYNE....ELCIIHIDELVD.WLA.......TQDHI...WG..I..PLGKCQWNK------iynsde...............................................................
A0A0M9EYH7_9HYPO/26-192              .............................................ap---NGLNPATIMEKAVRDRIVD..S.IYYKMQCFACNE................................-ADIVDRVVED..VKFIGG..............-TYG.TTQ.............................................VP.SPFLCLAFKL.LELSPSDA..........VLL.EYLKf.............................................gGEAFK..YLRALACF....Y...F.....RLTRQ........................AKDV....YE.MLE.....PF..LEDRR.KLRRRGREG..............-----....-VKLSYMDEFVD.ELL.......TKERV...CG..T..SLWKMPKREVLEDL-e....................................................................
A0A067QAN7_9HOMO/10-173              ..............................................q-AIHGQNPQFLVETVIRNRIWE..S.AYWKEHCFALTA................................-ESLIDKAIE-..VKAIGG..............-VYG.N-Q.............................................KP.TEFMCLLLKL.LQIQPEKE..........ILV.EYLQ...............................................ADEFK..YLRALAVM....Y...I.....RMTFA........................SAEV....YG.LLE.....PL..LKDYR.KLRYRNTAG..............-----....-YTLTYFDEFVD.QLL.......HDERV...CD..I..ILPRLAKRSVLEEN-g....................................................................
B0WBK3_CULQU/28-154                  ..............................................l-PLWGNESTMNLNPLILANIQG..S.SYFKVSLFKLKT................................YHEVVDEIYYQ..VKHLEP..............WERG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAFCLLYKL.YTLRLTRK..........QVN.GLLT...............................................HTDSP..YIRALGFM....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------ncfiksrcvt...........................................................
D7LFT1_ARALL/10-175                  ...............................................KNIRGTNPQNLVEKIVRTKIYQ..H.TFWKEQCFGLTA................................-ETLVDKAME-..LDHLGG..............-TFG.GSR.............................................KP.TPFLCLILKM.LQIQPEKE..........IVV.EFIK...............................................NDDYK..YVRILGAF....Y...L.....RLTGT........................DVDV....YR.YLE.....PL..YNDYR.KVRQKLADG..............-----....RFSLTHVDEVIE.ELL.......TKDYS...CD..I..AMPRLKKRWTLEQN-g....................................................................
A0A0N4XCA9_NIPBR/461-626             ..............................................h-TVKGTNPQFLVEKIIRQRIYD..S.KYWKESCFALSA................................-DLIVDRALD-..LRYIGG..............-IYA.GNV.............................................KP.TPFLCLALKM.LQIQPEKD..........IIV.EFIQ...............................................QEQSK..YARALGAM....Y...L.....RLTFT........................SVEI....YK.YLE.....PL..FNDYR.KLRYMNKQG..............-----....RFELVYMDEFID.NLL.......REERY...CD..I..QLPRLQKRQALEE--ag...................................................................
C4R8X3_PICPG/19-184                  ..............................................e-KIHGVNPVFLIDKILREKILD..S.LFWKKHCFLLDI................................-LELQDLASE-..VEIIGT..............YDTN.QNS.............................................RA.TDYICLLLKM.LQLQPKDE..........IVI.YMLT...............................................QPYFK..YVTALAAL....Y...I.....RLVFP........................SVRV....YQ.LLE.....PL..LNDYR.KLRIRKHGN..............-----....-ADLTYVDQLVD.ELL.......TEEKF...CG..L..TLPRLVNRLRLEDD-g....................................................................
E1ZNW2_CHLVA/10-175                  ..............................................a-AIHGTNPQNLIEYISRQKIYD..S.IYWKQECFGLSA................................-ERLVDKAVE-..ITEVGG..............-MQG.EPQ.............................................KP.THFICLILKM.LQIQPDKD..........IVV.EFIK...............................................NDDFK..YLRLLGAF....Y...M.....RLVGR........................PLDV....YQ.YLE.....PL..YNDYR.KVRIRNFQG..............-----....RQELGHVDELID.AML.......HKDRL...FG..I..ALPRLPARTTLE---gag..................................................................
U6LKK7_9EIME/85-141                  ................................kdrqqkgdrketter----------------------..-.------------................................-----------..------..............----.---.............................................--.----------.--------..........---.----...............................................-----..--------....-...-.....-----........................----....--.---.....--..-----.-------RQ..............EGDIQ....GLRKETIGEYVQ.SLL.......TEDKY...FS..T..VLPRLPLL-------vknv.................................................................
E5S6X1_TRISP/427-610                 ..............................................l-NFWGNKETMNLNHLVLENIVS..S.PYYKNTLLPLKT................................HFEVIDEIYYN..VEHLEP..............WEKG.TRKttgqtgmcg...........................gvrgvgaggVV.SSAFCLLYKL.FTLKLTRK..........QLT.AILN...............................................HPDSC..YIRGLGFM....Y...I.....RFCLH........................PATF....WS.WYE.....PY..FEDSE.---------..............EIDPKa..gGGDLMTIGEMVK.SLL.......TKLDW...YS..T..LFPRIPVPIQKEI--d....................................................................
A9RSQ4_PHYPA/6-170                   ........................................vqtcgkp-------LDTLIERVLCTNILS..S.DYFK-ELFGLQT................................YTEVVDEIYNH..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKL.FTLKFTVK..........QMQ.DILD...............................................HPDSP..YIRALGFL....Y...L.....RYVGD........................PKTI....WD.WFE.....PY..VKDPE.---------..............EFSPG...sNKKMTTMGVYVR.DII.......LNQYY...FD..T..LFPRIPVPILR----qita.................................................................
A0A0G4L1S5_9PEZI/26-193              ............................................lap---NGENPAKIMEKAVIGRIVD..A.QYFQYQCFALNE................................-AGIVDRVVND..VKFIGG..............-TYG.SAQ.............................................KP.TPFLCLAFKL.LQLAPSDD..........VLE.TYLSf.............................................gGDKFK..YLRALACF....Y...I.....RMTRR........................ARDV....YA.ILE.....RY..LVDRR.KLRRKGRQG..............-----....-TSLTFVDEFVD.DLL.......TKTRV...CA..T..SFRELPRRTDLVD--lg...................................................................
G3PQV2_GASAC/24-208                  ..............................................l-PLWGNEKTMNLNPMILTNVLS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHAEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QLM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PADL....ID.WYD.....GF..LDDEE.---------..............ELDVKa..gGGCVMTVGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKL---idq..................................................................
K9FM30_PEND2/21-204                  ..............................................l--IRGVNPATLFEKAVRDRITD..S.YYWKEQCFGLNA................................-ATLCDRAVE-..LTSIGG..............-TYG.VSE.............................................KP.TPFLCLAFKL.LQLGPDRD..........VIL.ELLNytdpgsgdea...........................enpddalvkdRGDFK..YLRALAAF....Y...V.....RLTFD........................PVDV....YK.TLE.....PL..LLDYR.KLKRRVRDN..............-----....-FTLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKLPPRSQLEDL-d....................................................................
U7PR73_SPOS1/26-192                  .............................................ap---NGLNPATIMEKAVRERIVD..S.YFWKEQCFGVNE................................-ADIVDRVVEH..VSCIGG..............-TTG.TTQ.............................................KP.TPFLCLALKL.LQLAPDDA..........ILQ.AYLSq.............................................gGDKFK..YLRALALF....Y...I.....RLTRP........................AADV....YT.TLE.....PY..LADRR.KLRRKGRAG..............-----....-TQLTFVDEFVD.DLL.......VKTRV...CA..T..SLWKLPQREDLED--lg...................................................................
A0A067DBD0_CITSI/1-27                ...............................................----------------------..-.------------................................-----------..------..............----.---.............................................--.----------.--------..........---.----...............................................-----..----IGFL....Y...L.....RYAAD........................PKTL....WN.WFE.....QY..LKDEE.---------..............-----....------------.---.......-----...--..-..---------------.....................................................................
D8LU65_ECTSI/4-146                   ..............................................r----------------------..-.RYWKEHCFGLTA................................-ETLVDKAMM-..LTHLGG..............-TFG.GNQ.............................................QP.TKFLCLVLKM.LQIQPEKE..........III.EFIK...............................................NEDYK..YVRVLGAF....Y...L.....RLVGT........................PADI....YQ.YLE.....PL..YNDYR.KIRLRLTQG..............-----....-WELRTIDQQIE.ELL.......HSDIS...CS..I..ALPRLPKRVALEDS-k....................................................................
Q4WUN3_ASPFU/34-222                  ..............................................l--VRGVNPATLFEKAVRDRITD..S.YYWKEQCFGLNA................................-ATLCDRAVE-..LTSIGG..............-TYG.VAE.............................................KP.TPFLCLAFKL.LQLNPERE..........IIL.EYLNytdpgsdeetea......................taeeqarngvlgqRGDFK..YLRALAAF....Y...V.....RLTFD........................PVDV....YK.TLE.....PL..LLDYR.KLKRRVRDT..............-----....-FVLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKLPARQQLEDL-d....................................................................
H2PZJ2_PANTR/47-231                  ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
K2R9I0_MACPH/20-208                  .............................................al--IRGQNPALLFEKAVRDRITE..S.YYWKEQCFGLNA................................-ATLCDRAAE-..LTYIGG..............-TYG.GMG.............................................KA.TPFLCLAFKL.LQLVPEKE..........IIL.AYLNwpedeergsgdd.......................gededesrvpgtKGEFK..YLRALAAF....Y...I.....RLAWE........................PVEI....YK.TLE.....PL..LADYR.KLKRRMRDG..............-----....-FVLTFVDQFVD.DLL.......TKDRV...CA..T..SLWKLPPRTLLEDL-d....................................................................
A0A067GPW5_CITSI/2-84                .............................................ti----------------------..-.------------................................-----------..------..............----.---.............................................--.----------.--------..........---.----...............................................--TSK..YVRVLGAF....Y...L.....RLTGT........................DIDI....YR.YLE.....PL..YNDYR.KLRQKSGDG..............-----....RFILTHVDEVID.ELL.......TKDYS...CD..I..ALPRIKKRWNLET--vg...................................................................
F1S580_PIG/50-234                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
V7BIY7_PHAVU/10-175                  ...............................................KSIRGTNPQNLVEKILRSKIYQ..N.TYWKEQCFGLTA................................-ETLVDKAME-..IDHLGG..............-TYG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKE..........IVI.EFIK...............................................NEDYK..YVRILGAF....Y...L.....RLTGS........................DIDV....YR.YLE.....PL..YNDYR.KLRQKSSDG..............-----....QFTLTHVDEVID.ELL.......TKDYS...CD..I..ALPRVKKRWTLES--ld...................................................................
H3G9C3_PHYRM/9-173                   ..............................................l-SVHGVNPQTLVEKIMRNRIYA..S.IYWKEQCFGLTA................................-ETLVDKAVE-..LSDFGG..............-TFG.GNQ.............................................QP.TPFLCLLLKM.LQLQSEIE..........VVK.QFVE...............................................NEDYK..YVTVLGAV....Y...L.....RLVGK........................PADV....YT.LLE.....PL..LSDYR.KIRKRNVIG..............-----....-WEITHVDEIAD.ALL.......TEEYY...ID..L..TLPRLVDRGLLEK--ne...................................................................
F6ZP02_CIOIN/10-175                  ..............................................h-TVKGTNPQYLIEKIIRSRIYD..S.RYWKEQCFALTA................................-ELLVDKAMD-..LKYIGG..............-VYS.GNI.............................................KP.CPFLCLILKM.LQIQPDKD..........IIV.EFIR...............................................NEDFK..YVRCLGAF....Y...M.....RITGT........................SLDC....YK.YLE.....PL..LNDFR.KIKFQKREG..............-----....NFVITHMDEFID.ELL.......REERS...CD..V..ILPRIQKRQILEE--le...................................................................
X0BDR0_FUSOX/26-192                  .............................................ap---NGLNPATIMEKAVKDRIVD..S.YFYKEQCFALNE................................-ADIVDRVVEH..VNFIGG..............-TYG.VTQ.............................................KP.SPFLCLAFKL.LELSPSDA..........VLM.EYLKy.............................................gGEAFK..YLRALACF....Y...F.....RLTRQ........................AKDV....YE.MLE.....PF..LEDRR.KLRRRGRAG..............-----....-VVLTFMDEFVD.ELL.......TKERV...CG..T..SLWKMPKREVLEDL-e....................................................................
A0A091CPG3_FUKDA/10-175              ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0CFN0_PARTE/86-247                  ..............................................i-PIRGENAISNMNSLVRQNILT..C.PYYK-ELLQIRD................................INDIVTETDKI..VTSVGT..............WAG-.-PG.............................................VP.SSFFCILHKL.MSMNLNVK..........QLQ.ILCD...............................................WKLNP..YVRCLGLL....Y...L.....RYSLD........................PNFL....WG.WMK.....RY..ILDEQ.---------..............EFKPS....KDENITIGDFCE.RLL.......TDLNY...YN..T..RLPRIPQQIDT----iiqa.................................................................
V4NLP3_EUTSA/4-168                   ..............................................i-QTNGRAYESLLEKVLSMNILS..S.DYFK-ELYGLKT................................YHEVIDEIYNQ..VNHVEP..............WMGG.NCR.............................................GP.STAYCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HTDSP..YIRAVGFL....Y...L.....RYVAD........................AKTL....WT.WYE.....PY..IKDDE.---------..............EFAPG...sNGRMTTMGVYVR.DLL.......LGLYY...FD..T..LFPRIPVPVMR----qivs.................................................................
L9KRH9_TUPCH/54-238                  ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
A0A0M9VNM6_9BASI/10-174              ..............................................l-SIHGTNPQFLVERVIRTRIYD..S.TYWKQDCFALTA................................-ATLVDKAAE-..LTYVGG..............-TYG.MLR.............................................-P.SPFLCLVCKL.LQIQPEKS..........VIE.EYLA...............................................ADDLK..YLRAVAAM....Y...V.....RLTYP........................SMDV....YE.TLE.....PM..LNDYR.KLRWRDMTG..............-----....QYSLSHMDEFID.QLL.......TEERV...CD..L..ILPRLTKRTVLEAN-e....................................................................
K4BPW0_SOLLC/5-167                   .......................................ktsgrpid---------QLLEKVLCMNILS..S.DYFR-DLLRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYLGD........................FKTL....WG.WYE.....PY..LKDDE.---------..............EFSPG...sSGQMTTMGVYVR.DLF.......LGQYY...FD..T..LLPRIPVPVV-----rtav.................................................................
A0A061DDF0_BABBI/167-343             ............................................lpm----TNSSTYNLNTLLLSNILN..S.EYYK-SLSAINS................................YVDVMNELIQY..ADHAEP..............YCST.ATR.............................................AP.STLFCCLHKL.FTLRLTER..........QMT.ALVD...............................................CPKSP..YPRCCGFL....Y...L.....RFVLPsdqvrsl..........ngavmswPPQL....WD.WFE.....PY..LMDDE.---------..............SFVVSa..hPTRKTTIGEFCE.RLL.......VDDKY...FN..T..VLPRLPMRFK-----nrh..................................................................
E4UUK9_ARTGP/21-208                  ..............................................l--IRGVNPATLFEKAVRDRITD..S.YYWKEQCFGLNA................................-ATLCDRAVE-..LSYIGG..............-TYG.---.............................................--.---------L.LQLAPEKE..........VIL.EYLDfhdpeadeedsnakgdnsg.........aegnvedaqdradaailkaTGDFK..YLRALAAF....Y...V.....RLTFE........................PVEI....YK.TLE.....PL..LTDYR.KLKRRTKEG..............-----....-FLLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKIPARTMLEDL-d....................................................................
A0A0P7UWJ7_9TELE/10-175              ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LKYVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRLLGAM....Y...M.....RLTGS........................SVDC....YK.YLE.....PL..YNDYR.KIKTQNRNG..............-----....EFELMHVDEFID.ELL.......HGERV...CD..V..ILPRLQKRQVLEEA-e....................................................................
W4W0X9_ATTCE/37-225                  ..............................................l-PLWGNERTMNLNPLILTNIQS..S.HYFKVNLYELKT................................YHEVIDEIYYK..VSHLEP..............WEKG.SRKtagqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.FTLRLTRK..........QLN.GLIN...............................................HPDSP..YIRALGFM....Y...IstvtiRYTQP........................PADL....FS.WYN.....DY..LEDEE.---------..............ELDVKa..gGGQVMKMGDILK.QFL.......TKLEW...FS..T..LFPRIPVPIQKD---le...................................................................
Q0CIC3_ASPTN/21-209                  ..............................................l--VRGVNPATLFEKAVRDRITD..S.YYWKEQCFGLNA................................-ATLCDRAAE-..LTALGG..............-TYG.VAE.............................................KP.TPFLCLAFKL.LQLNPERE..........IIL.EYLNftdpgsddedeq......................taeeqaqngvvkqRGDFK..YLRALAAF....Y...V.....RLTFD........................AVDV....YK.TLE.....PL..LLDYR.KLRRRVRDS..............-----....-VVLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKLPPRQQLEDL-d....................................................................
C1ML42_MICPC/10-175                  ..............................................r-SINGLNPQAIIEKITRTKIYE..S.PFWKERCFGVSA................................-ATLVDLAMN-..LRAFGG..............-VYG.SSS.............................................KA.TDFLCLTLKM.LQIQPDKE..........VIL.EFIK...............................................NEDCK..YVRILGAF....Y...L.....RLVGK........................SFEV....YQ.LLE.....PL..LLDYR.KIRHQTSQG..............-----....NFELMHVDEFVS.ALL.......TRDNF...CD..I..SLPRLTHRQLLET--sg...................................................................
A0A0C2IZB7_THEKT/10-175              ..............................................i-NVRGTNPQFLLDKIVRSRIYE..A.RFWLEECFALTA................................-ELLVDKIVD-..LKYIGG..............-CYG.GNS.............................................KA.SNFLCLLLKM.LQIQPEKE..........III.EFLR...............................................NEEYK..YMRALAAI....Y...V.....RLVFP........................AVDC....YN.YLE.....PL..YLDYR.KLRFMKSDG..............-----....KFKVITMDEYID.SLL.......RDERV...CD..I..IMPTLPLRRVLEEL-d....................................................................
K3ZVF4_SETIT/1-99                    ...............................................----------------------..-.------------................................-----------..------..............----.---.............................................--.---------M.LQIQPDKD..........IVV.EFIK...............................................NEDYK..YVRVLGAF....Y...M.....RLTGT........................VADV....YQ.YLE.....PL..YNDYR.KLRHKLSDG..............-----....QFALTHVDEFID.ELL.......TKDYS...CD..T..ALPRIQKRWVLEA--sg...................................................................
G6DFN0_DANPL/10-175                  ...............................................KSIRGTNPQYLIEKIIRSRIYD..S.KYWKEECFALTA................................-ELLVDKAME-..LRYIGG..............-VHG.GFI.............................................YP.TPFLCLVLKM.LQIQPEKD..........IVV.EFIK...............................................NEEFK..YVRALGAF....Y...M.....RITGS........................SLDC....YK.YLE.....PL..YNDNR.KLRRQNREG..............-----....QFEIVHVDEFID.ELL.......REERL...CD..V..ILPRIQKRHILEEN-n....................................................................
F7AMT8_CALJA/47-190                  ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.---------..............-----....------------.---.......-----...--..-..---------------hftl.................................................................
A0A0D2US18_GOSRA/10-175              ...............................................KSIRGTNPQNLVEKIVRSKIYQ..N.TYWKEQCFGLTA................................-ETLVDKAME-..LDHIGG..............-TYG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKD..........IVV.EFIK...............................................NDDYK..YVRVLGAF....Y...L.....RLTGI........................DSDI....YR.YLE.....PL..YNDYR.KVRRKSPDG..............-----....NFMLTHVDEVID.ELL.......TRDYS...CD..I..ALPRIKKRWTLES--lg...................................................................
B3LAT7_PLAKH/162-322                 ............................................lem----TNTTTYNVNTLLRNNILS..S.EYFR-SLVPLKT................................FKEVVEEIHLY..ADHVEP..............YCIG.STR.............................................AP.STLFCCLYKL.FTMHLSEK..........QM-.-LIE...............................................SRESC..YIRACGFL....Y...L.....RYVHS........................PANL....WM.WFE.....PY..LLDED.---------..............EFITSa..dKRKKQTIGEYTQ.CLL.......ADDKY...FN..T..VLPRMPIKIK-----nty..................................................................
A0A0F4ZI01_9PEZI/24-191              ............................................lap---NGLNPATIMEKAVRERIID..S.YFYKEQCFALNE................................-ADIVDRVVEY..VQFVGG..............-TYG.VTQ.............................................KP.TPFLCLAFKL.LQLAPSDA..........VLT.EYMQl.............................................gGEHFK..YLRALACF....Y...V.....RMTRP........................AKQC....YQ.LLE.....PF..LEDYR.KLKRKGRNG..............-----....-TVLTYMDEFVD.DLL.......VKERV...CG..T..SLWKMPKREVLEDM-d....................................................................
E7QER7_YEASZ/15-219                  ...............................................KQLNNQSVSLVIPRLTRDKIHN..S.MYYKVNLSNESLrg............................ntMVELLKVMIGA..FGTIKGqng.......hlhmMVLG.GIE.............................................--.--FKCILMKL.IEIRPNFQ..........QLN.FLLNvk..........................................nenGFDSK..YIIALLLV....Y...A.....RLQYYylngn.............nkndddENDL....IK.LFKvq.lyKY..SQHYF.KLKSFPLQVdc..........faHSYNE....ELCIIHIDELVD.WLA.......TQDHI...WG..I..PLGKCQWNK------iynsde...............................................................
E2B9R7_HARSA/37-220                  ..............................................l-PLWGNERTMNLNPLILTNIQS..S.HYFKVNLYELKT................................YHEVIDEIYYK..VSHLEP..............WEKG.SRKtagqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.FTLRLTRK..........QLN.GLIN...............................................HPDSP..YIRALGFM....Y...I.....RYTQP........................PADL....FS.WYS.....DY..LDDEE.---------..............ELDVKa..gGGQTMKMGDILK.QFL.......TKLEW...FS..T..LFPRIPVPIQKD---le...................................................................
U3JJ31_FICAL/50-200                  ....................................tgasikplsqv----------------------..-.------------................................---------E-..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKAI--dq...................................................................
U3IDW8_ANAPL/1-111                   ..............................................x----------------------..-.------------................................-----------..------..............----.---.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HEERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
S9VCB1_9TRYP/46-244                  .............................................wn--LQGRSAFAVLDPTTRHRIAH..A.HNMT-RCRDQPL................................-LWVLEELIT-..IESVGG..............-LSG.PLF.............................................RV.EYFLCLVARV.LQAAPDPA..........VVL.ALLR...............................................QDVHK..YLRVAALF....M...I.....RLIGN........................VAMQ....KE.AVR.....VG..WDDYR.KIRVYGDEG..............EVD--....------------.---.......-----...--..-..---------------yvfdatlrgrkhpreaaegeqppvnieeakpahyfilcmdeltdrlfrvdsdgekrsqffgvplpplmf
H9JWH7_BOMMO/10-175                  ...............................................KSIRGTNPQYLIEKIIRSRIYD..S.KYWKEECFALTA................................-ELVVDKAME-..LRYVGG..............-VHG.GFI.............................................YP.TPFLCLVLKM.LQIQPEKD..........IVV.EFIK...............................................NEEFK..YVRALGAF....Y...M.....RLTGT........................SVDC....YK.YLE.....PL..YNDNR.KLRRQNRDG..............-----....QYEIVHMDEFID.ELL.......REERL...CD..I..IMPRIQNRHILEQN-n....................................................................
A0A0L1L023_9EUGL/103-269             ..........................................vpnta--------QYNMDDSLWNKVQDylQ.KLRKGNLMSLSN................................QDAIVKYIAAN..VRHINA..............--FD.K-E.............................................EP.SLFFALLVMY.MDLGISED..........RVR.SLLV...............................................HE-CA..YVKAAGVV....I...A.....RYVFS........................PSQT....DD.ILV.....TT..QLLGR.SMNEIVESS..............HIVNV...vQGESLTIPALIG.NLI.......EHDEF...LE..A..WFPIY----------ssvhhvi..............................................................
M0Z3R6_HORVD/3-165                   ...........................................lqts----GRPIEVLMEKVLSMNIVS..S.DYFK-ELYKIKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKL.FTMKLTVN..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYAAD........................PKTL....WT.WYE.....PY..IQDDE.---------..............EFSPG...sNGKMTTMGVYVR.DVI.......LGQYY...FD..S..LLPRVPL--------lilrqv...............................................................
Q4YX53_PLABA/179-341                 ............................................lem----TNTSTYNVNNLLRNNILS..S.EYFR-SLITLKT................................FKEVLDEILSY..ADHAEP..............YCIG.STR.............................................AP.STLFCCLYKL.FTMHLSKK..........QLK.SLIE...............................................NKESC..YVRACGFL....Y...L.....RYVHS........................PSNL....WM.WFE.....PY..LLDDE.---------..............EFTVSa..dKRKLMTIGEYAQ.SLL.......YDDKY...FN..T..VLPRFPIKIK-----niy..................................................................
A0A078JHH0_BRANA/4-168               ..............................................i-QTNGRAYESLLEKVLSMNIVS..S.DYFK-ELYGLKT................................YHEVIDEIYNQ..VSHVEP..............WMGG.NCR.............................................GP.STAYCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HTDSP..YIRAVGFL....Y...L.....RYVAD........................AKTL....WT.WYE.....PY..IKDDE.---------..............EFAPG...sNGRTTTMGVYVR.DLL.......LGLYY...FD..T..LFPRIPVPVMR----qivs.................................................................
A0A0E0L7N6_ORYPU/101-262             ........................................qssgrpi--------DVLMEKVLSVNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.SSAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAVGFL....Y...L.....RYVAE........................PKTL....WS.WYE.....PY..IKDDE.---------..............EFSPG...sNGKMTTMGVYVR.DLL.......LGQYY...FD..S..LLPRVPL--------lilrqv...............................................................
E6ZP67_SPORE/10-174                  ..............................................v-SIHGTNPQFLIEKPVRARIYE..S.PFWKEHCFALSA................................-ATILPLATS-..LHHIGG..............-LVG.L-Q.............................................RP.SHFLCLLQKL.LQIQPEPA..........IVS.AYLG...............................................ARQFK..YLRALAAF....Y...V.....RLTYK........................STDI....YT.LLE.....PL..LEDGR.KLRWRGSGG..............-----....EFSIVHMDEWID.MLL.......AEERV...CD..I..ILPRLTRRDVCET--rd...................................................................
B3SEX8_TRIAD/10-175                  .............................................vt--VKGTNPQYLVEKITRSRIYE..C.KYWKEKCFAVTA................................-ELLVDRAME-..LDHIGG..............-TFG.GNI.............................................KP.TPFLCLILKM.LQIQPEKD..........IIV.EFIK...............................................NEDYK..YVRALGAI....Y...M.....RLVGT........................SNDC....YN.YLE.....PL..YNDFR.KLKRKQRSG..............-----....QFQVIHMDEFVE.ELL.......TEDRA...CD..T..ILPRIQKRYILEQ--tn...................................................................
B8NUH3_ASPFN/21-209                  ..............................................l--VRGVNPATLFEKAVRDRITD..S.YYWKEQCFGLNA................................-ATLCDRAVE-..LTSIGG..............-TYG.VSE.............................................KP.TPFLCLAFKM.LQLNPDRD..........IVL.EYLNftdpvndeegeq......................taaeqaengvvkqRGDFK..YLRALAAF....Y...V.....RLTFD........................AVDV....YK.TLE.....PL..LLDYR.KLKRRVRDS..............-----....-VVLTYVDQFVD.DLL.......TKDRV...CG..T..SLWKLPSRQQLEDL-d....................................................................
N6TV19_DENPD/10-175                  ...............................................KSIHGTNPQYLVEKIIRSRIYD..S.KYWKEECFALTA................................-ELLVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IVV.EFIK...............................................NEEFK..YVRALGAF....Y...M.....RLTGS........................SLDS....YK.YLE.....PL..YNDNR.KLRRQNRQA..............-----....QFELVHVDEFID.ELL.......REERV...CD..V..ILPRLQKRHILEEN-n....................................................................
A0A0N5AD73_9BILA/46-230              ..............................................l-PLWGNTQTMNLNALVLENIIQ..C.TYYKNYLAEATG................................FQQLTEEIYYN..VKHLEP..............WERG.TRKtqgmtgmcg...........................gvrgvgaggVV.STAFCLLYKL.FTIRLTRK..........QLV.SMIN...............................................NRDSP..YIRGIGFM....F...I.....RFCQP........................PIDL....WA.WME.....PY..LDDEE.---------..............QIDPRs..gGGDIMTMGQVVK.MML.......TKLDW...YG..T..LFPRIPVPIQKEIE-q....................................................................
A0A078F0Q5_BRANA/10-175              ...............................................KNIRGTNPQNLVETIVRKKIHD..H.TFWKEQCFGLTA................................-ETLVDKAME-..LDHVGG..............-TFG.GNR.............................................KP.TPFLCLVLKM.LQIQPEKE..........IVV.EFIK...............................................NDDYK..YVRVLGAF....Y...L.....RLTGS........................DADV....YR.YLE.....PL..YNDYR.KVRQKLADG..............-----....RFSLTHVDEVIE.ELL.......TKDYS...CD..I..AMPRLKKRCTLEQN-g....................................................................
A0A067K8T2_JATCU/1-123               ..............................................m----------------------..-.------------................................----------E..LDHLGG..............-TYG.GNR.............................................KP.TPFMCLVMKM.LQIQPQKD..........IVV.EFIK...............................................NDDYK..YVRILGAF....Y...L.....RLTGT........................DVDV....YR.YLE.....PL..YNDYR.KLRQKLPDG..............-----....KFDLIHVDEVIH.ELL.......TKDYS...CD..V..ALPRIKKRWTLE---si...................................................................
D6WU66_TRICA/10-175                  ...............................................KSIHGTNPQYLVEKIIRSRIYD..S.KYWKEECFALTA................................-ELLVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IVV.EFIK...............................................NEEFK..YVRALGAF....Y...M.....RLTGS........................SLDC....YK.YLE.....PL..YNDNR.KLRRQNRQA..............-----....QFEIVHMDEFID.ELL.......REERV...CD..V..ILPRIQKRIVLEES-n....................................................................
A0A093ZLY5_9PEZI/22-189              ............................................lap---NGLNPATIFEKPVRERIID..C.YFWKDQCFALNE................................-ADIVSRVVEH..VQFVAG..............-TYG.DSQ.............................................RP.SPFLCLAFKL.LQLGPGDD..........ILK.EYLGy.............................................gGEKFK..YLRALACF....Y...V.....RLTRP........................AKEI....YE.TLE.....PF..LEDAR.KLRRRGRQG..............-----....-TSLTFMDQFVD.ELL.......TKERV...CA..T..SLWKMPKREVLEDL-e....................................................................
Q7RLR8_PLAYO/1-56                    ..............................................m----------------------..-.------------................................-----------..------..............----.---.............................................--.----------.--------..........---.----...............................................-----..--------....-...-.....-----........................----....--.WFE.....PY..MLDDE.---------..............EFTVSa..dKRKLMTIGEYVQ.SLL.......YDDKY...FN..T..VLPRLPIKIK-----niyga................................................................
M7YZV4_TRIUA/100-177                 ............................................mey----------------------..-.------------................................-----------..------..............----.---.............................................--.----------.--------..........---.----...............................................---SY..FLQQIGFL....Y...L.....RYAAD........................PKTL....WT.WYE.....PY..IQDDE.---------..............EFSPG...sNGKMTTMGVYVR.DVI.......LGQYY...FD..S..LLPRVPL--------lilrqv...............................................................
S9X1J3_9CETA/10-175                  ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
X2JF51_DROME/24-141                  ..............................................l-PFWGNESSMNLNALILANIQS..S.SYFKVHLFKLKT................................YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.YTLRLTRK..........QIN.GLLN...............................................HTDSA..YIRALG--....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------rcw..................................................................
E6X8B2_CELAD/97-274                  .............................................ka----------------------..-.--YKEVLYHSFI................................-NKMEDDIITD..VQFHHY..............NIDN.FKT.............................................IL.NNSLGKYYKY.VVMGFDHK..........QVA.KTLAkipnndlllidwninstpe.........nnyvfqdfgrsfykglesiTENFK..KYKALHFL....Y...P.....NYTNH........................AKET....VD.YFE.....KY..CQDNN.----FE---..............-YQIK...tNPQEYTIEKGVA.YLS.......VSDRV...LG..I..FLEQCRKQ-------nlep.................................................................
A0A022QWG5_ERYGU/5-166               ...........................................kssg-----RSIDQLLEKVLCMNILS..S.EYFR-DLLRLKT................................YHEVIDEIYVT..VTHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKTL....WS.WYE.....PY..LKDDE.---------..............EFSPG...sNGRTATMGAYVI.DLL.......LGQYY...FD..T..LFPRIPVPVM-----rtv..................................................................
A0A096Q427_MAIZE/1-86                ...............................................-----------MEKVLSVNILS..S.DYFK-ELFKYKT................................YHKVVDEIYNQ..VDHVEP..............WMTD.NCR.............................................GP.SSAFCLLYKL.FTMKLTVK..........QMH.GLLK...............................................HQDSP..YIRA----....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------ewl..................................................................
A0A078GCR5_BRANA/10-175              ...............................................KNIRGTNPQNLVEKIVRTKIYN..H.TFWKEQCFGLTA................................-ETLVDKAME-..LDHVGG..............-TFG.GNR.............................................KP.TPFLCLILKM.LQIQPEKE..........IVV.EFIK...............................................NDDYK..YVRILGAF....Y...L.....RLTGS........................DVDV....YR.YLE.....PL..YNDYR.KVRQKLSDG..............-----....RFSLTHVDEVIE.ELL.......TKDYS...CD..I..AMPRLKKRWTLEQN-g....................................................................
Q86IV3_DICDI/48-212                  ...............................................KSIHGVNPRNLIEKITRIKIQS..H.PYWKEKCIGLNE................................-ESLVDRAMA-..LESYGG..............-CFG.GNK.............................................QP.THFLCLLLKM.LQIQPEMD..........IIK.EFIE...............................................NEDFK..YVRILGAI....Y...L.....RLVGK........................PVDI....YN.QLD.....PL..YKDFR.ALRRKTDMG..............-----....-STKVFVDQFIE.ELL.......TTNYS...CD..I..ALPHIPSRANLIQ--qs...................................................................
A0A094FSS4_9PEZI/22-189              ............................................lap---NGLNPATIFEKPVRERIID..C.YFWKDQCFALNE................................-ADIVSRVVEH..VHFVAG..............-TYG.DSQ.............................................RP.SPFLCLAFKL.LQLGPGDD..........ILN.EYLGy.............................................gGERFK..YLRALACF....Y...V.....RLTRP........................AKEV....YE.TLE.....PF..LEDGR.KLRRRGRQG..............-----....-TTLTFVDQFVD.ELL.......TKERI...CA..T..SLWKMPKREVLEDL-e....................................................................
J9JZ53_ACYPI/30-214                  ..............................................m-PVWGNERTMNLNTLILTNIQS..S.HYFKVNLYELKT................................YHEVIDEIYYK..VQHLEP..............WEKG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAFCLLYKL.FTLKLTRK..........QVT.GLIT...............................................HCDSP..YIRALGFM....Y...I.....RYTQP........................PGDL....WD.WYE.....SF..LDDEE.---------..............EMDVRa..gGGQTMTIGNILK.SFL.......FKLEW...YS..T..LFPRIPVPIQQQM--ek...................................................................
U4L199_PYROM/27-190                  ..............................................e-TIHGGNPLLLVEKIIRDRILD..S.LYWKELCFGLNA................................-ATLLDRATE-..LTYLGG..............-TY-.SNQ.............................................KP.TPFICLLLKL.LQLQPEKP..........ILL.AYLQ...............................................DPEFK..YLRCLAAL....Y...I.....RLTWK........................TVEI....FQ.TLE.....PL..MGDYR.KVRIRGMGG..............-----....-WRLGYVDEFID.SLL.......VEERV...CD..I..ALPRMMTRAQLED--lg...................................................................
W2R409_PHYPN/9-173                   ..............................................q-SVHGVNPQTLVEKIMRNRIYA..S.IYWKEQCFGLTA................................-ETLVDKAVE-..LQEFGG..............-TFG.GNQ.............................................QP.THFLCLLLKM.LQLQPELE..........VVK.QFIE...............................................NEDYK..YVTVLGAV....Y...L.....RLVGK........................PLEV....YT.LLE.....PL..LSDYR.KIRKRNVIG..............-----....-WEITHVDEIAD.ALL.......HEEYY...ID..L..ALPRLADRELLEKN-e....................................................................
A0A0N4X4R7_HAEPC/1-161               ...............................................-----TNPQFLVEKIIRQRIYD..S.KYWKESCFALSA................................-DLIVDRALD-..LRYIGG..............-IYA.GNV.............................................KP.TPFLCLALKM.LQIQPEKD..........III.EFIQ...............................................QEQSK..YARALGAM....Y...L.....RLTFS........................SVEI....YK.YLE.....PL..FNDYR.KLRYMNKLG..............-----....RFELVYMDEFID.NLL.......REERY...CD..I..QLPRLQKRQALED--ag...................................................................
V4T5N8_9ROSI/10-175                  ...............................................KSIRGTNPQNLVEKIVRSKIYQ..N.TYWKEQCFGLTA................................-ETLVDKAME-..LDHLGG..............-TFG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKD..........IVV.EFIK...............................................NDDYK..YVRVLGAF....Y...L.....RLTGT........................DIDI....YR.YLE.....PL..YNDYR.KLRQKSGDG..............-----....RFILTHVDEVID.ELL.......TKDYS...CD..I..ALPRIKKRWNLE---tvg..................................................................
K1Q5L4_CRAGI/7-191                   .............................................lp--NWGNEKTMNMNPLILTNIQA..S.PYFKVNLYELKT................................YHEVIDEIYYK..VDHLEP..............WEKG.SRKtagqtgmcg...........................gvrgvgaggIV.SSAYCLLYKL.YTLKLTRK..........QLM.GLIT...............................................HKDSP..YIRGLGFM....Y...I.....RYCQD........................PKDM....WD.WYE.....PY..LDDEE.---------..............EIDVKa..gGGHKMTMGEVLR.QWM.......VKLEW...YS..T..LFPRIPVPIQKD---lmq..................................................................
A0A078CCT6_BRANA/4-168               ..............................................i-QTNGRAYESLLEKVLSMNIVS..S.DYFK-ELYGLKT................................YHEVIDEIYNQ..VSHVEP..............WMGG.NCR.............................................GP.STAYCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HTDSP..YIRAVGFL....Y...L.....RYVAD........................AKTL....WT.WYE.....PY..IKDDE.---------..............EFAPG...sNGRTTTMGVYVR.DLL.......LGLYY...FD..T..LFPRIPVPVMR----qivs.................................................................
U3JST2_FICAL/1-134                   ............................................laa----------------------..-.------------................................-ELVVDKAME-..LKYVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HEERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
M1C6B4_SOLTU/5-167                   .......................................ktsgrpid---------QLLEKVLCMNILS..S.DYFR-DLLRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYLGD........................FKTL....WG.WYE.....PY..LKDDE.---------..............EFSPG...sSGQMTTMGVYVR.DLF.......LGQYY...FD..T..LLPRIPVPVV-----rtav.................................................................
X6NM44_RETFI/10-176                  ..............................................r-QMHGTNPQWLVDKMIRGKVYD..S.LYWKEHCFALTA................................-ELLIEKVIKH..VRYVGG..............-MHG.GMK.............................................RP.CEFLCLLIKL.LQIQPKKE..........III.EFIK...............................................QKEFK..YLRILSAF....Y...F.....RLIYD........................SVEI....YT.YLE.....PL..LNDYR.KIVEIDRNG..............-----....KFHLTHVDEIID.QFL.......QERFL...FG..I..NLPHLIDRSVLEK--ng...................................................................
D3B1N8_POLPA/3-164                   ............................................lev----HGNKSMNLDQILLTNIQS..S.QYFK-SLYNLKT................................YHEVLSEINNH..VEYLCP..............YIP-.NTK.............................................TP.SSAYCLLFKL.YTMKMTEN..........QMN.GIVT...............................................-HDSP..FVRAVGFL....Y...L.....RYCFP........................PANL....WS.WWG.....EA..LGDQE.TIKVTPRS-..............-----....--DPITVEELLI.QLV.......REQRF...AD..T..ILPRIPVKVMKEL--ed...................................................................
G3TI91_LOXAF/47-231                  ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
A0A015NFA3_9GLOM/10-174              ..............................................i-AVHGTNPQYLIEKIMRTRIYE..S.LYWKEFCFGLTA................................-ETLIDRAIE-..LTSFGG..............-EYG.N-Q.............................................KP.TEFLCLTLKL.LQLQPNKD..........IVM.EFIR...............................................NEDYK..YLRVLGAF....Y...L.....RLVGN........................SLEI....YQ.TLE.....PL..LNDYR.KLRKRTSEG..............-----....DFEIVCVDEFIE.ELL.......KEERV...CD..T..ILPRMLKRHVLEEN-g....................................................................
B8C555_THAPS/10-167                  ..............................................h-SVHGTNPQNLVEYITRQKIYD..S.LYWKEECFGLSA................................-SDVATKATD-..LKALGG..............-SYG.GNN.............................................KP.TRFLCLALKL.LQIQPEEG..........IVE.EFLE...............................................NEEFK..YVRALGAF....Y...L.....RLTGR........................PAEI....YE.LIE.....PL..FNDFR.KLRFRESTG..............-----....-WKVTYMDELAD.ELL.......TSDRY...CG..I..ALPHLPKR-------.....................................................................
F6V7L2_ORNAN/39-223                  ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
G3VXQ4_SARHA/1-133                   .............................................sa----------------------..-.------------................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A093YW19_9PEZI/22-189              ............................................lap---NGLNPATIFEKPVRERIID..C.YFWKDQCFALNE................................-ADIVSRVVEH..VQFVAG..............-TYG.DSQ.............................................RP.SPFLCLAFKL.LQLGPSDD..........ILK.EYLGy.............................................gGERFK..YLRALACF....Y...V.....RLTRP........................AKEV....YE.TLE.....PF..LEDGR.KLRRRGRQG..............-----....-TSLTFVDQFVD.ELL.......TKERI...CA..T..SLWKMPKREVLEDL-e....................................................................
A0A0M3ILB4_ASCLU/165-201             ..............................................l----------------------..-.------------................................-----------..------..............----.---.............................................--.----------.--------..........---.----...............................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------..............-----....--QLVYMDEFID.NLL.......RQERY...CD..I..QLPRLQSRQALEE--vg...................................................................
F2UNQ1_SALR5/10-175                  ..............................................r-SVHGTNPQFIVDKIIRSRIYE..T.LYWKEQCFALTA................................-ETVIEKAVE-..LTYVGG..............-VYG.GNI.............................................RP.TPFLCLTLKL.LQLQPDKD..........III.EYIK...............................................NEDFK..YLRALGAF....Y...L.....RLVGT........................SMDC....YR.YIE.....PL..LNDYR.KLKRMSRNG..............-----....VMELTHMDEFVD.ELL.......REDRV...CD..I..GLPRIQKRYALEV--nd...................................................................
D8TND3_VOLCA/10-177                  ...............................................KTVHGTNPQNLVEYIVRQKIYQ..T.VFWKEKCFALTA................................-ETMLEVAVN-..LKSVGG..............-TVG.GQR.............................................KP.SDFLCLLLKM.LQIQPDKE..........IVI.EYIK...............................................NEDFK..YVRLLGAF....Y...M.....RLVGK........................PLEV....YQ.YLE.....PL..YNDYR.KATVRLQAV..............---EG....HFMLTHVDEVVD.DML.......RKDFL...FD..I..ALPRVPARLTLEK--lt...................................................................
B9SR85_RICCO/3-167                   ..........................................iqtsg-----KPIDSLLEKVLCMNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HKDSP..YIRAIGFL....Y...L.....RYAAD........................AKTL....WN.WCE.....PY..IKDDE.---------..............EFSPG...sNGRNTTMGVYVR.DLL.......LGQYY...FD..T..LFPRIPVPVMR----qivs.................................................................
A0A023BDW0_GRENI/56-217              ............................................lem----TNTTSYNLNPMLKENILV..S.EYYK-SLYQFTT................................VPELIDEVVQY..VDHVEP..............HVTG.HLK.............................................IP.STFACCLYKL.FNLRCTED..........EML.TITE...............................................HPNL-..FVRTLGFV....W...L.....RFVHP........................PEKL....WQ.WFE.....TV..VLDDT.---------..............DFRPT....KNQTTTFGEFAE.SLL.......KEDRY...FN..T..PLPRLPAKIRTH---tnk..................................................................
A0A0D3GCQ3_9ORYZ/4-150               ........................................qssgrpi--------DVLMEKVLSVNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.SSAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAVGFL....Y...L.....RYVAE........................PKTL....WS.WYE.....PY..IKDDE.---------..............EFSPG...sNGKMTTMGVYVR.DLL.......L----...--..-..---------------gqcpl................................................................
U5HBW6_USTV1/10-174                  ..............................................l-SIHGTNPQYLIEKVIRARIYD..S.LYWKEHCFALDA................................-ATVIDEALK-..LQYLGG..............-TYA.NTR.............................................-P.TEFMCLTLKL.LQLQPERE..........IIL.EYLR...............................................AEEFK..YLRALAAF....Y...V.....RLTFD........................PVNV....YE.VLE.....PL..FDDYR.KLRTRGMDG..............-----....AYSITTIDEFCD.QLL.......SEERV...CE..I..QLPRLTQRRVLEET-e....................................................................
M5XQR0_PRUPE/1-124                   ..............................................m----------------------..-.------------................................----------E..LDHIGG..............-TFG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKE..........IVI.EFIK...............................................NDDYK..YVRILGAF....Y...L.....RLTGT........................DTDV....YQ.YLE.....PL..YNDYR.KLRRKLADG..............-----....NYALTHVDEVID.ELL.......TKDYS...CD..I..AMPRIKKRWTLEA--tg...................................................................
H2ARW2_KAZAF/14-209                  ...............................................KQLNHQSVSLIIPRLTRDRIHN..N.IYYKVNLQPTSLrg............................dtLLELSKVIIRD..LGTLKDlsv........nkvHVLG.GME.............................................--.--FKCLLMKL.IEIRPTIN..........QLF.AMLNpan.........................................antNFEDK..YITALIIT....Y...L.....RIQYFylt.................daqeCLRM....KN.LFK.....KC..IKDYR.KLKSLSLQSdc..........wsPSEEL....TVAVVHMDELTE.WLV.......SKEQI...WG..I..PLGKCQWA-D-----ifddd................................................................
C4WV68_ACYPI/10-175                  ...............................................KTIHGTNPQYLIEKIIRSRIYD..N.KFWKEECFALSA................................-ELLVDKAML-..MRFIGG..............-VFG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEEFK..YVRALGAF....Y...M.....RLTGS........................SVDC....YK.YLE.....PL..LADSR.KLRRQNRDG..............-----....QFELIYIDEFID.SLL.......RDERV...CD..V..ILPRIQSRHVLEEN-n....................................................................
D8SIA0_SELML/5-72                    .......................................ehvllvnv----------------------..-.------------................................--LVVDEISNR..VDHLEG..............----.NFR.............................................GP.SPAFCLLFKL.FTMKLTDE..........QIQ.GLLN...............................................HADSP..YVRAVRLL....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------lf...................................................................
E2LWB8_MONPE/48-120                  .......................................arpeshgk----------------------..-.----------RT................................AESLIDKAIE-..LKCIGG..............-VYG.NQR.............................................-P.TEFLCLLLKL.LQIQPEKE..........ILI.EYLQ...............................................ADEFKcdYIV-----....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------lssfv................................................................
M4DKE9_BRARP/10-175                  ...............................................KNIRGTNPQNLVETIVRKKIHD..H.TFWKEQCFGLTA................................-ETLVDKAME-..LDHVGG..............-TFG.GNR.............................................KP.TPFLCLVLKM.LQIQPEKE..........IVV.EFIK...............................................NDDYK..YVRVLGAF....Y...L.....RLTGS........................DADV....YR.YLE.....PL..YNDYR.KVRQKLADG..............-----....RFSLTHVDEVIE.ELL.......TKDYS...CD..I..AMPRLKKRCTLEQN-g....................................................................
G4N721_MAGO7/23-190                  ............................................lap---NGLNRARIMEKAVVDRITE..S.YFWKEQCFGVNE................................-ADIVDRVVDH..VTYIGG..............-VVG.QSQ.............................................KP.TPFLCLAFKL.LQLGPDDS..........ILA.EYLKf.............................................gGEKFK..YLRALAIF....Y...V.....RLTRT........................SADV....FR.TLE.....PF..LEDRR.KLRRKGRAG..............-----....-TSLTYMDEFAD.DLL.......TKDRV...CA..T..SLFKLTRRDVLEDL-d....................................................................
G1QM59_NOMLE/48-232                  ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
S8A531_DACHA/22-185                  .............................................pt--IHSMNPLLLMEKIIRERIID..S.MYWKEQAWGLNA................................-ATLLDRAVD-..LQYIGG..............-QY-.ANQ.............................................KP.TAFICLVLKM.LQLNPERE..........ILL.EYLQ...............................................DEDFK..YLRALAAF....Y...I.....RLAWP........................AAEV....YK.TLE.....PL..MADYR.KLRLRTQAG..............-----....-FKLTFVDEFID.DLL.......TKERV...CD..I..ALPRMPTRAQLEDM-d....................................................................
G5BQU6_HETGA/49-233                  ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
A0A091DHP7_FUKDA/10-70               ..............................................h-SLHGTNPQNLV-KIIWMQIYE..S.KYWKEECFGLLA................................-ELVVDKAIE-..LRDI--..............----.---.............................................--.----------.--------..........---.----...............................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------mithfepsisfegl.......................................................
G7KFW5_MEDTR/3-166                   .........................................iqtsgr------PIESLLEKVLCMNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAVGFL....Y...L.....RYYAD........................PKTL....WS.WFE.....PY..AKDDE.---------..............EFSPG...sNGRMTTMGVYIR.DLL.......LGQYY...FD..T..LFPRIPVPVM-----rqvv.................................................................
H0XNF3_OTOGA/49-233                  ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
G3JII3_CORMM/24-191                  ............................................lap---NGLNPATIMEKAVKDRITD..S.YFYKEQCFALNE................................-ADIVDRVVEH..VRFIGG..............-TSG.MTQ.............................................KP.SPFLCLAFKL.LELSPSDA..........VIA.EYLAy.............................................gGEHFK..YLRALACF....Y...L.....RLTRQ........................AKDV....YA.TLE.....PF..LEDRR.KLRRRGRDR..............-----....-TTLTYVDEFVD.DLL.......TKDRV...CA..T..SLWKMPKREILEDL-e....................................................................
A0A0G2JEW4_MOUSE/48-138              ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRK.............................................TA.----------.--------..........---.----...............................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------gqtgmcggvsrssrcwnrrhcfysilpsiq.......................................
B4L223_DROMO/28-212                  ..............................................l-PLWGNETSMNLNPLILANIQS..S.SYFKVHLFKLKT................................YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.YTLRLTRK..........QVN.GLLN...............................................HTDSA..YIRALGFM....Y...L.....RYTQP........................PGDL....YD.WYE.....DY..LQDEE.---------..............EIDVKa..gGGQVMTIGQMVY.QFM.......TKLDW...FS..T..LFPRIPVPIQKQIE-k....................................................................
R0K0D1_SETT2/23-218                  .............................................sl--IRGQNPALLFEKGVRERITE..S.YYWKEQCFGLNA................................-ATLCDRAAE-..LKFIGG..............-TTG.ITG.............................................KP.TPFLCLAFKL.LQLVPDKA..........IIL.EYLNfrddededkqdadeq................ddedaakdtdlnaagkLGCFK..YLRCLAAF....Y...I.....RLAWE........................PVEI....YK.TLE.....PL..LTDYR.KIKRRLKDT..............-----....-FTLTHVDQFID.DLL.......TRDRI...CA..T..SLWKLPSRAILEDL-d....................................................................
Q29IQ7_DROPS/30-214                  ..............................................l-PFWGNETSMNLNPLILANIQS..S.SYFKVHLFKLKT................................YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.YTLRLTRK..........QIN.GLLN...............................................HTDSA..YIRALGFM....Y...L.....RYTQP........................PGDL....YD.WYE.....DY..LQDEE.---------..............EIDVKa..gGGQVMTIGQMVY.QFM.......TKLDW...FS..T..LFPRIPVPIQKQIE-r....................................................................
G7E6U1_MIXOS/10-174                  ..............................................v-SIHGTNPQFLIETTIRYRIWD..S.NFWKEHCFALTA................................-ESIIDRAVA-..LNYIGG..............-TYG.ASK.............................................-P.TDFLSLTLKM.LQIQPSKE..........IVL.EYLR...............................................AEEFK..YLRALAIF....Y...I.....RLTFD........................AMEV....YE.ILE.....PL..LEDYR.KLRYRQLDG..............-----....SYSIMTIDAFVD.SLL.......TEERV...CE..I..QLPRLTLRRVLEET-e....................................................................
B7FY05_PHATC/41-205                  ..............................................l-PLWGAPDSFHFNPLLLRNTVR..S.LYFQKCCEKLLD................................WNAVVDEIYYE..VKYLQP..............FALD.--K.............................................SP.STAFCLLLRL.LTLRVTNH..........QME.LTLK...............................................HTDSP..YIRGIGFL....Y...L.....RYAGP........................PEQI....WS.FIE.....SS..LQDEE.ELVIEAGHR..............-----....-GKRSTIGQFVR.SLF.......SSRDF...YG..T..SLPRLPIQTERD---iq...................................................................
Q4XAT0_PLACH/10-175                  ............................................ikt---FGSNPQYLISNIIRNKIYD..S.PYWKEKCFALTS................................-ESIIDQAVS-..LKYVGG..............-TYG.GNR.............................................KP.TRFLCLVLKL.LQLQPDKD..........IIY.EFIK...............................................NEEFI..YLRALGIF....Y...L.....RLVGK........................GIEI....YK.NIE.....PI..LFDYR.KIRLRLQDG..............-----....SFQKIYMDVFAD.NCL.......VFNNF...LD..V..DFPALTKRIVLEEN-n....................................................................
F7ALV5_CALJA/25-209                  ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
A0A0K0J8G0_BRUMA/10-175              .............................................vt--VKGTNPQYLVEKIIRTRIYD..S.KYWKEECFALTA................................-ELLVDKGME-..LRYIGG..............-IYA.GNV.............................................KP.TPFLCLCLKM.LQIQPEKD..........IAV.EFIR...............................................QEEYK..YIRALGAM....Y...I.....RLTFT........................SIEV....YK.YLE.....PL..YNDYR.KLRMMNNEG..............-----....RFEIVHMDEFID.SLL.......RDERY...CD..I..HLPRIQKRITLEE--vg...................................................................
A1DES8_NEOFI/21-209                  ..............................................l--VRGVNPATLFEKAVRDRITD..S.YYWKEQCFGLNA................................-ATLCDRAVE-..LTSIGG..............-TYG.VAE.............................................KP.TPFLCLAFKL.LQLNPERE..........IIL.EYLNytdpgsdeetea......................taeeqarngvlgqRGDFK..YLRALAAF....Y...V.....RLTFD........................PVDV....YK.TLE.....PL..LLDYR.KLKRRVRDT..............-----....-FVLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKLPARQQLEDL-d....................................................................
B3MDH3_DROAN/10-175                  ...............................................KNVHGTNPQYLIEKIIRSRIYD..S.KYWKEQCFALTA................................-ELLVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TQFLCLTLKM.LQIQPEKD..........IVV.EFIK...............................................NEEFK..YVRALGAF....Y...L.....RLTGA........................ALDC....YK.YLE.....PL..YIDNR.KLRRQNRAG..............-----....QFEIVYMDEYID.ELL.......RNDRV...CD..I..ILPRIQKRTILEEN-n....................................................................
M7YUL5_TRIUA/10-175                  ..............................................r-SIHGTNPQNLVEKIVRAKIYQ..S.NYWKEQCFGLTA................................-ETLVDKAME-..LDHTGG..............-THG.GNR.............................................RP.TPFLCLALKM.LQIQPDKE..........IVV.EFIK...............................................NEDYK..YVRVLGAF....Y...L.....RLTGT........................VADV....YQ.YLE.....PL..YNDYR.KIRQKLSDG..............-----....KFTLTHVDEFID.ELL.......TKDYS...CD..T..ALPRIQKRWILEA--sg...................................................................
W5AB44_WHEAT/3-166                   ............................................iqt---SGKPIDMLMEKVLCMNILS..S.DYFK-ELYRMKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKIL....WT.WYE.....PY..LKDDE.---------..............EFSPG...sNGRMTTMGVYVR.DLI.......LGQVC...FD..S..ILPRVPVPVV-----rqvt.................................................................
C1FDQ5_MICSR/10-174                  ..............................................r-NVRGTNPQNLLEAITRKKVYE..T.LYWKEKCFAVSA................................-ESLVDLAMD-..LKTCGG..............LCAG.-KH.............................................KA.SEFLCLTLKL.LQIQPETE..........IVL.EFIT...............................................NENHK..YIRLLGAF....Y...L.....RLVGK........................PVDV....YR.YLE.....PL..LYDYR.RIRYKNSRG..............-----....VCEVKHVDELVN.DLL.......CKDNF...CD..V..VLPRIPRRPALE---ga...................................................................
A0A0E0KZ63_ORYPU/3-166               ............................................iqt---SGKPIDLLMEKVLCMNIMS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKIL....WT.WYE.....PY..LKDDE.---------..............EFSPG...sNGRMTTMGVYVR.DLI.......LGQYY...FD..S..LLPRVPLPV------irqvt................................................................
A0A024UKU5_9STRA/9-173               ..............................................i-SIHGVNPQHLVEKILRNRIYD..C.MYWKEQCFGLTA................................-ETLVDKAIE-..LTHIGG..............-HFG.GNQ.............................................QP.TPFLCLILKM.LQIQPDLE..........IVV.EFIK...............................................NGDYK..YVTILGAF....Y...L.....RLVGK........................PTEV....YP.MLE.....EL..LADYR.KIRKRNTLG..............-----....-WEMLHVDEVAD.ILL.......KEEYF...CD..I..ALPHLVDRYQLET--tn...................................................................
A8IDN7_CHLRE/1-167                   ..............................................m-EIHGSNTTFNLENVLRQNILS..S.DYYKGTCSELSN................................CSDIVDEIYES..VDHVEP..............WMSG.NAR.............................................GP.STAFCLLHRL.FTLKLSAK..........EVK.GMLD...............................................HKDSP..YIRAVGFL....Y...L.....RYVGD........................PKTL....WS.WVA.....PY..VKDQE.---------..............KFSPSg..pNEKEVAMGDYVR.DLL.......LSQYY...FE..T..IFPRIPKPVQDQIN-d....................................................................
U1GVC6_ENDPU/20-185                  ..............................................l--IRGANPITLIETAVRDRITE..S.LYWKEQCFGLNA................................-ATLLDRAVD-..LSYIGG..............-TYG.VGM.............................................RP.TPFLCLAFKL.LTLTPEKE..........IVL.EYLNm.............................................gGEEWK..YLRALAAF....Y...V.....RLTFE........................PVDI....YT.TLE.....PF..LTDAR.KLRRRRKEG..............-----....-YVLVHMDEFID.ELL.......TKDRS...CA..T..SLWKLPGRQQLEDL-d....................................................................
M2Y140_GALSU/5-87                    ..............................................l-EIYGNKKTFNFPEKVISNVLR..S.PYFR-SLYELKT................................FNQVVDEIYNQ..VSYLEP..............WVAGkGVG.............................................TP.SSAFCLLYKL.FTLKLS--..........---.----...............................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------gvgvsv...............................................................
G3N166_BOVIN/47-231                  ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
A0A0B2UEZ7_9MICR/2-161               ...........................................qykr-----------IGKIAREKIIE..S.QEFR-AMRSLTY................................-SDLVNEICK-..LNSIGG..............MIR-.--N.............................................TP.HRFICLVHKL.DSISLIDD..........VVA.EALEdmkprhi................................gpsltandFKGNV..YLLTAFLL....Y...L.....RLSVN........................FHQY....RD.LIK.....CF..EADFR.KITVVNEQN..............-----....TRFSMYIDVFVD.DLL.......NKPRV...LG..I..CL-------------ni...................................................................
W5DUT1_WHEAT/1-85                    ...............................................----------------------..-.------------................................-----------..------..............----.---.............................................--.----------.--------..........-MH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYAAD........................PKTL....WT.WYE.....PY..IQDDE.---------..............EFSPG...sNGKMTTMGVYVR.DVI.......LGQYY...FD..S..LLPRVPL--------lilrqvt..............................................................
A7APG3_BABBO/171-333                 ............................................ldm----TNSSTYNMNTLLLNNILN..S.DYYK-SLSTMTS................................HHSIIDELAQY..ADHVEP..............YCKT.ATR.............................................VP.STLFCCLHKL.FTLRLTER..........QME.DLID...............................................CTKSP..YPRCCGFL....Y...L.....RFVLP........................SDQL....WA.WFE.....PY..LMDEE.---------..............TFVMSv..nPTRKTTIGKFCE.SLL.......VEDRY...FN..T..VLPRLPSRFK-----nmy..................................................................
T1HNK6_RHOPR/10-175                  ..............................................k-SVRGTNPQFLIEKIIRSRIYE..C.KYWKEECFALSA................................-ELIVDKAME-..LRFLGG..............-VYG.GNV.............................................KP.SPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEEFK..YVRALGAL....Y...M.....RLVGT........................SIEC....YK.YLE.....PL..LNDGR.KLRNQTRDG..............-----....KFVMIHMDEYID.GLL.......HEERM...FD..I..ILPRIQKRHVLEEA-n....................................................................
W4GR42_9STRA/57-221                  ..............................................l-PIHGNQTTYNFNTLLYDNVMN..S.DYFR-KLYELAT................................YHEVVDEIYYR..VDHAEP..............WAAG.TSR.............................................IP.STCFCLLMKF.CTMRLTVN..........QMQ.GLLK...............................................HVDSP..FIRCVGFL....Y...L.....RYTCD........................PELL....WE.WYE.....PF..LDDEE.---------..............EFNASs..nDAILTTMGAWIR.SLL.......EDLNY...FN..T..ILPRIPKKIQ-----dgik.................................................................
Q4N1F1_THEPA/128-239                 ............................................ipm----TNSVTYNMNDLLRSNILS..S.EYYK-SL-SVKN................................FYQVFDELVQF..ATHSEP..............YCST.ATR.............................................AP.STIFCCLYRF.LVLKLTEK..........QMN.FLLE...............................................NVKSP..YARCCGFL....Y...L.....RYVLP........................PDKL....WN.CI-.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------s....................................................................
PR38A_BOVIN/10-175                   ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
L0B1D3_THEEQ/121-233                 ............................................iqm----TNSTTYNLNNLLRNNILA..S.EYYK-SLFSMQT................................FQDVVNELIQY..GTHAEP..............YCST.ATR.............................................AP.STLFCCLYKF.FTMKLTEK..........QMY.SLLD...............................................NSKSP..YPRCCGLL....Y...L.....RYVLP........................PDKL....WN.C--.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------qc...................................................................
Q7JVL3_DROME/10-175                  ...............................................KNVHGTNPQYLIEKIIRSRIYD..S.KYWKEQCFALTA................................-ELLVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TQFLCLTLKM.LQIQPEKD..........IVV.EFIK...............................................NEEFK..YVRALGAF....Y...L.....RLTGA........................ALDC....YK.YLE.....PL..YIDNR.KLRRQNRAG..............-----....QFEIVYMDEYID.ELL.......RNDRV...CD..I..ILPRIQKRSILEEN-n....................................................................
A0A0Q9WI28_DROVI/1-69                ...............................................----------------------..-.------------................................-----------..------..............----.---.............................................--.----------.--------..........---.----...............................................-----..-------M....Y...L.....RYTQP........................PGDL....YD.WYE.....DY..LQDEE.---------..............EIDVKa..gGGQVLTIGQMVY.QFM.......TKLDW...FS..T..LFPRIPVPIQKQIE-k....................................................................
B6HM45_PENRW/21-204                  ..............................................l--VRGVNPATLFEKAVRDRITD..S.YYWKEQCFGLNA................................-ATLCDRAVE-..LTSIGG..............-TYG.VSE.............................................KP.TPFLCLAFKL.LQLGPDRD..........VIL.ELLNytdpgsgdea...........................edpdsalvkdRGDFK..YLRALAAF....Y...V.....RLTFD........................PVDV....YK.TLE.....PL..LLDYR.KLKRRVRDT..............-----....-FTLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKLPPRTQLEDL-d....................................................................
W7AWH2_PLAVN/10-175                  ............................................ikt---FGSNPQYLISNIIRNKIYD..S.PYWKEKCFALTS................................-ESIIDQAVS-..LKYVGG..............-TYG.GNR.............................................KP.TRFLCLVLKL.LQLQPDKD..........IIY.EFIK...............................................NEEFI..YLRALGIF....Y...L.....RLVGK........................GIEI....YK.NIE.....PI..LFDYR.KIRLRLQDG..............-----....SFQKIYMDVFAD.NCL.......VFNNF...LD..V..DFPALTKRIVLEEN-n....................................................................
L5K4Z1_PTEAL/49-233                  ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
K6UDH3_9APIC/43-122                  ..............................................t----------------------..-.------------................................-----------..------..............----.---.............................................--.------LLKL.LQIQPDKD..........IIY.EYIK...............................................NEEFI..YLRALGIF....Y...L.....RLIGK........................SLEI....YR.YLE.....PI..LFDYR.KLRIRLQNG..............-----....TFEKIYMDEFVD.NCL.......-----...--..-..---------------.....................................................................
T1EG64_HELRO/7-191                   ..............................................l-PIHGNEKTMNLNSLVLANIQA..S.PYFKVHLYELKT................................YHKVIDEIYYK..VNHLEP..............WEKG.SRKlagqtgmcg...........................gvrgvgtggIV.SSAYCLLYKL.YTLKLTRK..........QLI.GLCT...............................................HTDSS..FIRALGLM....Y...I.....RYTQP........................PNTF....WE.WLE.....PY..LDDDE.---------..............EVDPKa..gGGNNMTIGEMCE.QLL.......LKLDW...YG..T..LFPRIPVPIQKDI--en...................................................................
D8TKN7_VOLCA/1-167                   .............................................me--LYGSSTTYNLENVLRQNILG..S.DYYRQTCTSLNN................................WSDIVDEIYEN..VDHVEP..............WMSG.NAR.............................................GA.SSAFCLLHRL.FTLKLNPK..........QIK.DMLD...............................................HRDSP..YIRAVGFL....Y...L.....RYVAD........................PKTL....WS.WCG.....PY..VKDQE.---------..............MLAPSg..pEQKEVTMGDYVR.DLL.......LSQYY...FE..T..IFPRIPKPVQD----vine.................................................................
A0A0J8FEL6_BETVU/10-175              ...............................................KSIRGTNPQNLVEKIVRSKIYQ..N.TYWKEQCFGLTA................................-ETLVDKAME-..LDHVGG..............-TYG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKD..........IVV.EFIK...............................................NEDYK..YVRILGAF....Y...L.....RLTGT........................DSDV....YL.YLE.....PL..YNDYR.KLRMRKQDG..............-----....QFLLTHVDEFID.ELL.......TKDYS...CD..I..AMPRIKKRWNLEN--vg...................................................................
A0A068Y424_ECHMU/1-99                ...............................................----------------------..-.------------................................-----------..------..............----.---.............................................--.---------M.LQIQPDKD..........IVI.EFIK...............................................QEDYK..YARALGAF....Y...L.....RLVGE........................SVEI....YK.YLE.....AL..YNDFR.KLKQQDTTG..............-----....KFSIVRMDEFID.QLL.......NEERV...CD..V..ILPRLQKRSVLEDN-n....................................................................
A0A0A0KT86_CUCSA/8-91                .....................................lrsygsnsii----------------------..-.------------................................-----------..------..............----.---.............................................--.----------.--------..........---.----...............................................-----..HLVLIGFL....Y...L.....RYVAD........................PKTL....WN.WFE.....PY..VKDDE.---------..............EFSPG...sHGRMTTMGVYVR.DLL.......LGQYY...FD..T..LFPRIPVPV------lrqvv................................................................
I1LB75_SOYBN/10-175                  ...............................................KSIRGTNPQNLVEKILRSKIYQ..N.TYWKEQCFGLTA................................-ETLVDKAME-..LDHLGG..............-TYG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKE..........III.EFIK...............................................NEDYK..YVRILGAF....Y...L.....RITGS........................DIDV....YR.YLE.....PL..YNDYR.KLRRKLADG..............-----....QFALTHVDEVID.ELL.......TKDYS...CD..I..AMPRVKKRWTLES--lg...................................................................
E1C6A8_CHICK/10-175                  ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LKYVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HEERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A5DTV1_LODEL/38-215                  ............................................dkr---TTTNKAHLVDTIIRHRILD..S.IFYKQHLYLANE................................-ATILQVITKH..VHYIGG..............--VD.SMG.............................................RP.SPFIQCLFRL.LELNPSKE..........IVH.VYLHq............................................leFNEFK..YLLALSLL....F...V.....RLTYP........................SEEV....YS.IFD.....EF..AQDYR.KLRYKMKVP..............DFDENklaiFYKIGYMDEFLD.DLL.......TKERV...VD..L..LLPRLTLRNTLVE--qa...................................................................
A8IJK3_CHLRE/10-175                  ...............................................KTVHGTNPQNLVEYIVRQKIYQ..T.TYWKEKCFALTA................................-ESLLEVAVQ-..LKSVGG..............-TFG.GQR.............................................KP.SDFLCLLLKM.LQIQPDKE..........III.EYIK...............................................NEDFK..YVRLLGAF....Y...M.....RLVGK........................PLEV....YQ.YLE.....PL..YNDYR.KVRLQTLEG..............-----....AYALTHVDEVVD.DML.......RKDFL...FD..I..ALPRVPSRYTLEK--lg...................................................................
L2GTU9_VAVCU/4-152                   ............................................yrl-----------FSNPIKEKIFK..S.PYFK-EIRTYDL................................-NQTITEAQQ-..LSSIGS..............LVYG.S--.............................................-P.HQFICLLQKL.ESLNIGDS..........IIL.EKYHe............................................alKGDNS..SFVMFFVF....Y...I.....RMTVR.......................mKGDF....EE.IRR.....NL..CSDES.LINIIDENN..............-----....EHYTITIKEMLN.MLK.......NDRYV...LG..I..FM-------------knv..................................................................
I1NJ40_SOYBN/10-175                  ...............................................KSIRGTNPQNLVEKILRSKIYQ..N.TYWKEQCFGLTA................................-ETLVDKAME-..LDHLGG..............-TYG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKE..........IVI.EFIK...............................................NEDYK..YVRILGAF....Y...L.....RITGS........................DIDV....YR.YLE.....PL..YNDYR.KLRRKLADG..............-----....QFTLTHVDEVID.ELL.......TKDYS...CD..I..ALPRVKKRWTLES--lg...................................................................
K7V8Q5_MAIZE/76-246                  ...........................................iqss----GRSIEGLMDKVLSVNILS..S.DYFK-ELFKYKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.SSAFCLLYKLlFTMKLTVK..........QMH.GLLK...............................................HQDSP..YIRADAKC....FrniV.....RSQAV........................SRNI....VN.AIRevldaPA..TADAR.VAKMLLAEE..............-----....------------.---.......-----...--..-..---------------mknevskeyflktvrnivgdkllkqaasqyqm.....................................
M1CAV6_SOLTU/10-175                  ...............................................KSIRGTNPQNLVEKILRSKIYQ..N.TYWKEQCFGLTA................................-ETLVDKAME-..LDHLGG..............-TFG.GNR.............................................KP.SPFICLVMKM.LQIQPEKD..........IVV.EFIK...............................................NEDYK..YVRVLGAF....Y...L.....RLTGT........................DIDI....YR.YLE.....PL..YNDYR.KLRRKLADG..............-----....QYALTHVDEYID.ELL.......TTDYS...CD..I..ALPRIKKRWILEQN-k....................................................................
A0A0N5C737_STREA/6-171               ..............................................k-TIRGTRSTFLIEKIIRTRINE..S.LYWKEECFGLSA................................-ETVIDKGAE-..LRYVGG..............-IYA.GNT.............................................RP.TPFLCLTLKL.LELAPEKD..........III.EYIQ...............................................QEEFK..YIRALGAM....Y...I.....RLTFP........................SVDV....YR.YLE.....PI..YNDYR.KLRYMNRMG..............-----....RFELMYMDQFID.RLL.......NEELF...CD..V..HLPKLQGRQLLEQN-d....................................................................
W1NQE5_AMBTC/3-166                   ..........................................iqtsg-----KPIDSLLEKVLCMNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYAAE........................PKTL....WG.WFE.....PY..VKDEE.---------..............EFSPG...sNGRMTTMGVYVR.DLL.......LGQYY...FD..T..LFPRTPVPIMR----qiv..................................................................
W3XIF8_9PEZI/20-186                  .............................................cp---NGMNPATLLEKAMIERIID..S.FYFKDACFGLNE................................-ADIVDRVVSH..VTFVGG..............-TYG.SSQ.............................................KP.TPFLCLLFKL.LQLGPGDD..........VLG.EYLSf.............................................gGERFK..YLRALAAF....Y...I.....RLTRR........................SEDV....YK.TLE.....PF..LEDRR.KLRRKGAQG..............-----....-TTLTFVDQFVD.DLL.......TKDRV...CG..T..TLWQLTKRELLED--le...................................................................
A0A068SG10_9FUNG/10-173              ..............................................i-AVHGKDPQHLVEKIIRERIYD..S.LYWKEHCFGLSS................................-ATLMDKAVK-..LTYIGG..............-QYA.GQH.............................................-P.TEFLCLTLKM.LQLQPEKE..........IVH.ELIK...............................................QEDFK..YLRALSAF....Y...L.....RLVGR........................SKEI....YL.ALE.....PL..LNDPR.KLRVRQGDG..............-----....-YSLTYMDEFVD.QLL.......HEERV...CD..V..ILPRLVSRYIMEEN-d....................................................................
E2AHT2_CAMFO/35-218                  ..............................................l-PLWGNERTMNLNPLILTNIQS..S.HYFKVNLYELKT................................YHEVIDEIYYK..VSHLEP..............WEKG.SRKtagqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.FTLRLTRK..........QLN.GLIN...............................................HPDSP..YIRALGFM....Y...I.....RYTQP........................PADL....FS.WYS.....DY..LEDEE.---------..............ELDVKa..gGGQTMKMGDILK.QFL.......TKLEW...FS..T..LFPRIPVPIQKD---le...................................................................
M7U0A7_BOTF1/21-188                  ............................................lap---NGLNPATILEKPVRERIVD..C.YFWKDQCFALNE................................-ADIVSRVVSH..VTFIAG..............-TYG.DSQ.............................................RP.SPFLCLAFKL.LQLGPGDD..........ILK.EYMGy.............................................gGEKFK..YLRALALF....Y...W.....RMTRQ........................AKDV....YT.MLE.....GY..LEDRR.KLRRKTRTG..............-----....-TTLTFMDQFVD.DLL.......TKDRV...CG..T..TLWKMPKREILEDL-e....................................................................
B4ME55_DROVI/10-175                  ...............................................KNVHGTNPQYLIEKIIRSRIYD..S.KYWKEQCFALTA................................-ELLVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TQFLCLTLKM.LQIQPEKD..........IVV.EFIK...............................................NEEFK..YVRALGAF....Y...L.....RLTGA........................AIDC....YK.YLE.....PL..YIDNR.KLRRQNRAG..............-----....QFEIVYMDEYID.ELL.......RNDRV...CD..I..ILPRIQKRSILEEN-n....................................................................
I3MQ15_ICTTR/10-175                  ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
H2ZFB4_CIOSA/10-175                  .............................................yt--IKGTNPQYLIEKIIRSRIYD..S.RYWKEQCFALSA................................-ELLVDKAME-..LKYVGG..............-VYA.GNI.............................................KP.SPFLCLILKM.LQIQPDKD..........IIV.EFIR...............................................NEDFK..YVRCLGAF....Y...M.....RITGK........................SLEC....YK.YLE.....PL..LNDFR.KIKFQKRDG..............-----....NFVVTHMDEFID.ELL.......REERS...CD..V..ILPRIQKRQILEE--le...................................................................
Q57XW0_TRYB2/205-343                 ..............................heavtslresqrherrv----------------------..-.------------................................-ESLLHYCEQN..VLYIGV..............--MD.EEG.............................................KA.TPFLLAIGAF.YKLGLTRH..........DAL.VHFA...............................................RHHRR..TIRALALF....I...A.....RYTTA........................PEEL....EP.FFT.....PS..LTDEV.VVACAEDQQ..............-----....--VTCSMRQLAE.DLL.......LHDEV...CE..A..---------------wpptlhpf.............................................................
A5DGC7_PICGU/7-183                   ..........................................dkrhv-----LNGAKLVEHIVRHRIHD..S.LFYKQHLYLTNE................................-QTILPVIVDN..VTYIGG..............--TD.ANG.............................................RP.SPFICCLLRL.LEVEPEER..........ILA.MYETq............................................lgYNRFK..YLTCLVMI....Y...Y.....RLTKT........................GAEI....YK.RLE.....PY..YKDYR.KVRLQLKVP..............EFENGs.arHYKVYTIDQWAD.DLL.......QHERV...VD..I..ILPRILPRHILM---qrg..................................................................
D8T1B4_SELML/10-168                  ...............................................KSVHGTNPQNLVEKILREKIHQ..S.SFWKEQCFALTA................................-ETLVDKAME-..LDHIGG..............-TYG.GNR.............................................KA.TPFMCLTLKM.LQIQPEKE..........IVV.EFIK...............................................NQDYK..YVRVLGAF....Y...L.....RLVGK........................ATDV....YQ.YLE.....PL..YNDYR.KIRQRSADG..............-----....SFFLSHVDEFID.QLL.......TTDYC...CD..I..TLPRVPKR-------.....................................................................
A0A023B5L5_GRENI/10-174              ..............................................r-SVHGTNPQFLINQITRNRIYD..S.AYWKEYCFGLNA................................-VTLLDKAAG-..LKYVGS..............-VYG.GNN.............................................KA.CPFLCLLLKL.LQIGPSDS..........VVD.EYME...............................................QTDFK..YLQALSAV....Y...L.....RLTGS........................PERI....YR.KLE.....EL..YTDNR.LLRLRLNNG..............-----....SFKLFHVDEFID.ELL.......HSNVC...IN..I..DLPPLPNRNLLEQ--n....................................................................
U6KXF4_EIMTE/120-282                 ............................................vqm----TDSTTYNVNQLLRGNIMS..S.EYFK-SLHQFKS................................FNEVVDELAAF..ADHAEP..............YCSG.STR.............................................AP.STLFCCLYKL.FTLKLTEK..........QMH.MLLN...............................................HRESP..YVRCTGFL....Y...L.....RYVHP........................ADQL....WK.WYE.....PY..FLDDE.---------..............QFTPGa..dPNRVISMGEYVQ.SLL.......TEDKY...FS..T..VLPRLPVLVK-----nvy..................................................................
U9UJB9_RHIID/7-167                   ..............................................l-ETWGSETTMNLNNILYQNIQA..S.PYFK-HLYELKT................................YHEVIDEIFN-..---HEP..............FLKG.TTA.............................................--.STAFCLLYKL.WTLRLTVK..........QVN.GLIE...............................................HTDSP..HIRALGFL....Y...L.....RYVCK........................PIHL....WE.WFE.....EY..LDDEE.E--------..............-VQIQg.gpRPVIITIGKMCR.QLL.......TEQKW...LG..T..ILPRIPVPIAREIE-q....................................................................
W5MMD1_LEPOC/32-216                  ..............................................l-PLWGNEKTMNLNPMILTNVLS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHIEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PADL....MD.WFD.....SF..LDDEE.---------..............ELDVKa..gGGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKL---idq..................................................................
A0A0A1NZQ0_9FUNG/11-122              .............................................tg--VHGRHPMHLVEKIIRERIQE..S.IYWKEKCYGLTA................................-ATLMERAVE-..IEYIGG..............-TFG.NLQ.............................................-P.TEFLCLLLKL.LQLLPERE..........III.EYIM...............................................QDDFK..YLRALGAF....Y...L.....RLTGK........................SVEI....E-.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------sikie................................................................
E0VES7_PEDHC/10-175                  ..............................................k-SVRGSNPQYLIEKIIRARIYD..S.KYWKEECFALSA................................-ELLVDKAME-..LKYVGG..............-VFG.GNI.............................................KP.TPFLCLILKM.LQIQPEKD..........IIV.EFIK...............................................NEEFK..YVRALGAF....Y...M.....RLVGN........................PLEC....YK.YLE.....PL..LIDCR.KLRKQNRQG..............-----....HFELLHMDEFVD.DLL.......REERM...FD..I..ILPRIQKRHVLEEN-n....................................................................
J9NZD6_CANLF/48-232                  ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
A0A096RF19_MAIZE/1-55                ..............................................m----------------------..-.------------................................-----------..------..............----.---.............................................--.----------.--------..........---.----...............................................-----..--------....-...-.....-----........................----....--.WYE.....PY..LRDDE.---------..............EFSPG...sNGRKTTMGVYVR.DLI.......LGQYY...FD..S..LLPRIPLPVTRQ---ita..................................................................
A0A067K178_JATCU/3-166               ..........................................iqtsg-----KPIDSLLEKVLCMNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HKDSP..YIRAIGFL....Y...L.....RYAAD........................PKTL....WN.WFE.....PY..IKDDE.---------..............EFSPG...sNGRKATMGVYVR.DLL.......LGQYY...FD..T..LFPRIPVPVMR----qig..................................................................
K2N6A4_TRYCR/38-206                  .............................................wn--LKGRSAVAALDPPTRHRIMQ..S.HAMA-SCFHKPL................................-LATLEVLIT-..VQYVGG..............-ITG.PLQ.............................................KP.EPFICHVTRL.LQITPDPS..........IVL.AMLH...............................................QDVHK..YLRVAALF....I...I.....RLIGN........................EAMM....RE.AMR.....VG..WEDYR.KIRVYGYVE..............-----....------------.---.......-----...--..-..---------------dlagttdgkentasdedegfvrapaygimcvdeitdrlfnvg...........................
A0A087XEK0_POEFO/10-175              ..............................................n-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LKFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRLLGAM....Y...M.....RLTGT........................AVDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HAERV...CD..I..ILPRLQKRQVLEEA-e....................................................................
A0A0M0K198_9EUKA/55-233              ...........................................savg--------NMNLNSMLVENIRS..D.DYFK-GLAELKT................................FEDVVDQIYYD..CKFVTP..............WVPG.THKsqkasgmcs...........................glrgvsnagTP.STGYMLLFKL.YTLQITTH..........QIR.RMLN...............................................HTDSP..YIRALGFL....Y...L.....RHACD........................PKEL....WT.WCK.....PF..VADPE.ELYVEGA--..............-----....DGPVSTIGRWLR.GLL.......TEQEY...HG..T..MLPRLPVPVA-----rdvl.................................................................
V9ES07_PHYPR/9-173                   ..............................................q-SVHGVNPQTLVEKIMRNRIYA..S.IYWKEQCFGLTA................................-ETLVDKAVE-..LQEFGG..............-TFG.GNQ.............................................QP.THFLCLLLKM.LQLQPELE..........VVK.QFIE...............................................NEDYK..YVTVLGAV....Y...L.....RLVGK........................PLEV....YT.LLE.....PL..LSDYR.KIRKRNVIG..............-----....-WEITHVDEIAD.ALL.......HEEYY...ID..L..ALPRLADRELLEKN-e....................................................................
A7RN21_NEMVE/18-202                  ..............................................l-PLWGSERTMNMNNMILTNILQ..S.PYFKNELYQLKT................................YHEVVDEIYYK..VDHLEP..............WEKG.SRKtsgqvgmcg...........................gvrgvgaggIV.STAYCLLYKL.FTLRLTRK..........QLN.GLLT...............................................HTDSP..YIRALGFM....Y...I.....RYCQP........................PADL....WE.WYE.....PY..LEDEE.---------..............EVDPKa..gTGCTMTMGQLVR.SFL.......LKLEW...YG..T..LFPRIPVPIQKD---lek..................................................................
A0A078DXJ9_BRANA/10-198              ...............................................KNIRGTNPQNLVEKIVRTKIQN..H.TFWKEQCFGLTA................................-ETLVDKAME-..LDHVGG..............-TFG.GNR.............................................KP.TPFLCLVLKM.LQIQPEKE..........IVV.EFIKnddykhdmfvf........................lpkllsfvritfLGVVK..YVRVLGAF....Y...L.....RLTGS........................DVDV....YR.YLE.....PL..YNDYR.KVRQKLADG..............-----....RFSLTHVDEVIE.ELL.......TKDYS...CD..I..AMPRLKKRCTLEQN-g....................................................................
L1ICQ1_GUITH/10-169                  ..............................................a-SVHGTNPQFLVEKILRQKIYD..D.NYWKEHLFGLTA................................-ETIVDRAME-..LDHIGG..............-TFG.GNN.............................................KP.TVFIQLVLKL.LQLQPEKE..........IVL.EFIR...............................................NEEFK..YVRALGAF....Y...L.....RLTGR........................ALDI....YQ.YLE.....PL..LNDYR.KLRV-----..............-----....-ISVMYMDVFID.QLL.......RDPMV...LD..V..ALPTLPKRLNLEDL-k....................................................................
C1H036_PARBA/21-214                  ..............................................l--IRGVNPATLFEKAVRDRITE..S.YYWKEQCFGLNA................................-ATLCDRAVE-..LTYIGG..............-TYG.LAQ.............................................KP.TPFLCLAFKM.LQLSPEKE..........IVL.EYLNfndpetghdgvygen.................nveedhdtdsgvvkaVGDFK..YLRALAAF....Y...I.....RLTFD........................AAEI....YT.TLE.....PL..LADYR.KLKRRTKDG..............-----....-FLLTYMDQFVD.DLL.......TKDRV...CA..T..SLWKLPSRTQLEDL-d....................................................................
A0A0P7V7J0_9TELE/41-225              ..............................................l-PLWGNEKTMNLNPMILTNVLS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PADL....LN.WFD.....AF..FDDEE.---------..............ELDVKa..gGGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKVI--dq...................................................................
A0A0F8DAS5_CERFI/24-191              ............................................lap---NGLNPATIMEKAVRDRIID..S.YFYKEQCFALNE................................-ADIVDRVVEF..VQFIGG..............-TYG.VTQ.............................................KP.TPFLCLAFKL.LQLAPSDA..........ILS.EYLEl.............................................gGEHFK..YLRALACF....Y...I.....RLTRP........................AKEC....YL.LLE.....PF..LEDRR.KLKRKGRAG..............-----....-TTLTYVDEFVD.HLL.......VKERV...CG..T..SLWKMPKRDVLEDM-d....................................................................
C5K8A2_PERM5/121-216                 ............................................lql----TNTTTYNYPQMLHQQLAK..S.AYYH-SIQPLDT................................PEAIIDEIKTR..CKDAEP..............YAPG.SHT.............................................AP.STMFCCLYRL.FVMRINSK..........VLG.QLIN...............................................YHGAP..YVRSI---....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------ee...................................................................
A8X281_CAEBR/57-204                  ..............................................l-PIWGNQVTMNLNTLVLENIRE..S.YYYKNNLVEIDS................................FQTLVEQIFYQ..VKHLEP..............WEKG.TRRlqgmtgmcg...........................gvrgvgaggVV.SSAYCLLYRL.FNLRITRK..........QLI.SMLN...............................................SRQSV..YIRGIGFM....Y...I.....RYTQP........................PADL....WY.WLE.....PY..LDDDS.E--------..............-----....------------.---.......-----...--..-..---------------idprsgg..............................................................
H3DCW8_TETNG/25-209                  ..............................................l-PLWGNEKTMNLNPMILTNVLS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QLM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PPDL....LE.WYD.....GF..LDDDE.---------..............ELDVKa..gGGCVMTVGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKSI--dq...................................................................
G5C765_HETGA/85-176                  .......................................sqapraek----------------------..-.------------................................-----------..------..............----.---.............................................--.----------.--------..........---.---K...............................................NEDFK..YVCMLGAL....Y...M.....RLTGT........................AIDC....YK.CLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELR.......HSERV...CD..I..MLPRLQKRYVLEE--ve...................................................................
C4LZA0_ENTHI/2-162                   ..........................................sgper----------RLETILRNKIYN..C.EYWKQQCFTLTS................................-ETILDEIVK-..LHDFGG..............-TYG.VLK.............................................KP.TKFIVLIMKL.LMLRPDKS..........IIY.EYIM...............................................NEEFK..YVRVIGAF....Y...L.....RLIGS........................SKEC....YQ.FIE.....PL..YYDYR.PLKYRIDSK..............-----....HYEIITIDQFAW.NLL.......HLDYY...CD..I..TLPIITPRPVIE---shg..................................................................
A2Q158_MEDTR/10-175                  ...............................................KSIRGTNPQNLVEKILRSKIYQ..H.TYWKEQCFGLTA................................-ETLVDKAME-..LDHLGG..............-TYG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKE..........IVI.EFIK...............................................NDDYK..YVRILGAF....Y...L.....RLTGS........................DTDV....YH.YLE.....PL..YNDYR.KLRRKLPDG..............-----....QFALTHVDEVID.ELL.......TTDYS...CD..I..AMPRIKKRWTLES--lg...................................................................
G1S8M8_NOMLE/1-148                   ...............................................------------------RIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
Q28XW5_DROPS/10-175                  ...............................................KNVHGTNPQYLIEKIIRSRIYD..S.KYWKEQCFALTA................................-ELLVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TQFLCLTLKM.LQIQPEKD..........IVV.EFIK...............................................NEEFK..YVRALGAF....Y...L.....RLTGV........................ALDC....YK.YLE.....PL..YIDNR.KLRRQNRAG..............-----....QFEIVYMDEYID.ELL.......RNDRV...CD..I..ILPRIQKRTILEEN-n....................................................................
F7G6K1_MONDO/12-177                  ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LRFMGG..............-VYG.STI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIR...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................ATDC....YK.YLE.....PL..YNDYR.KIRIQNRNG..............-----....EFELMRMDEFID.ELL.......HRERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A9TDL8_PHYPA/6-170                   ........................................vqtcgkp-------LDTLIERVLCTNILS..S.DYFK-ELFSLKT................................YLEIVDEIYNH..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKL.FTMKFTVK..........QMQ.DILD...............................................HPDSP..YIRALGFL....Y...L.....RYVGD........................PKTL....WD.WFE.....PY..VEDTE.---------..............EFSPG...sNGKMTTMGVYVR.DII.......LNQYY...FD..T..LFPRIPVPILR----qita.................................................................
A0A0L6VIQ5_9BASI/10-176              ..............................................l-SIHGTNPQFLIDKILRSRIYE..S.EYWKESCFGLTA................................-ESIIDKAVFD..LNYLAS..............-TFT.ANL.............................................RP.SPFICLLLKL.LQLQPEKE..........IIL.EYLR...............................................AEEFK..YLRALAAF....Y...V.....RLTFT........................PINV....YQ.TLE.....PM..LQDYR.KLRIRELDG..............-----....SYGLMTFDEFID.KLL.......TETIV...FE..V..VLPRLTSRKVLEE--le...................................................................
G3Y0M7_ASPNA/21-209                  ..............................................l--VRGVNPATLFEKAVRDRITD..S.YYWKEQCFGLNA................................-ATLCDRAVE-..LTSIGG..............-VYG.VSE.............................................KP.SPFLCLAFKL.LQLNPERD..........IIL.EYLNfsdpandedstg......................heerehddgvvkaRGDFK..YLRALAAF....Y...V.....RLTFE........................PVEV....YK.TLE.....PL..LLDYR.KLKRRVRDS..............-----....-FTLTYMDQFVD.ELL.......TKERV...CG..T..SLWKLPARQVLEDL-d....................................................................
Q59WJ8_CANAL/17-194                  ...........................................dkry----TINKSNLIEPIIRHRIQD..S.LFYKQHLYLSNE................................-ATILPIIIEH..VHYIGG..............--TD.SSN.............................................RP.STFISCLFRL.LELEPSKE..........IIK.TYLTq............................................ldFNEFK..YLTALTLI....Y...I.....RLTYP........................SQEV....YS.IFD.....QY..FQDFR.KLRIKLKTP..............VFDSQklpiHYKITFIDEWVD.TLL.......VNERV...ID..L..MLPRLIPRTTLVE--rg...................................................................
I1EAR9_AMPQE/1-144                   ...............................................----------------------..C.QYWKEKCFALTA................................-ELLVDEAMA-..LDYVGG..............-VVG.GNI.............................................KP.TPFLCLILKM.LQIQPNKD..........IVI.EFIK...............................................NPDYK..YVRALGAL....Y...L.....RIVGT........................SVEC....YK.YLE.....PL..YNDYR.KIKYKNRQG..............-----....KFELSHVDEFVD.SLL.......REDRV...CD..V..ILPRIQKRHILEET-e....................................................................
A8X8F6_CAEBR/10-175                  ..............................................k-TVKGTNPQFLVEKIIRQRIYD..S.MYWKEHCFALTA................................-ELVVDKGMD-..LRYIGG..............-IYA.GNI.............................................KP.TPFLCLALKM.LQIQPDKD..........IVL.EFIQ...............................................QEEFK..YIRALGAM....Y...L.....RLTFD........................STEI....YK.YLE.....PL..YNDFR.KLRFMNKMG..............-----....RFEAIYMDDFID.NLL.......REDRY...CD..I..QLPRLQRRWALEE--vd...................................................................
A0A094AGC6_9PEZI/22-189              ............................................lap---NGLNPATIFEKPVRERIID..C.YFWKDQCFALNE................................-ADIVSRVVEH..VHFVAG..............-TYG.DSQ.............................................RP.SPFLCLAFKM.LQLGPGDD..........ILN.EYLGy.............................................gGERFK..YLRALACF....Y...V.....RLTRP........................AKEV....YE.TLE.....PF..LEDGR.KLRRRGRQG..............-----....-TSLTFVDQFVD.ELL.......TKERI...CA..T..SLWKMPKREVLEDL-e....................................................................
A0A0M3JW10_ANISI/46-229              ..............................................l-PLWGNTQSMNLNALVLENIIQ..C.TYYKNYLAETTG................................FQQLTEEIYYN..VKHLEP..............WERG.TRKtqgmtgmcg...........................gvrgvgaggVV.STAFCLLYKL.FTIRLTRK..........QLV.SMIN...............................................NRDSP..YIRGIGFM....Y...I.....RFCQP........................PTDL....WT.WME.....PY..LDDEE.---------..............QIDPRs..gGGDVMSMAQVVK.MML.......TKLDW...YG..T..LFPRIPVPIQKD---ie...................................................................
F6QPW1_MACMU/47-231                  ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
J3M4G7_ORYBR/3-166                   ............................................iqt---SGKPIDLLMEKVLCMNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKNL....WT.WYE.....PY..LKDDE.---------..............EFSPG...sNGRMTTMGVYVR.DLI.......LGQYY...FD..S..LLPRVPLPV------irqvt................................................................
E5A0N9_LEPMJ/24-234                  .............................................al--IRGQNPALLFEKGVRERITE..S.YYWKEQCFGLNA................................-ATLCDRAAE-..LKFIGG..............-ITG.ITG.............................................KP.TPFLCLAFKL.LQLVPEKA..........IIL.EYLNfrsddgeedeatngqnghangee.eegnvdegdkqvhkpqdlnaagkLGDFK..YLRCLAAF....Y...I.....RLAWQ........................PVEI....YK.TLE.....PL..LTDYR.KIKRRLKDG..............-----....-YTLTYIDQFID.DLL.......TKDRI...CA..T..SLWKLPSRANLEDL-d....................................................................
U6PD84_HAECO/69-253                  ..............................................l-PCWGNQQTMNLNGLVLENVKE..S.YYYKNHLVEIDT................................AQQLLDEVFYK..VKHLEP..............WEKG.TRKvqgmtgmcg...........................gvrgvgaggVV.SSAFCLLYRF.FKVRLTRK..........QLI.SMIN...............................................SRVSP..YIRGLGFM....Y...I.....RYTQP........................PADL....WE.WFE.....PY..LDDEE.---------..............EIDPRs..gGGDVMTFGQVVR.IML.......TKLDW...YG..T..LFPRIPVPIQKEID-e....................................................................
M1W229_CLAP2/24-191                  ............................................lap---NGLNPATIMEKAVRDRIVE..S.HFYMEQCFAVNE................................-ADIIDRVVEH..VTFVGG..............-TYG.DSQ.............................................KP.SPFLCLAFKL.LELGPSDE..........ILA.EYLSy.............................................gGEQFK..YLRALASF....Y...F.....RMTRQ........................AKDI....YE.TLE.....PF..LEDRR.KLRRKGRAG..............-----....-TSLTYVDEFVD.DLL.......VKERV...CA..T..SLWKMPKREILEDL-e....................................................................
L1J4V0_GUITH/160-321                 ...........................................kqvc------NDAYNLNPVLRENILA..S.DYFK-ALAEFTT................................FEELVDEIYNK..VTYATP..............-FIP.NTR.............................................SP.SSCFCLLYRL.FQMRLTYK..........QLA.DLLE...............................................HPDSP..MIPVVGIL....Y...V.....RYVVD........................PKEM....WG.FFK.....NK..INDST.---------..............EFDAS...pGGKKKTIGQFTR.EVI.......EDIHY...FD..T..ILPRIPVAIQRDM--qe...................................................................
W2QD97_PHYPN/37-201                  ..............................................l-PIYGNDTTYNLNTLLHQNILQ..S.AYFH-ELYKFRT................................YHEVVDEIYYR..VDHAEP..............WSPG.TAR.............................................IP.SSCFCLLHKF.FLMRLTRK..........QMQ.GLLR...............................................HTDSP..YIRAVGFL....Y...L.....RFTCD........................PEEL....WT.WFE.....PF..LEDPE.---------..............EFNASa..nPSVKTTIGEWLI.SLL.......EENNY...FG..T..ILPRIPKKIE-----dgik.................................................................
A0A059LRU5_9CHLO/10-175              ..............................................a-SVHGTNPQNLIEYIVRQKVYD..S.LYWKQECFGLTA................................-EGVVAKAAE-..LKYVGG..............-MHG.QPQ.............................................KP.SEFLCLALKL.LQIAPERG..........VVL.EFVR...............................................NEDFK..YLRLLGAF....Y...L.....RLVAR........................PAEI....YA.TLE.....PL..LLDSR.RVRRRDLAG..............-----....RFSLWHVDEAVD.ALL.......SKERV...YD..V..ALPRLTPRHVLEE--tg...................................................................
A0A0A1N932_9FUNG/9-173               ..............................................l-ETWGNETTMNMNAIIYQNILS..S.PYFR-SLYEKKT................................FHEIVDEIYNE..VTVLTP..............FIKG.-N-.............................................QP.STAFCLLFKL.WTIRLTVR..........QIE.NLVE...............................................HGDSP..YIRAIGFL....Y...L.....RYVCA........................PAKL....WD.WFQ.....YY..LEDDE.EIAI-----..............----Ss.glHPTKVTVGNLIR.MLI.......TELKF...QG..T..MLPRIPIPIAR----dlek.................................................................
F6HI04_VITVI/3-166                   ..........................................iqtsg-----KPIDSLLEKVLCMNILS..S.DYFK-ELYRLKT................................YHEVVDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAVGFL....Y...L.....RYAGD........................PKTL....WN.WFE.....PY..VKDEE.---------..............EFSPG...sTGRMTTMGAYVR.DLL.......LGQYY...FD..T..LFPRIPVPIMR----qiv..................................................................
C5X6Q2_SORBI/10-175                  ...............................................KSIHGTNPQNLVEKIVRSKIYQ..S.TYWKEQCFGLTA................................-ETLVDKAME-..LDHTGG..............-TYG.GNR.............................................KP.TPFLCLALKM.LQIQPDKD..........IVV.EFIK...............................................NEDYK..YVRVLGAF....Y...L.....RLTGT........................IADV....YQ.YLE.....PL..YNDYR.KIRHKLSDG..............-----....QFTLTHVDEFID.ELL.......TKDYS...CD..T..ALPRIQKRWVLEA--sg...................................................................
A0A0B0P1S4_GOSAR/10-175              ...............................................KSIRGTNPQNLVEKIVRSKIYQ..N.TYWKEQCFGLTA................................-ETLVDKAME-..LDHIGG..............-TYG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKD..........IVV.EFIK...............................................NDDYK..YVRVLGAF....Y...L.....RLTGI........................DSDI....YR.YLE.....PL..YNDYR.KVRRKSPDG..............-----....NFMLTHVDEVID.ELL.......TRDYS...CD..I..ALPRIKKRWTLES--lg...................................................................
A0A088A0G8_APIME/10-175              ...............................................KSIRGTNPQYLVEKIIRSRVYD..S.KYWKEECFALTA................................-ELLVDKAME-..LRYIGG..............-VYG.GNV.............................................KP.TPFLCLILKM.LQIQPEKD..........IIV.EFIK...............................................NEEFK..YVRALGAL....Y...M.....RLTGS........................SLDC....YK.YLE.....PL..FNDNR.KLRRQNKQG..............-----....KFELIHMDEFID.DLL.......REERC...CD..V..ILPRIQKRHVLEEN-n....................................................................
A0A0H5C1I8_CYBJA/16-169              ............................................rkh---KGVNSTELAEKIVRERVFD..S.LYWKLNCFNVNA................................-ATILNRCVE-..LRCVGS..............--FE.QSG.............................................RP.FPFLCLFVKL.IQMLPPSE..........IIE.FYLQ...............................................QHEFK..YLKVLALL....Y...V.....RIVER........................DQD-....--.TLR.....QH..LSDYR.KIILFENGA..............-----....-WSLTTVDVIVD.RLL.......TEDFF...IG..L..TLPF-----------mgas.................................................................
R9P9R0_PSEHS/10-175                  ..............................................h-SIHGTNPQHLIEKPIRYRIYS..S.PYWKQHCFALSA................................-STILPLATS-..LHHIGG..............-LIG.GLQ.............................................RP.SHFLCLLQKL.LQIQPDPS..........IID.AYLD...............................................ASDFK..YLRALTAF....Y...I.....RLTYD........................SKSI....YE.KLE.....PL..LEDGR.KLRWCRADG..............-----....GYEVMCVDEWVD.SLL.......REERV...CD..I..ILPRLVRREVCE---vrd..................................................................
G3BAA6_CANTC/7-180                   .......................................dkrrvsgy--------AHILETIVRNRIKD..S.LFYKQHLYLTNE................................-QTILQVIVDN..VKYVGG..............--LD.SSN.............................................RP.SPFLCCLLRL.LEIGPSAA..........VVG.LYLK...............................................QPEFK..YLTILTLI....Y...I.....RLTQP........................PTEV....YQ.VLD.....TY..RSNYT.KVRVLLSSP..............EMVDGv.pvNYGIIHIDEFVD.ELE.......RSDRV...VG..V..VMPRLESRRRL----varg.................................................................
U5CUR3_AMBTC/1-70                    ...............................................----------------------..-.------------................................-----------..------..............----.---.............................................--.----------.--------..........---.----...............................................-----..YVRILGAF....Y...L.....RLVGK........................PTDV....YQ.YLE.....PL..YNDYR.KLRRKSADG..............-----....SFVLIRVDEFID.ELL.......TKEHS...CD..I..ALPRVPK--------.....................................................................
A0A0F8UXB5_9EURO/21-212              ..............................................l--VRGVNPATLFEKAVRDRITD..S.YYWKEQCFGLNA................................-ATLCDRAVE-..LTSIGG..............-TYG.TSE.............................................KP.SPFLCLAFKL.LQLNPERD..........VVL.EYLNfsdpeldtneaege...................taagereqnsvlkqRGDFK..YLRALAAF....Y...V.....RLTFE........................PVEV....YK.TLE.....PL..LLDYR.KLKRRIRDS..............-----....-FTLTHVDAFID.DLL.......TKDRV...CG..T..SLWKLPSRQQLEDL-d....................................................................
E5RYR9_TRISP/10-175                  ..............................................a-SLKGTNPQYLIEKVTRSRIYD..S.RYWKEECFALSA................................-ELLVDRGME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLLLKM.LQIQPEKD..........IVI.EFIR...............................................QEDSK..YIRALGAL....Y...L.....RMTFS........................YVEV....YK.YLE.....PL..LNDYR.KLRWINKQG..............-----....KFELIHMDEFVD.KLL.......REERF...CD..V..QLPRLQKRAFLEE--tn...................................................................
D7FPC2_ECTSI/167-227                 ............................................lvh----------------------..-.------------................................-----------..------..............----.---.............................................--.----------.--------..........---.----...............................................-----..--------....-...-.....-----........................-EEL....WG.WLE.....PY..MDDEK.KFKPSPTEG..............-----....---SMTMGKWVR.KII.......SDMQY...YG..T..MLPRIPVLIER----kmk..................................................................
A0A0Q9WN88_DROMO/1-69                ...............................................----------------------..-.------------................................-----------..------..............----.---.............................................--.----------.--------..........---.----...............................................-----..-------M....Y...L.....RYTQP........................PGDL....YD.WYE.....DY..LQDEE.---------..............EIDVKa..gGGQVMTIGQMVY.QFM.......TKLDW...FS..T..LFPRIPVPIQKQIE-k....................................................................
E1BVP9_CHICK/50-234                  ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKTI--dq...................................................................
T1KXQ5_TETUR/61-245                  ..............................................l-PFWGNERTMNLNPLLLTNIKN..S.PYFKVNLYALKT................................YHEVIDEIWTQ..VKHMEP..............WEKG.SRRmggqtgmcg...........................svrgvgaggIV.STPFCILYKL.FTLRLTRK..........QVM.GLIK...............................................HKDSP..YIRAIGLM....Y...I.....RYTQP........................PESL....WE.WLS.....PY..LEDTE.---------..............EFDAKa..gGGQKMTIGQMCR.HLL.......VKLEW...FS..T..LFPRIPVPIQKDI--et...................................................................
D5GP15_TUBMM/20-183                  .............................................qt--FHGVNPLLLVEKIIRERIFE..S.LYWKEQAFGLNA................................-ATLLDRAVE-..LTYIGG..............-QY-.SNQ.............................................RP.TPFLCLTFKL.LQLQPSRE..........IIL.VYLN...............................................DPDFK..YLRSLAAF....Y...I.....RLTWS........................AVDI....YR.TLE.....PL..MGDYR.KLRVRGMGG..............-----....-WRMTYVDEFID.ELL.......TKERV...CD..I..ALPHIKTRAMLEDA-d....................................................................
A0A0L7LKK1_9NEOP/87-152              ...........................................mcgg----------------------..-.------------................................-----------..------..............----.---.............................................--.----------.--------..........---.----...............................................-----..--------....-...-.....----P........................PADL....FD.WYA.....EY..LYDEE.---------..............EVDPRa..gGGGPTTIGALVR.QMM.......IKLDW...FS..T..LFPRIPVPIQKQIE-q....................................................................
W5AKT7_WHEAT/3-166                   ............................................iqt---SGKPIDMLMEKVLCMNILS..S.DYFK-ELYQMKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKIL....WT.WYE.....PY..LKDDE.---------..............EFSPG...sNGRMTTMGVYVR.DLI.......LGQYY...FD..S..ILPRVPVPVV-----rqvt.................................................................
J7RRK2_KAZNA/15-210                  ...............................................KQLNHQSVSLVIPRLTRDKVHH..V.LYYKVNLEVGSLrg............................dtMLQLSKVLIRD..LGTIKAntl........nqtHILG.GVE.............................................--.--FKCLLMKL.VEIRPTRE..........QLV.YILEtq...........................................nkTFDDK..YIVALILT....Y...I.....RIQYFyvtl................hdelARKW....RE.LFK.....TY..MKDFR.KLKAVDFEQdc..........wsQSQKI....NVKVTHLDELID.WLV.......TETQI...WG..I..PLGMCQW-CNIY---ndsd.................................................................
K1WAK9_MARBU/21-188                  ............................................lap---NGLNPATIMEKPVRERIVD..C.YFWKDQCFAVNE................................-ADIVDRVVAH..VTFIGG..............-TYG.DAQ.............................................RP.SPFLCLAFKL.LQLGPTDE..........ILT.EYLEy.............................................gGEKFK..YLRALAMF....Y...I.....RLTRQ........................AKDV....YR.LLE.....PF..LADYR.KLKRRGRMG..............-----....-TSLTYVDVFAD.ELL.......VKDRV...CG..T..TLWKMPKREILEDL-d....................................................................
T1JGX1_STRMM/10-175                  ..............................................h-SVKGTNPQYLVEKIIRSRIYD..S.RFWKEECFALTA................................-ELLVDKAME-..MKFIGG..............-VFG.GNI.............................................KP.CAFLCLLLKM.LQIQPEKD..........IVV.EFIR...............................................NEDFK..YVRVLGAL....Y...M.....RLVGT........................SLDC....YK.YLE.....PL..YNDYR.KLKRQNRSG..............-----....LFEIVHMDELID.ELL.......RGERA...CD..I..ILPRIQKRYVLEE--ln...................................................................
A0A0D2T6W8_GOSRA/10-175              ...............................................KSIRGTNPQNLVEKIVRSKIYQ..N.TYWKEQCFGLTA................................-ETLVDKAME-..LDHIGG..............-TYG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKD..........IVV.EFIK...............................................NDDYK..YVRVLGAF....Y...L.....RLTGI........................DSDI....YR.YLE.....PL..YNDYR.KVRRKSPDG..............-----....NFMLTHVDEVID.ELL.......TRDYS...CD..I..ALPRIKKRWTLES--lg...................................................................
S8ESL2_FOMPI/10-173                  ..............................................e-AIHGQNPQYLVETVIRNRIYE..S.PYWKEHCFALTA................................-ETLIDKSIE-..LKCIGG..............-VYG.N-Q.............................................KP.TEFLCLLLKL.LQLQPQKE..........ILL.EYLQ...............................................ADEFK..YLRALAIM....Y...I.....RMTFR........................SVEV....YE.ILE.....PL..LKDYR.KIRYRGMNG..............-----....-YSLTYIDEFVD.NLL.......VEERV...CD..I..ILPRLTKRDVLEDN-g....................................................................
W7X6X1_TETTS/10-175                  ..............................................l-SVRGQNPQNLIEAVIRNKIYQ..N.RYWKEKLPGLTA................................-ASIIDEALE-..LDYVGG..............-TYG.GNR.............................................KP.SKFLMLSLKL.LQISPEKA..........EVM.EYIN...............................................QEDYK..YLTALGCF....Y...I.....RLVAS........................SEDI....YK.ILE.....PL..YADYR.KLRFRDLDG..............-----....SFKIIHMDEFVE.SLI.......NQEVY...LD..T..LLPNIQKRRVLEEN-g....................................................................
A9UQL8_MONBE/10-172                  .............................................gt--VHGANPQFLVEKIIRTRIYD..T.LYWKEHCFALTA................................-ETVIDKAVQ-..LDHIGG..............-VYG.GSI.............................................KP.TPFLCLTLKL.LQLAPDKD..........IIY.AYIA...............................................AKDFK..YLQALGVF....Y...L.....RLVGT........................AKEC....YS.YLE.....PF..LEDFR.KLRHMKRDG..............-----....QYELMHMDEFVD.QLL.......REDRV...CD..I..ILPRLMVRMQ-----pt...................................................................
E9EM03_METRA/24-191                  ............................................lap---NGLNPATIMEKAVKDRIVE..S.YFYKEQCFALNE................................-ADIVDRVVEH..VRFVGG..............-THG.DAQ.............................................KP.SPFLCLAFKL.LELGPSEA..........VVR.EYLSy.............................................gGEHFK..YLRALACF....Y...Y.....RLTRR........................AADV....HR.ALE.....PF..LGDRR.KLRTRGRRG..............-----....-AALTYVDEFVD.GLL.......TRERV...CA..T..SLWKMPPREVLEDL-d....................................................................
A0A0B4GRE7_9HYPO/24-191              ............................................lap---NGLNPATIMEKAVKDRIVE..S.YFYKEQCFALNE................................-ADIVDRVVEH..VRFVGG..............-THG.DAQ.............................................KP.SPFLCLAFKL.LELGPSEG..........VVR.EYLSy.............................................gGEHFK..YLRALACF....Y...Y.....RLTRR........................AADV....HR.ALE.....PF..LGDRR.KLRTRGRRG..............-----....-AGLTYVDEFVD.GLL.......TRERV...CA..T..SLWKMPPREVLEDL-d....................................................................
A0A0N4X5Z2_HAEPC/70-254              ..............................................l-PCWGNQQTMNLNGLVLENVKE..S.YYYKNHLVEIDT................................AQQLLDEVFYK..VKHLEP..............WEKG.TRKvqgmtgmcg...........................gvrgvgaggVV.SSAFCLLYRF.FKVRLTRK..........QLI.SMIN...............................................SRVSP..YIRGLGFM....Y...I.....RYTQP........................PADL....WE.WFE.....PY..LDDEE.---------..............EIDPRs..gGGDVMTFGQVVR.IML.......TKLDW...YG..T..LFPRIPVPIQKEID-e....................................................................
C5K487_PERM5/83-217                  ..................................khnngckkcreyk----------------------..-.------------................................--EWVVATLN-..VGNIRN..............---G.SLT.............................................VP.STMFCCLYRL.FVMRINSK..........VLG.QLIN...............................................YHGAP..YVRCAGFL....Y...V.....RFGLS........................PRDY....WS.FLQ.....PH..LLDDE.---------..............EFTPGc..dKGRIITMGEYVE.KLL.......TEDRY...YS..L..L--------------iiarlrsiee...........................................................
A0A024VK41_PLAFA/10-82               ...........................................iknf----GSNPQYLISNIIRSKIYD..S.PYWKEKCFALTS................................-ESIIDQAIN-..LKYVGG..............-TYG.GNR.............................................KP.TRFLCLIY--.--------..........---.----...............................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------iyiyiym..............................................................
G1SEF5_RABIT/10-175                  ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
Q54J00_DICDI/3-165                   ............................................let---FGNEKSMNLDNVLLTNIQS..S.LYFK-NLYPKRS................................YHEVIEEIKRN..VEILAP..............YIP-.NTK.............................................TP.STTFCLLYKF.FLMKLTVK..........QMK.GLLG...............................................NNESP..YIRAIGAL....Y...L.....RYCHP........................PANL....WD.WYV.....DY..LDDQE.---------..............TVFIS....KNTEVTIQRFLL.DLL.......KDNKF...SG..T..VLPRIPTKIQQD---ldk..................................................................
A0A059LNV7_9CHLO/42-209              ............................................leq---YGNSSTFNFENVIRQNVLI..S.SYYHKSAAVLDN................................WQALVDEIYYS..VDNVEP..............WMSG.NAR.............................................GP.TTAFNLLYRL.CQLRPTHG..........EIR.MMLD...............................................HKDSP..YIRAIGFL....Y...L.....RYVCN........................PRQL....WQ.WMQ.....PY..IEDSE.---------..............EFSPSp.egLGKTVSMGDFVR.DIL.......LDQYY...FE..T..IFPRIPKAVEDEI--ka...................................................................
I3LP32_PIG/10-97                     ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..--------....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------.....................................................................
A0A0D9WLP6_9ORYZ/3-166               ........................................iqssgrp-------IEVLMEKVLSVNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.SSAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYVAE........................PKTL....WG.WYE.....PY..ITDDE.---------..............EFSPG...sNGKMTTMGVYVR.DLI.......LGQYY...FD..S..LLPRVPL--------lilrqvt..............................................................
X0J3G6_FUSOX/26-192                  .............................................ap---NGLNPATIMEKAVKDRIVD..S.YFYKEQCFALNE................................-ADIVDRVVEH..VNFIGG..............-TYG.VTQ.............................................KP.SPFLCLAFKL.LELSPSDA..........VLM.EYLKy.............................................gGEAFK..YLRALACF....Y...F.....RLTRQ........................AKDV....YE.MLE.....PF..LEDRR.KLRRRGRAG..............-----....-VVLTFMDEFVD.ELL.......TKERV...CG..T..SLWKMPKREVLEDL-e....................................................................
A0A0M8P2W3_9EURO/73-256              ..............................................l--VRGVNPATLFEKAVRDRITD..S.YYWKEQCFGLNA................................-ATLCDRAVE-..LTSIGG..............-TYG.VSE.............................................KP.TPFLCLAFKL.LQLGPDRD..........VIL.ELLNytdpgsgdea...........................enpddalvkeRGDFK..YLRALAAF....Y...V.....RLTFE........................PVDI....YK.ILE.....PL..LLDYR.KLKRRVRDT..............-----....-FTLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKLPPRSQLEDL-d....................................................................
A0A096RF20_MAIZE/2-80                ............................................tvl----------------------..-.------------................................-----------..------..............----.---.............................................--.----------.--------..........---.----...............................................----R..YLVQIGFL....Y...L.....RYVAD........................PKVL....WM.WYE.....PY..LRDDE.---------..............EFSPG...sNGRKTTMGVYVR.DLI.......LGQYY...FD..S..LLPRIPLPVTRQ---ita..................................................................
K3ZF04_SETIT/3-166                   ............................................iqt---SGKPIDLLMEKVLCMNILS..S.EYFK-ELYRLKT................................YHEVIDEIYTC..VEHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKTL....WT.WYE.....PY..LRDDE.---------..............EFSPG...sNGRMTTMGVYVR.DLI.......LGQYY...FD..S..LLPRIPLPVT-----rqvt.................................................................
I3JV42_ORENI/25-209                  ..............................................l-PLWGNEKTMNLNPMILTNVLS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHIEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QLM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....FE.WYD.....GF..LDDEE.---------..............ELDVKa..gGGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKVI--dq...................................................................
W7AKF8_9APIC/252-414                 ............................................lem----TNTTTYNVNTLLRNNILS..S.EYFR-SLISFKT................................IKEVLDEIHLY..ADHVEP..............YCIG.STR.............................................AP.STLFCCLYKL.FTMHLSEK..........QMK.MLIE...............................................SRDSC..YIRACGFL....Y...L.....RYVHS........................PANL....WM.WFE.....PY..LLDED.--QFVT---..............----Sa..dKRKKQTIGEYIQ.SLL.......ADDKY...FN..T..VLPRMPIKIK-----nty..................................................................
M0X6G8_HORVD/3-153                   ............................................iqt---SGKPIDMLMEKVLCMNILS..S.DYFK-ELYRMKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKIL....WT.WYE.....PY..LKDDE.---------..............EFSPG...sNGRMTTMGVFVR.DLI.......LGQKL...CQ..-..---------------la...................................................................
G1THN5_RABIT/1-139                   ...............................................----------------------..-.------------................................-----------..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
B2ATX0_PODAN/63-230                  ............................................lap---NGLNPATILEKAVRERIVD..S.YFYKEQCYAINE................................-ADIVDRVVEH..VDHIGG..............-VTG.TVQ.............................................KP.TPFLCLAFKL.LQLAPNDD..........ILN.EYLNf.............................................gGEKFK..YLRALAVF....Y...I.....RLTRQ........................DKDV....YT.RLE.....PF..LEDRR.KLRRKGRNG..............-----....-VSLTYMDEFVD.DLL.......VKDRV...CA..T..SLWKMRRRDVLED--le...................................................................
V8PH37_OPHHA/10-175                  ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LRYTGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRLLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKNQNRNG..............-----....EFELMHVDEFID.QLL.......HDERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A0F9XUE7_TRIHA/26-193              ............................................lap---NGLNPATIMEKAVKDRIVD..S.YFYKEQCFALNE................................-ADIIDRVVEH..VNFIGG..............-THG.ASQ.............................................KP.SPFLCLAFKL.LELAPSDA..........ILN.EYLSy.............................................gGEHFK..YLRALACF....Y...V.....RLTRQ........................PKDV....YQ.TLE.....PF..LEDRR.KLRRKARAG..............-----....-TSLTYVDEFVD.DLL.......TKDRV...CA..T..SLWKMPKRETLEDL-e....................................................................
W5P5R7_SHEEP/10-175                  ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A0K0DK53_ANGCA/45-229              ..............................................l-SCWGNQQTMNLNGLVLENVKE..S.YYYKNHLVEIDS................................AQQLLDEVFYK..VKHLEP..............WEKG.TRKvqgmtgmcg...........................gvrgvgaggVV.SSAFCLLYRF.FKVRLTRA..........-IE.FVLG...............................................RC--H..HISVVWVL....C...I.....YATLS........................PQLI....YGnVLQ.....SPidIDDEE.---------..............EIDPRs..gGGDVMTFGQVVR.IML.......TKLDW...YG..T..LFPRIPVPIQKEID-e....................................................................
Q69K06_ORYSJ/10-175                  ...............................................KSIHGTNPQNLVEKIVRSKIYQ..S.TYWKEQCFGLTA................................-ETLVDKAME-..LDHTGG..............-TYG.GNR.............................................KP.TPFLCLALKM.LQIQPDKD..........IVV.EFIK...............................................NEDYK..YVRVLGAF....Y...L.....RLTAT........................VADV....YQ.YLE.....PL..YNDYR.KIRHKLSDG..............-----....KFTLTHVDEFID.DLL.......TKDYS...CD..T..ALPRIQKRWVLET--sg...................................................................
A0A099P229_PICKU/22-191              ..............................................q-RVHGLNRVLLMEKILREKVLD..S.QYWHVKASQLQF................................-YGLLKECVLH..VDCVGT..............YENS.AKT.............................................KT.TKFVALLLRL.LQLAEIPK..........DVV.EWLVv.............................................gDHGHV..YLSVLFMV....Y...V.....RLVFE.......................dSAEI....WK.LLE.....RK..YNEYD.KVRYIENGR..............-----....-VTDRHIDEIAD.GLL.......MESHF...VD..M..TLPRLVRRWVLEEK-g....................................................................
A0A0D9M0R0_9EURO/21-204              ..............................................l--VRGVNPATLFEKAVRDRITD..S.YYWKEQCFGLNA................................-ATLCDRAVE-..LTSIGG..............-TYG.VSE.............................................KP.TPFLCLAFKL.LQLGPDRD..........VIL.ELLNytdpgsgdea...........................enpddalvkeRGDFK..YLRALAAF....Y...V.....RLTFE........................PVDV....YK.TLE.....PL..LLDYR.KLKRRVRDT..............-----....-FTLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKLPPRSQLEDL-d....................................................................
Q8IM21_PLAF7/173-335                 ............................................lem----TNTTTYNVNTLLRNNILS..S.EYFK-SLIPIKT................................FKEVVDEIHSY..ADHVEP..............YCIG.SNR.............................................AP.STLFCCLYKF.FTMQLSEK..........QLK.SLIE...............................................NKDSC..YIRACGFL....Y...L.....RYVHS........................PANL....WM.WFE.....PY..LLEED.---------..............EFSISc..dKRRKVTIGEYVQ.SLL.......SDDKY...FN..T..VLPRLPIKIK-----nvy..................................................................
H2MLH7_ORYLA/25-209                  ..............................................l-PLWGNEKTMNLNPMILTNVLS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHIEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QLM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....LD.WYD.....GF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKMI--dq...................................................................
W5MME7_LEPOC/32-216                  ..............................................l-PLWGNEKTMNLNPMILTNVLS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHIEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PADL....MD.WFD.....SF..LDDEE.---------..............ELDVKa..gGGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKL---idq..................................................................
B4QGS9_DROSI/10-175                  ...............................................KNVHGTNPQYLIEKIIRSRIYD..S.KYWKEQCFALTA................................-ELLVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TQFLCLTLKM.LQIQPEKD..........IVV.EFIK...............................................NEEFK..YVRALGAF....Y...L.....RLTGA........................ALDC....YK.YLE.....PL..YIDNR.KLRRQNRAG..............-----....QFEIVYMDEYID.ELL.......RNDRV...CD..I..ILPRIQKRSILEEN-n....................................................................
V7BAP5_PHAVU/3-165                   .......................................iqtcgkpi--------DSLLEKVLCMNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAVGFL....Y...L.....RYCGD........................PKTL....WS.WFE.....PY..IKDDE.---------..............EFSPG...sNGRMTTMGVYIR.DLL.......LGQYY...FD..T..LFPRIPVPV------lrqv.................................................................
D7FPC2_ECTSI/52-172                  ..............................................l-PIHGNDRTFNLNTLLAQTILA..S.EYFK-SLAGITTylegvkivglaagdchtmtydvsgkaygwgsyREKVVDEIYSY..CDHVAP..............WAPG.TSR.............................................VP.SSAFCLLMKL.FVIKLTRP..........QMN.EILV...............................................HEE--..--------....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------l....................................................................
Q7PMU1_ANOGA/45-223                  ..............................................l-PLWGNETSMNLNPLILANIQG..S.SYFKVSLFKLKT................................YHEVVDEIYYQ..VKHLEP..............WERG.SRKtagqtgmcg...........................gvrgvgaggIV.STAFCLLYKL.YTLRLTRK..........QVN.GLLS...............................................HGDSP..YIRALGFM....Y...L.....RYTQP........................PSDL....FE.WYE.....PY..LLDEE.---------..............EIDVKa..gGGQIMTIGQMIR.QWL.......TKLDW...FS..T..LFPL-----------aqpdr................................................................
A0A094E0S4_9PEZI/22-189              ............................................lap---NGLNPATIFEKPVRERIID..C.YFWKDQCFALNE................................-ADIVSRVVEH..VHFVAG..............-TYG.DSQ.............................................RP.SPFLCLAFKL.LQLGPGDD..........ILK.EYLGy.............................................gGERFK..YLRALACF....Y...V.....RLTRP........................AKQV....YE.TLE.....PY..LEDGR.KLRRRGRQG..............-----....-TSLTFVDQFVD.ELL.......TKERI...CA..T..SLWKMPKREQLEDM-e....................................................................
A0A066WLJ0_9HOMO/10-172              ..............................................i-HIHGQNPQFLVEKVIRTRIWE..S.AFWKEECFALSE................................--SLIDKAIE-..LNTIGG..............-VYG.NQR.............................................-P.THFICLLLKL.LQIQPEKE..........ILI.EYLM...............................................VDEFK..YLRALAAM....Y...I.....RMTFP........................AVEV....YE.LLE.....PL..LKDYK.KIRLRNVAG..............-----....-YSLTFMDEFVD.QLL.......TEERV...CD..I..ILPRMAKREVLEET-e....................................................................
B4IGQ6_DROSE/1-166                   ...............................................----------------------..-.----------KT................................YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.YTLRLTRK..........QIN.GLLN...............................................HTDSA..YIRALVVA....F...A.....RRGPSislhlpa..........klrytqpPSDL....YD.WYE.....DY..LQDEE.---------..............EIDVKa..gGGQVLTIGQMVY.QFM.......TKLDW...FS..T..LFPRIPVPIQKQIE-k....................................................................
A0A094A3V8_9PEZI/1-139               ...............................................----------------------..-.------CFALNE................................-ADIVSRVVEH..VQFVAG..............-TYG.DSQ.............................................RP.SPFLCLAFKL.LQLGPGDD..........ILK.EYLGy.............................................gGERFK..YLRALACF....Y...V.....RLTRP........................AKEV....YE.TLE.....PF..LEDGR.KLRRRGRQG..............-----....-TSLTFVDQFVD.ELL.......TKERI...CA..T..SLWKMPKREVLEDL-e....................................................................
G3AGB8_SPAPN/17-194                  ............................................dkr---NVLNKAYLIEPIIRHRIQD..S.IFYKQHLYLTNE................................-ATILPIIVEH..VKYVSG..............--TD.SSG.............................................RP.SPFICCLLRM.LELEPSKD..........MID.TYLTq............................................lgFNEFK..YLTALALI....Y...V.....RLVYS........................SDVV....YK.TFD.....PY..FQDAR.KLRVKLKSPi...........fnEVKLP...iGYSLTYIDAWVD.ELL.......TRERV...VD..I..ILPRLVPRIKF----vesg.................................................................
I1EKT3_AMPQE/1-78                    ...............................................----------------------..-.------------................................-----------..------..............----.---.............................................--.----------.--------..........---.----...............................................-----..YVRALGAL....Y...L.....RIVGT........................SVEC....YK.YLE.....PL..YNDYR.KIKYKNRQG..............-----....KFELSHVDEFVD.SLL.......REDRV...CD..V..ILPRIQKRHILEET-e....................................................................
I1GG42_AMPQE/33-217                  ..............................................l-PLFGNKETMNINNMIITNILQ..S.RYFKIELYEKKT................................FHEVVDEIFYR..VEHLEP..............WEKN.SRKlsgqvgmca...........................gvrgvaaggIV.STPFCLLYKL.FTLKLTRK..........QVK.VMLN...............................................HVDSP..YIRGLGFM....Y...I.....RYCQP........................PNNF....LD.WFS.....PY..LEDEE.---------..............EIDLKa..gGGYPVTIGVMCH.MML.......TKMEW...FG..T..MFPRISVNVQKDI--hd...................................................................
K6UDH3_9APIC/10-45                   ..............................................i-KIFGSNPQYLISNIIRSKIYE..S.PYWKEKCFALTL................................-----------..------..............----.---.............................................--.----------.--------..........---.----...............................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------l....................................................................
B8P4M7_POSPM/8-160                   ..............................................q-AIHGQNPQFLVETVIRNRIYE..S.PFWKEHCFALTA................................-ESLIDKAID-..LKAIGG..............-VYG.N-Q.............................................KP.TEFLCLLLKL.LQIQPEKE..........ILL.EYLQ...............................................ADEFK..YLRALAVM....Y...I.....RMTFS........................AADV....YE.ILE.....PL..LKDYR.KIRYRGMNG..............-----....-YSLTYMDEFVD.NLL.......VDERV...CD..I..ILPR-----------.....................................................................
G8BDC4_CANPC/23-200                  ..........................................dkrni-----LNKAYLVEPIVRHRIHD..S.IFYKQHLYLTNE................................-STILPVITQN..VQYIAG..............--VD.SIG.............................................RP.SPFLQCLLRL.LELEPAKE..........IIN.VYLDq............................................lsYNEFK..YLTALTLL....Y...I.....RLVYP........................SEDI....YN.IFD.....KH..AQDYR.KLRFKLKTPq...........fnA---VqqpiYYKLGYMDEFID.DLL.......TQERV...VD..L..ILPRLIPRLSLV---erg..................................................................
A0A0D2USY9_GOSRA/10-175              ...............................................KSIRGTNPQNLVEKIVRSKIYQ..N.TYWKEQCFGLTA................................-ETLVDKAME-..LDHIGG..............-TYG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKD..........IVV.EFIK...............................................NDDYK..YVRVLGAF....Y...L.....RLTGI........................DSDI....YR.YLE.....PL..YNDYR.KVRRKSPDG..............-----....NFMLTHVDEVID.ELL.......TRDYS...CD..I..ALPRIKKRWTLES--lg...................................................................
G1N3A5_MELGA/1-182                   ...............................................---WGNEKTMNLNPMILTNILS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV..............--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKTI--dq...................................................................
A0DJV2_PARTE/10-175                  .........................................hlandg------RQMTLIDQIIRNKVFN..C.RYWKEDCFGLTA................................-VTLVDKACK-..LDCVGA..............-TYS.GTG.............................................KP.VPFLCLLMKL.LQINPDKE..........III.EFLK...............................................SKDYK..YISALAMF....Y...I.....RLTSK........................PKEA....YP.TIE.....QF..YADFR.KIRIRNLDG..............-----....TFAIWHMDELAE.KLL.......SEEII...FG..I..SLPRFQKRWILEE--lg...................................................................
L7JXS8_TRAHO/4-152                   ............................................ykl-----------FSNPIKEKILK..S.PYFK-EIKNYDL................................-DQTISDAHK-..LSSIGS..............LVYG.S--.............................................-P.HPFICLLQKL.ESLNVDNN..........TML.EKYHg............................................alREENS..TVIMFFVF....Y...F.....RMTAK........................MKNE....FN.EIK.....KP..LENKKlLVKIVDENN..............-----....ESYSVTIKEVLN.MLQ.......SNKYV...FG..I..FMK------------si...................................................................
F9X714_ZYMTI/19-186                  .............................................tl--IRGDNPLKLFEKPVRDRIVD..S.YYWKEQCFGLNA................................-ATVLDRAVE-..LTFLGG..............-TYG.VAQ.............................................KP.TPFLCLAFKL.LQLTPEKE..........IIM.YYLEq.............................................aGEEFK..YLRALAAF....Y...V.....RMAWE.......................kDEDV....YT.TLE.....PY..LADFR.KLKRRTREG..............-----....-WALTHVDQFID.DLL.......VKSRV...CA..T..TLPKINPRTFLEDE-d....................................................................
H2TYE2_TAKRU/22-164                  ..............................................l-PLWGNEKTMNLNPMILTNVLS..S.PYFKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QLM.GLIT...............................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PPDL....LE.WYD.....GF..LDDDE.---------..............-----....------------.---.......-----...--..-..---------------iyt..................................................................
N6U570_DENPD/23-207                  ..............................................l-PLYGNERTMNLNALILTNIQS..S.HYFKVNLYELKT................................YHEVVDEIYYK..VSHLEP..............WEKG.SRRtsgqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.FTLKLTRK..........QLN.GLIT...............................................HCDSP..YIRALGFM....Y...I.....RYVFP........................PSAL....LD.WYE.....EY..LEDEE.---------..............ELDVKa..gGGQNMTMGQILR.QWL.......VKLEW...FS..T..LFPRIPVPIQHRI--qk...................................................................
I2H5J2_TETBL/16-212                  ...............................................KQLNHQSVSLVIPRLTRDKIHS..A.LYYKVNLQDPSMrg............................ntLLGLNNVIIRD..LGTLNNesi........nkkNVLG.GVE.............................................--.--FKCILMKL.VELRPTIE..........QLD.IILEisd.........................................atgEFNNK..YIIALILV....Y...L.....RIQYYyane................tsdeAKRF....KA.LFQ.....QY..INDYR.KMKAISLNIdc..........wsQSQII....TVELIHMDELVH.WLS.......AKDNI...WG..I..PLGKCSWCNILE---df...................................................................
B4M6P8_DROVI/28-212                  ..............................................l-PLWGNETSMNLNPLILANIQS..S.SYFKVHLFKLKT................................YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.YTLRLTRK..........QLN.GLLN...............................................HTDSA..YIRALGFM....Y...L.....RYTQP........................PGDL....YD.WYE.....DY..LQDEE.---------..............EIDVKa..gGGQVLTIGQMVY.QFM.......TKLDW...FS..T..LFPRIPVPIQKQIE-k....................................................................
A0A022R4J6_ERYGU/6-166               ........................................ssgrpid---------QLFEKVLSINIVS..S.DYYR-DLLRLNT................................YNEVIDEIYVT..VTHVEP..............WMTG.NCR.............................................GP.STAYCLLYKF.FTMKLTVK..........QMH.GLLQ...............................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKTL....WS.WYE.....PY..IKDDE.---------..............EFSPG...sNGRTTSMGAYLR.DLL.......LGQYY...FD..T..LFPRIPVL-------virsi................................................................
V9DTB5_PHYPR/11-61                   ..............................................q-SVHGVNPQTLVEKIMRNRIYA..S.IYWKEQCFGLTA................................-EALVDKILS-..------..............----.---.............................................--.----------.--------..........---.----...............................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------rqqegsw..............................................................
R1EUR9_EMIHU/44-217                  ..........................................dpvhg------APAFNINPMLLEGIRM..GdRFWE--LAKLTT................................FGEVVDAIFYE..VKYVTP..............WVPG.THGkrssgmqs............................avrgvsnagTP.GIAYTMLLKL.FLLRLTRD..........QVR.SLLR...............................................HPDSP..YIRAIGFL....Y...L.....RLGLY.......................dFKEL....WA.WFQ.....PY..LGDDD.Q--F-----..............FIDGT....PATATTIGE---.---.......-----...--..-..---------------fdffgdrlprlpvlvsrqie.................................................
Q7RLR7_PLAYO/177-256                 ............................................lem----TNTSTYNVNNLLRNNILS..S.EYFR-SLITLKT................................FKEVLDEILSY..ADHAEP..............YCIG.STR.............................................AP.STLFCCLYKL.FTMHLSKK..........QV-.----...............................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------..............-----....------------.---.......-----...--..-..---------------i....................................................................
A0A0M0UHW7_9PEZI/24-191              ............................................lap---NGLNPATIMEKAVRERIVE..S.YFYKEQCFGVNE................................-ADIVDRVVDH..VDFIGG..............-VYG.TVQ.............................................KP.TPFLCLAFKL.LQLAPSDA..........ILD.EYLNf.............................................gGEKFK..YLRALAVF....Y...I.....RLTRP........................DRDV....YT.LLE.....PF..LEDRR.KLRRKGRNG..............-----....-TTLTYMDVFVD.DLL.......TKDRV...CA..T..SLWKMRKRDILED--le...................................................................
B2WHZ6_PYRTR/23-234                  ..............................................k-LIRGQNPALLFEKGVRERITE..S.YYWKEQCFGLNA................................-ATLCDRAAE-..LKFIGG..............-TTG.ING.............................................KP.TPFLCLAFKM.LQLVPDKD..........IIL.EYLNfrdddddeeqkdhdtdanadaenghisdtdsttaaakktldlnakgkLGNFK..YLRCLAAF....Y...I.....RLAWE........................PVEI....YT.TLE.....PL..LTDYR.KIKRRLKDA..............-----....-FTLTYIDQFVD.DLL.......TKERI...CG..T..SLWKLPSRANLEDL-d....................................................................
A0A067BPW6_SAPPC/9-173               ..............................................t-HVHGVNPQHLVEKILRNRIYD..C.MYWKEHCFGLTE................................-ETLVEKAIE-..LSYIAG..............-HFG.GNQ.............................................QP.SPFLCLLLKM.LQMQPDMD..........VVM.TFIE...............................................NGDYK..YVTALGAM....Y...L.....RLTGK........................PVEI....YP.VLE.....NL..LSDYR.KVRFRKTMG..............-----....-WDVLHMDEVAD.LLL.......REEYF...CN..I..ALPRLVDRFQLET--mn...................................................................
C5LD14_PERM5/10-181                  ............................................aga---HGGNPQFLISQIVRDRVYS..L.RYWKEECFGLNA................................-ETILDKAAE-..LKYVGT..............-VYG.SLQ.............................................RP.SPFLCLLVKL.LQIGPEKE..........IIK.SFIDlsa.........................................gddAGELR..YLRALACT....Y...L.....RYIGR........................PDEI....YN.WLE.....PV..LWDYR.QIVVRKLDG..............-----....SFEISNLDTWVN.TLL.......TEDEI...IT..L..GLPKLPQRHILEER-e....................................................................
B4HSN2_DROSE/10-175                  ...............................................KNVHGTNPQYLIEKIIRSRIYD..S.KYWKEQCFALTA................................-ELLVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TQFLCLTLKM.LQIQPEKD..........IVV.EFIK...............................................NEEFK..YVRALGAF....Y...L.....RLTGA........................ALDC....YK.YLE.....PL..YIDNR.KLRRQNRAG..............-----....QFEIVYMDEYID.ELL.......RNDRV...CD..I..ILPRIQKRSILEEN-n....................................................................
A0A074Z976_9PEZI/19-183              .............................................tl--IRGQNPLLLFEKAVRDRIID..S.YYWKEQCFGLNA................................-ATLCDRAVE-..LSFIGG..............-TYG.IGQ.............................................KP.TPFLCLAFKL.LQLTPEKE..........IIL.HYLQ...............................................QEEWK..YLRALAAF....Y...I.....RLTWE........................PKDI....YE.TLE.....QY..LGDYR.KLKRRTRDA..............-----....-YSLSYVDQFVD.DLL.......TKDRI...CA..T..SLWKMPTRTQLEDL-d....................................................................
C4M949_ENTHI/7-169                   ..............................................l-PTQGNTRTMNIDSILFTNITH..S.DYMFKTLGSIHS................................ISDLIDIIIND..VHYISP..............YIQK.SSS.............................................SP.STAFCVLLRL.FQLNPTPD..........DIR.MMST...............................................H-SNK..YVRCIAAL....I...I.....RYSIQ........................FNLL....LS.YLK.....PF..VDDRA.-VVNISLHG..............-----....-EKTKQIKCLVK.DLI.......LEPKF...EG..C..ILPRIPQ--------vyykp................................................................
I1JHT5_SOYBN/4-166                   .......................................qtcgrpid---------SLLEKVLCMNILS..S.DYFK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HLDSP..YIRAVGFL....Y...L.....RYCAD........................PKTL....WN.WFE.....PY..VKDDE.---------..............EFSPG...sNGRMTTMGVYVR.DLL.......LGQYY...FD..T..LFPRIPVPV------lrqvv................................................................
A0A0D2P7T1_GOSRA/1-112               ...............................................----------------------..-.------------................................-----------..------..............-MTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK...............................................HPDSP..YIRAIGFL....Y...L.....RYAAD........................PKTL....WS.WFE.....PY..IKDEE.---------..............EFSPG...sSGRMTTMGVYVR.DLL.......LGQYY...FD..T..LFPRIPVPVL-----rqvt.................................................................
R1F3N7_EMIHU/15-180                  ..............................................i-SVHGTNPQNLVEKILRSKIYN..H.AYWKEHCFGLTA................................-ESLVDKAME-..LDTVGG..............-TFG.GIR.............................................EP.SHFIQLTLKM.LQIQPEKE..........IVL.EFIK...............................................NEDYK..YVRALGAF....Y...L.....RLTGR........................PAEV....FQ.YLE.....PL..YNDYR.KLRRRLASG..............-----....EYCLVHVDELVD.ELL.......RDEYV...FD..L..ALPHLPKRHTL----vasg.................................................................
A0A0N1PBP9_LEPSE/285-423             .............................rlltvfeqheqdvsavlr----------------------..-.------------................................------YCEQK..VRYAGV..............--FD.DDE.............................................EA.SPFLIAMGLC.WRLHLTMD..........DVC.RHFA...............................................RHPRR..VIRALALY....L...A.....RYTLA........................PEDY....VH.FFL.....PS..LNDEV.IIACTEDAQ..............-----....--VTHSMKDLSR.QLL.......TRNDV...VD..A..WLPMLAR--------ywqdh................................................................
J4C3Z9_THEOR/10-175                  .............................................hl--IHGTNPQFLFSKILRDKVYN..S.FYWKESCFGLTA................................-ESLIDKAVQ-..LKYVGG..............-TFG.GNR.............................................QP.SPFLCLVLKM.LQIQPDME..........IVH.EYIK...............................................NEDFK..YLRALGVY....Y...M.....RLVGG........................AAEV....YG.TLE.....PI..LGDYR.KLRFRNTDG..............-----....SYSIKYMDEFVD.ECL.......TSSTY...LD..V..DFPPLAKRMSLEA--tr...................................................................
L5K6N9_PTEAL/10-175                  ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG..............-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
Q7SHZ0_NEUCR/24-191                  ............................................lap---NGLNPATIMEKAVRERIID..S.YFYKEQCFGVNE................................-ADIVDRVVEH..VDFIGG..............-VYG.TVQ.............................................KP.SPFLCLAFKL.LQLAPSDD..........ILN.EYLQf.............................................gGEKFK..YLRALALF....Y...I.....RLTRK........................DQDV....YK.TLE.....PF..LEDRR.KLRRKGRNG..............-----....-TSLTYMDVFVD.DLL.......TKDRV...CA..T..SLWKMRKRDILEDL-d....................................................................
E7NHW7_YEASO/15-219                  ...............................................KQLNNQSVSLVIPRLTRDKIHN..S.MYYKVNLSNESLrg............................ntMVELLKVMIGA..FGTIKGqng.......hlhmMVLG.GIE.............................................--.--FKCILMKL.IEIRPNFQ..........QLN.FLLNvk..........................................nenGFDSK..YIIALLLV....Y...A.....RLQYYylngn.............nkndddENDL....IK.LFKvq.lyKY..SQHYF.KLKSFPLQVdc..........faHSYNE....ELCIIHIDELVD.WLA.......TQDHI...WG..I..PLGKCQWNK------iynsde...............................................................
D0NNV1_PHYIT/37-201                  ..............................................l-PIYGNDTTYNLNTLLHQNILQ..S.AYFH-DLYKFRT................................YHEVVDEIYYR..VDHAEP..............WSPG.TAR.............................................IP.SSCFCLLHKF.FLMRLTRK..........QMQ.GLLR...............................................HSDSP..YIRVVGFL....Y...L.....RFTCD........................PEEL....WT.WFE.....PY..LEDSE.---------..............EFNASa..nPSLKTTIGEWLI.SLL.......EENNY...FG..T..ILPRIPKKIE-----dgik.................................................................
G2R425_THITE/24-192                  ............................................lap---NGLNPATIMEKAVRERIVE..S.YFYKEQCFGVNE................................-ADIVDRVVEH..VHFIGG..............VYGS.GGQ.............................................RP.TPFLCLAFKL.LQLAPGDD..........VLR.EYIGf.............................................gGDKFK..YLRALALF....Y...V.....RLTRP........................DKDV....YM.TLE.....PF..LEDRR.KLRRKGRNG..............-----....-TSLTYMDEFVD.DLL.......TKDRV...CG..T..SLWKMRKRDILED--le...................................................................
A7ARD6_BABBO/10-175                  .............................................vm--VHGTNPQNLFSKILRDKVYN..S.MYWKESCFGLTA................................-ESIIDKAID-..LQYIGG..............-TFG.GNR.............................................QP.SPFLCLVLKL.LQIQPEIE..........IIQ.EYIR...............................................NEEFK..YLRALGIY....Y...M.....RLVGN........................AVQI....YQ.NLE.....PV..YADYR.KLRFRNNDG..............-----....SYDIRHMDEFVD.DCL.......RLSSY...LD..V..DLPILPKRMILEET-k....................................................................
G4VNB2_SCHMA/10-175                  ..............................................h-TVHGTNPQYLLEKIVRSRIYE..S.KFWKEHCFALTA................................-ELLVDKAVE-..LRYVGG..............-VYS.GSV.............................................KP.TPFLCLTLKM.LQIQPDKD..........IVI.EFIK...............................................QEPYK..YARALGAF....Y...L.....RLVGD........................SVEI....YK.YLE.....TL..YNDFR.RLKFQDKMG..............-----....NFSLIYMDDFID.QLL.......TEERV...CD..V..ILPRLQKREVLEE--ln...................................................................
B0JYW3_XENTR/10-175                  ..............................................h-SVHGTNPQYLVEKIIRTRIYE..S.KYWKEECFGLTA................................-ELVVDKAME-..LKYVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK...............................................NEDFK..YVRTLGAL....Y...M.....RLTGT........................ATDC....YK.YLE.....PL..YNDYR.KVKVQNRNG..............-----....EFELMHVDEFID.QLL.......HEERV...CD..V..ILPRLQKRFVLEET-e....................................................................
E3KGQ2_PUCGT/10-176                  ..............................................l-SIHGTNPQFLIDKVLRSRIYE..S.EYWKESCFGLTA................................-ESIIDKTVFE..LSYLGS..............-TFT.ANL.............................................RP.TVFICLLLKL.LQLQPEKE..........IIL.EYLR...............................................AEEFK..YLRALAAF....Y...V.....RLTFS........................PINV....YQ.TLE.....PL..LQDYR.KLRTRNLDG..............-----....SYGLMTFDELID.SLL.......TETIV...FE..V..VLPRLTSRKVLEE--le...................................................................
A0A058ZG82_9EUKA/14-178              ..............................................k-SYHGTNPMNLIPKIMRERIFN..S.LYWKERCFGLND................................-ADVVDRAAE-..ITHIGG..............-TYG.HTN.............................................TA.TPFICLALKL.LR-SPNRE..........TLI.AFID...............................................QTHFK..YLRALGAF....V...F.....RLIAP........................SADI....YN.YLE.....PL..LIDLR.KLRMRNQEG..............-----....EFYLSFLDSFVD.ELL.......TETHV...LG..V..PMPTLVQRHVLEA--ag...................................................................
A0A098VUZ7_9MICR/10-175              ...............................................KSIHGTDPQFLIEKIVRERIYE..S.LYWKQECYDLTT................................-ESLVEKAVR-..LSHIGS..............-TFG.GNQ.............................................KP.TPFLCLLLKL.LQLQPDFE..........IVY.ALIK...............................................DPTFK..YLRILASF....Y...L.....RLVGR........................PRDI....YE.NLE.....PL..YSDYR.KIRVKAPSS..............-----....DYYLLCIDQVIE.TLL.......NEDGI...FS..I..HLPRIPKRRDVEAK-d....................................................................
A0A0E0AZ81_9ORYZ/10-175              ...............................................KSIHGTNPQNLVEKIVRSKIYQ..S.TYWKEQCFGLTA................................-ETLVDKAME-..LDHTGG..............-TYG.GNR.............................................KP.TPFLCLALKM.LQIQPDKD..........IVV.EFIK...............................................NEDYK..YVRVLGAF....Y...L.....RLTAT........................VADV....YQ.YLE.....PL..YNDYR.KIRHKLSDG..............-----....KFTLTHVDEFID.DLL.......TKDYS...CD..T..ALPRIQKRWVLET--sg...................................................................
H6BS57_EXODN/19-185                  .............................................pl--IRGQNPALLFETPMRDRITD..S.LYWKEQCFGLNA................................-ATLCDRAVE-..LTYIGG..............-TYG.VAM.............................................KP.TPFICLAFKL.LTLVPDKE..........IVL.EYLKn.............................................gGEEWK..YLRALAAF....Y...I.....RLTFD........................PADV....YK.TLE.....PL..LEDYR.KLRYRRKET..............-----....-YELIHMDEFVD.NLL.......TKERV...CG..T..SLWKLPARQLLEDL-d....................................................................
C5GJR6_AJEDR/21-214                  ..............................................l--IRGANPATLFEKAVRDRITD..S.YYWKEQCFGLNA................................-ATLCDRAVE-..LTYIGG..............-TYG.LAQ.............................................KP.TPFLCLAFKL.LQLAPEKD..........IVL.EYLNfhdpenerveggegn.................gleeeqdandgvvkaVGDFK..YLRALAAF....Y...I.....RLTFD........................AADI....YR.TLE.....PL..LVDYR.KLKRRTKDG..............-----....-FMLTYIDQFVD.DLL.......TKDRV...CG..T..SLWKLPSRTQLEDL-d....................................................................
Q95Y35_CAEEL/55-239                  ..............................................l-PVWGNKVTMNLNTLVLENIRE..S.YYYKNNLVEIDN................................FQTLIEQIFYQ..VKHLEP..............WEKG.TRRlqgmtgmcg...........................gvrgvgaggVV.SSAYCLLYRL.FNLKISRK..........QLI.SMLN...............................................SRQSV..YIRGLGFM....Y...I.....RYTQP........................PADL....WY.WLE.....PY..LDDDR.---------..............EIDPRs..gGGDLMTFGQLVR.TMI.......NKLDW...YG..T..LFPRIPVPIQKDID-e....................................................................
J9B997_WUCBA/47-231                  ..............................................l-PLWGNTQTMNLNALVLENIIQ..C.TYYKNYLAETTG................................FQQLTEEIYYS..VKHLEP..............WERG.TRKtqgmtgmcg...........................gvrgvgaggVV.STAFCLLYKL.FTIRLSRK..........QLV.SMIN...............................................NSDSP..YIRGIGFM....Y...I.....RFCQP........................PQDL....WA.WME.....PY..LDDEE.---------..............QIDPRs..gGGDVMVMAQVVK.MML.......TKLDW...YG..T..LFPRIPVPIQKEI--el...................................................................
A0A074RWM6_9HOMO/10-173              ..............................................i-HIHGQNPQFLVEKVIRTRIWE..S.SYWKEECFALTA................................-ESVIDKAIE-..LNTIGG..............-VYG.NQR.............................................-P.THFICLLLKL.LQIQPEKE..........ILI.EYLM...............................................VDEFK..YLRALAAM....Y...V.....RMTFP........................AVEV....YE.LLE.....PL..LKDYR.KIRLRNMAG..............-----....-YSLTFIDEFVD.QLL.......TEERV...CD..I..ILPRMSKREVFEE--te...................................................................
W7X5L5_TETTS/175-341                 .............................................si---WEYDSSGTLNPKLKTNIMN..S.SYFKIDLFSLKT................................YHEVIDEIQKH..VNHAEP..............YAIG.PTG.............................................VP.STLFCCLYKF.MLMKLTVK..........QVK.GLVE...............................................YKQSP..MVRAIGFL....Y...I.....RFCCD........................PKYM....FA.WFK.....KH..LLDDE.EFKPGAD--..............----K....NSPNMTIGDYVE.KLL.......SDQEY...YG..T..RLPRIPIKIETK---ika..................................................................
A0A0B2VGD8_TOXCA/46-230              ..............................................l-PLWGNTQSMNLNALVLENIIQ..C.TYYKNYLSDTTG................................FQQLTEEIYYN..VKHLEP..............WERG.TRKtqgmtgmcg...........................gvrgvgaggVV.STAFCLLYKL.FTIRLTRK..........QLV.SMIN...............................................NRDSP..YIRGIGFM....Y...I.....RFCQP........................PTDL....WA.WME.....PY..LEDEE.---------..............QIDPRs..gGGDLMTMAQVVK.MML.......TKLDW...YG..T..LFPRIPVPIQKEIE-q....................................................................
#=GC SS_cons                         ..............................................---BTTB-GGGGS-HHHHHHHHC..S.HHHHHHSTT--G................................-GGHHHHHTT-..---EE-..............-EET.TTT.............................................EE.-HHHHHHHHH.HHH---HH..........HHH.HHHH...............................................-SS-H..HHHHHHHH....H...H.....HHHS-........................HHHH....HH.HHG.....GG..GG---.EEEEE-TTS..............-----....-EEEEEHHHHHH.HHH.......H-SEE...TT..E..E------CHHHCCT-T....................................................................
#=GC seq_cons                        ..............................................h..hhGpssphll-pll+spIhs..S..YaK.phasLss.................................ppllDchhp...lpalts...............hhG.ssp.............................................tP.osahCLlhKh.hplpsscc...........lh.thlp...............................................pp-.p..YlRALGhh....Y...l.....Rhsts........................st-l....ap.ahE.....Ph..lpD.c.clp....ts.......................thplhphscalc.pLL.......pcpch...hs..h..hLPRlshph.hp...p....................................................................
//
DBGET integrated database retrieval system