GenomeNet

Database: Pfam
Entry: PRP38
LinkDB: PRP38
Original site: PRP38 
#=GF ID   PRP38
#=GF AC   PF03371.14
#=GF DE   PRP38 family
#=GF AU   Bateman A, Winge P
#=GF SE   Winge P
#=GF GA   22.40 22.40;
#=GF TC   23.00 22.50;
#=GF NC   22.00 21.50;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 26740544 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   1508195
#=GF RT   PRP38 encodes a yeast protein required for pre-mRNA splicing and
#=GF RT   maintenance of stable U6 small nuclear RNA levels. 
#=GF RA   Blanton S, Srinivasan A, Rymond BC; 
#=GF RL   Mol Cell Biol 1992;12:3939-3947.
#=GF RN   [2]
#=GF RM   9582287
#=GF RT   Progression through the spliceosome cycle requires Prp38p
#=GF RT   function for U4/U6 snRNA dissociation. 
#=GF RA   Xie J, Beickman K, Otte E, Rymond BC; 
#=GF RL   EMBO J 1998;17:2938-2946.
#=GF DR   INTERPRO; IPR005037;
#=GF CC   Members of this family are related to the pre mRNA splicing 
#=GF CC   factor PRP38 from yeast [1].  Therefore all the members of this
#=GF CC   family could be involved in splicing.  This conserved region
#=GF CC   could be involved in RNA binding. The putative domain is about
#=GF CC   180 amino acids in length. PRP38 is a unique component of the
#=GF CC   U4/U6.U5 tri-small nuclear ribonucleoprotein (snRNP) particle
#=GF CC   and is necessary for an essential step late in spliceosome
#=GF CC   maturation [2]. 
#=GF SQ   1334
#=GS B0WBK2_CULQU/28-212         AC B0WBK2.1
#=GS A0A0C9XDF4_9AGAR/10-173     AC A0A0C9XDF4.1
#=GS B9H3J6_POPTR/3-167          AC B9H3J6.1
#=GS I0Z2X4_COCSC/2-166          AC I0Z2X4.1
#=GS G0W4U6_NAUDC/16-222         AC G0W4U6.1
#=GS A0A093EJ78_9AVES/1-102      AC A0A093EJ78.1
#=GS C5FIK5_ARTOC/25-209         AC C5FIK5.1
#=GS A0A0V1L665_9BILA/78-243     AC A0A0V1L665.1
#=GS C5K6I2_PERM5/108-276        AC C5K6I2.1
#=GS PRP38_ARATH/10-175          AC Q8LB54.1
#=GS A0A0F7TUV8_9EURO/21-204     AC A0A0F7TUV8.1
#=GS A0A091TZ82_PHORB/1-183      AC A0A091TZ82.1
#=GS D3BAL0_POLPA/154-210        AC D3BAL0.1
#=GS A0A067RRD2_ZOONE/10-175     AC A0A067RRD2.1
#=GS W7J9T8_PLAFA/11-175         AC W7J9T8.1
#=GS A0A154PH93_9HYME/10-175     AC A0A154PH93.1
#=GS S0DNK7_GIBF5/26-192         AC S0DNK7.1
#=GS A0A0N1NXL0_9EURO/19-185     AC A0A0N1NXL0.1
#=GS J9I2Y7_9SPIT/195-356        AC J9I2Y7.1
#=GS A0A093XH37_9PEZI/1-164      AC A0A093XH37.1
#=GS A0A0E0PTE6_ORYRU/4-166      AC A0A0E0PTE6.1
#=GS A0A0N5AFH1_9BILA/10-174     AC A0A0N5AFH1.1
#=GS A0A177WQJ2_BATDE/9-159      AC A0A177WQJ2.1
#=GS H2MEA7_ORYLA/10-179         AC H2MEA7.1
#=GS G4TPS2_SERID/10-173         AC G4TPS2.1
#=GS A0A132BC42_9HELO/21-188     AC A0A132BC42.1
#=GS L2G882_COLGN/24-191         AC L2G882.1
#=GS C4Y6R0_CLAL4/3-178          AC C4Y6R0.1
#=GS C6HES4_AJECH/21-214         AC C6HES4.1
#=GS U9TVS5_RHIID/10-166         AC U9TVS5.1
#=GS A0A0D3G3V7_9ORYZ/3-166      AC A0A0D3G3V7.1
#=GS A0A091LHF6_CATAU/1-111      AC A0A091LHF6.1
#=GS U3JLV7_FICAL/10-175         AC U3JLV7.1
#=GS F2PU74_TRIEC/21-222         AC F2PU74.1
#=GS N1R8N2_FUSC4/26-192         AC N1R8N2.1
#=GS A0A0L7M0N4_PLAF4/173-289    AC A0A0L7M0N4.1
#=GS G5AIQ4_PHYSP/37-201         AC G5AIQ4.1
#=GS G8YPM8_PICSO/12-188         AC G8YPM8.1
#=GS W5KVG4_ASTMX/10-175         AC W5KVG4.1
#=GS H2S675_TAKRU/10-175         AC H2S675.1
#=GS W2YXI6_PHYPR/11-61          AC W2YXI6.1
#=GS W5FCD2_WHEAT/10-175         AC W5FCD2.1
#=GS A0A091VKC1_PHORB/1-108      AC A0A091VKC1.1
#=GS H0Z2D2_TAEGU/48-232         AC H0Z2D2.1
#=GS G3N4L7_GASAC/1-34           AC G3N4L7.1
#=GS A0A091DJ53_FUKDA/1-176      AC A0A091DJ53.1
#=GS A0A167E2X0_9PEZI/24-191     AC A0A167E2X0.1
#=GS A8BAJ9_GIAIC/1-145          AC A8BAJ9.1
#=GS A0A074W0U8_9PEZI/19-183     AC A0A074W0U8.1
#=GS W7HV93_9PEZI/23-186         AC W7HV93.1
#=GS T1H306_MEGSC/10-175         AC T1H306.1
#=GS W5MGQ8_LEPOC/10-175         AC W5MGQ8.1
#=GS W5L4F4_ASTMX/24-208         AC W5L4F4.1
#=GS A0A0D2QSW4_GOSRA/3-162      AC A0A0D2QSW4.1
#=GS A0A085M8W0_9BILA/10-175     AC A0A085M8W0.1
#=GS W9XE09_9EURO/20-185         AC W9XE09.1
#=GS A0A0R3QY60_9BILA/10-175     AC A0A0R3QY60.1
#=GS A0A066VG41_9BASI/10-174     AC A0A066VG41.1
#=GS W2XZF6_PHYPR/9-173          AC W2XZF6.1
#=GS A0A0N4VGU5_ENTVE/46-253     AC A0A0N4VGU5.1
#=GS S7QHR4_GLOTA/10-173         AC S7QHR4.1
#=GS I3MZU9_ICTTR/10-159         AC I3MZU9.1
#=GS F6UQW2_HORSE/10-175         AC F6UQW2.1
#=GS A0A0U5FWE5_9EURO/21-212     AC A0A0U5FWE5.1
#=GS A0A117DYI4_ASPNG/21-207     AC A0A117DYI4.1
#=GS A0A151M474_ALLMI/50-234     AC A0A151M474.1
#=GS A0A0S4KG86_BODSA/222-355    AC A0A0S4KG86.1
#=GS V3ZLZ8_LOTGI/10-175         AC V3ZLZ8.1
#=GS A0A0V1NN14_9BILA/427-610    AC A0A0V1NN14.1
#=GS M4A2I4_XIPMA/25-209         AC M4A2I4.1
#=GS F7A5D9_CALJA/47-231         AC F7A5D9.1
#=GS M3K4S3_CANMX/17-194         AC M3K4S3.1
#=GS A0A0C9ZG06_9HOMO/10-99      AC A0A0C9ZG06.1
#=GS A0A0A1NZE8_9FUNG/11-174     AC A0A0A1NZE8.1
#=GS S8BH21_PENO1/21-204         AC S8BH21.1
#=GS M0SG80_MUSAM/10-174         AC M0SG80.1
#=GS A0A087SV61_9ARAC/13-197     AC A0A087SV61.1
#=GS A0A0V0WEJ5_9BILA/427-610    AC A0A0V0WEJ5.1
#=GS A1CAF4_ASPCL/21-209         AC A1CAF4.1
#=GS Q4YH72_PLABA/10-175         AC Q4YH72.1
#=GS A0A091P9S9_APAVI/1-141      AC A0A091P9S9.1
#=GS L8FWG2_PSED2/22-189         AC L8FWG2.1
#=GS D8LWY4_BLAHO/35-198         AC D8LWY4.1
#=GS W2SQD8_NECAM/544-708        AC W2SQD8.1
#=GS E2A1P6_CAMFO/10-175         AC E2A1P6.1
#=GS A0A0K0EJ62_STRER/6-171      AC A0A0K0EJ62.1
#=GS A0A0L9SRI6_9HYPO/24-191     AC A0A0L9SRI6.1
#=GS G0QNS3_ICHMG/118-284        AC G0QNS3.1
#=GS Q2H4I5_CHAGB/105-167        AC Q2H4I5.1
#=GS F6SY19_ORNAN/10-56          AC F6SY19.1
#=GS D6X552_TRICA/24-208         AC D6X552.1
#=GS A0A183N3X9_9TREM/26-210     AC A0A183N3X9.1
#=GS A0A0C4E3X3_MAGP6/24-191     AC A0A0C4E3X3.1
#=GS A0A0K6G8X0_9HOMO/10-173     AC A0A0K6G8X0.1
#=GS A0A095C2R6_CRYGR/9-163      AC A0A095C2R6.1
#=GS A0A074T919_HAMHA/142-303    AC A0A074T919.1
#=GS A0A099Z750_TINGU/50-234     AC A0A099Z750.1
#=GS L5LMJ2_MYODS/10-175         AC L5LMJ2.1
#=GS Q4E0F0_TRYCC/9-176          AC Q4E0F0.1
#=GS W4FTM1_9STRA/9-142          AC W4FTM1.1
#=GS Q4N1F2_THEPA/1-29           AC Q4N1F2.1
#=GS T1K3B4_TETUR/10-175         AC T1K3B4.1
#=GS A0A0M3ILB4_ASCLU/10-168     AC A0A0M3ILB4.1
#=GS H2WNF1_CAEJA/10-112         AC H2WNF1.2
#=GS A0A074ZRA8_9TREM/29-213     AC A0A074ZRA8.1
#=GS W4GRF9_9STRA/57-221         AC W4GRF9.1
#=GS F0XUL2_GROCL/26-192         AC F0XUL2.1
#=GS A0A0C2Z7C8_HEBCY/10-173     AC A0A0C2Z7C8.1
#=GS A0A0L6WW45_9AGAR/10-168     AC A0A0L6WW45.1
#=GS A0A075AYX0_9FUNG/10-174     AC A0A075AYX0.1
#=GS M7YQW6_TRIUA/1-102          AC M7YQW6.1
#=GS U6Q036_HAECO/10-175         AC U6Q036.1
#=GS A0A091EHF6_CORBR/1-141      AC A0A091EHF6.1
#=GS A0A0C2X5H9_AMAMU/10-173     AC A0A0C2X5H9.1
#=GS S7NNI0_MYOBR/1-75           AC S7NNI0.1
#=GS A0A0V0TYI5_9BILA/59-224     AC A0A0V0TYI5.1
#=GS A0A0D3B635_BRAOL/10-175     AC A0A0D3B635.1
#=GS C1E4N5_MICCC/10-173         AC C1E4N5.1
#=GS F7GLK3_MONDO/52-236         AC F7GLK3.1
#=GS F2EBP1_HORVD/3-150          AC F2EBP1.1
#=GS G8F4J3_MACFA/47-231         AC G8F4J3.1
#=GS A2QN12_ASPNC/21-209         AC A2QN12.1
#=GS B8AYN3_ORYSI/3-166          AC B8AYN3.1
#=GS A0A0F4YPS0_TALEM/21-208     AC A0A0F4YPS0.1
#=GS A0A091RT37_9GRUI/1-134      AC A0A091RT37.1
#=GS E2QU96_CANLF/10-175         AC E2QU96.2
#=GS A0A0A2KNT9_PENIT/21-204     AC A0A0A2KNT9.1
#=GS A0A183EQT3_9BILA/10-58      AC A0A183EQT3.1
#=GS F7ISR6_CALJA/47-92          AC F7ISR6.1
#=GS C5LME5_PERM5/21-137         AC C5LME5.1
#=GS G3NPB2_GASAC/10-174         AC G3NPB2.1
#=GS A0A0D3BZE4_BRAOL/4-168      AC A0A0D3BZE4.1
#=GS W5QC53_SHEEP/39-223         AC W5QC53.1
#=GS J4G8D4_9APHY/10-193         AC J4G8D4.1
#=GS F7VQJ3_SORMK/24-191         AC F7VQJ3.1
#=GS A0A0R3R2G3_9BILA/1-84       AC A0A0R3R2G3.1
#=GS C4JLP1_UNCRE/21-208         AC C4JLP1.1
#=GS H2N6K2_PONAB/47-231         AC H2N6K2.1
#=GS A0A091T598_PHALP/10-175     AC A0A091T598.1
#=GS A0A078A1R7_STYLE/10-175     AC A0A078A1R7.1
#=GS L1LC98_THEEQ/10-175         AC L1LC98.1
#=GS A0A0V0XEY1_TRIPS/10-175     AC A0A0V0XEY1.1
#=GS A0A0R3U8G8_9CEST/10-175     AC A0A0R3U8G8.1
#=GS F4P219_BATDJ/9-173          AC F4P219.1
#=GS G2PZZ7_MYCTT/24-191         AC G2PZZ7.1
#=GS A0A0V0WDJ5_9BILA/541-724    AC A0A0V0WDJ5.1
#=GS A0A0D2R045_GOSRA/3-166      AC A0A0D2R045.1
#=GS A0A0R3PB76_ANGCS/1-106      AC A0A0R3PB76.1
#=GS A0A0H2S7A6_9HOMO/10-173     AC A0A0H2S7A6.1
#=GS A0A0W7VHJ3_9HYPO/26-193     AC A0A0W7VHJ3.1
#=GS A0A044QM65_ONCVO/10-175     AC A0A044QM65.1
#=GS E9EAI6_METAQ/24-191         AC E9EAI6.1
#=GS W9QWY7_9ROSA/10-174         AC W9QWY7.1
#=GS K3VWG0_FUSPC/26-192         AC K3VWG0.1
#=GS S9VFC1_9TRYP/46-244         AC S9VFC1.1
#=GS A0A0L0SI27_ALLMA/324-483    AC A0A0L0SI27.1
#=GS G1LCH7_AILME/47-231         AC G1LCH7.1
#=GS A0A093CLS2_TAUER/5-189      AC A0A093CLS2.1
#=GS A0A0G4F474_VITBC/149-314    AC A0A0G4F474.1
#=GS K7IUN1_NASVI/10-175         AC K7IUN1.1
#=GS V2XVC5_MONRO/10-173         AC V2XVC5.1
#=GS C3ZRP3_BRAFL/7-191          AC C3ZRP3.1
#=GS A0A0K9PSL8_ZOSMR/10-175     AC A0A0K9PSL8.1
#=GS A0A096MX21_PAPAN/48-232     AC A0A096MX21.1
#=GS D0NHN2_PHYIT/9-173          AC D0NHN2.1
#=GS A8PRE0_MALGO/10-174         AC A8PRE0.1
#=GS A0A194PYC3_PAPXU/10-175     AC A0A194PYC3.1
#=GS PRP38_SCHPO/14-177          AC Q9UUD2.1
#=GS W7AJL3_PLAVN/162-324        AC W7AJL3.1
#=GS A0A093QAV3_PHACA/1-115      AC A0A093QAV3.1
#=GS G4V8E6_SCHMA/26-210         AC G4V8E6.1
#=GS A0A0E0QMP1_ORYRU/10-175     AC A0A0E0QMP1.1
#=GS Q5CUQ1_CRYPI/3-168          AC Q5CUQ1.1
#=GS A0A167L4L6_9HYPO/24-191     AC A0A167L4L6.1
#=GS C1MPU3_MICPC/21-182         AC C1MPU3.1
#=GS A6QTF5_AJECN/41-234         AC A6QTF5.1
#=GS A0A0K0JRM4_BRUMA/47-231     AC A0A0K0JRM4.1
#=GS C7YSE8_NECH7/25-192         AC C7YSE8.1
#=GS F9F8Y6_FUSOF/26-192         AC F9F8Y6.1
#=GS W9YRJ2_9EURO/20-185         AC W9YRJ2.1
#=GS W4ZDU0_STRPU/160-344        AC W4ZDU0.1
#=GS S7MIS8_MYOBR/56-199         AC S7MIS8.1
#=GS A0A093CGG2_9AVES/10-194     AC A0A093CGG2.1
#=GS S3DD72_GLAL2/21-188         AC S3DD72.1
#=GS A9P852_POPTR/3-167          AC A9P852.1
#=GS A0A0B1T4B6_OESDE/60-111     AC A0A0B1T4B6.1
#=GS A0A0D3H3F8_9ORYZ/10-175     AC A0A0D3H3F8.1
#=GS A0C3P9_PARTE/86-247         AC A0C3P9.1
#=GS A0A024TF87_9STRA/1-98       AC A0A024TF87.1
#=GS G0S1D3_CHATD/24-191         AC G0S1D3.1
#=GS G0S1D3_CHATD/24-191         DR PDB; 5F5T B; 24-191;
#=GS G0S1D3_CHATD/24-191         DR PDB; 5F5U A; 24-191;
#=GS G0S1D3_CHATD/24-191         DR PDB; 5F5V D; 24-191;
#=GS G0S1D3_CHATD/24-191         DR PDB; 5F5V A; 24-191;
#=GS G0S1D3_CHATD/24-191         DR PDB; 5F5T A; 24-191;
#=GS G0S1D3_CHATD/24-191         DR PDB; 5F5U D; 24-191;
#=GS G0S1D3_CHATD/24-191         DR PDB; 5F5U G; 24-191;
#=GS H9JEJ8_BOMMO/23-207         AC H9JEJ8.1
#=GS E3QPI7_COLGM/24-191         AC E3QPI7.1
#=GS K7GHE6_PELSI/10-175         AC K7GHE6.1
#=GS Q0DKA8_ORYSJ/3-101          AC Q0DKA8.2
#=GS W6UMV2_ECHGR/10-175         AC W6UMV2.1
#=GS J9EVG5_WUCBA/10-175         AC J9EVG5.1
#=GS A0A096LYD0_POEFO/28-178     AC A0A096LYD0.1
#=GS A0A044STF6_ONCVO/47-231     AC A0A044STF6.1
#=GS A0A0L0CFU8_LUCCU/10-175     AC A0A0L0CFU8.1
#=GS M0W6M8_HORVD/1-69           AC M0W6M8.1
#=GS G0NBD0_CAEBE/55-239         AC G0NBD0.1
#=GS PR38A_PONAB/10-175          AC Q5RDD2.1
#=GS A0A183RI45_9TREM/33-164     AC A0A183RI45.1
#=GS Q6C616_YARLI/15-178         AC Q6C616.1
#=GS A0A0B1P5C4_UNCNE/21-188     AC A0A0B1P5C4.1
#=GS A0A0V0R8K3_PSEPJ/2167-2332  AC A0A0V0R8K3.1
#=GS Q5KIE6_CRYNJ/9-172          AC Q5KIE6.2
#=GS M4C7M0_BRARP/10-175         AC M4C7M0.1
#=GS A0A0N4VL93_ENTVE/10-174     AC A0A0N4VL93.1
#=GS A0A091STT2_9AVES/1-108      AC A0A091STT2.1
#=GS A0A094HRU1_9PEZI/22-189     AC A0A094HRU1.1
#=GS R1EST0_EMIHU/1-175          AC R1EST0.1
#=GS E1GES1_LOALO/47-231         AC E1GES1.2
#=GS A0A0C2MT08_THEKT/43-227     AC A0A0C2MT08.1
#=GS A0A0V1NN92_9BILA/46-229     AC A0A0V1NN92.1
#=GS A0A060SR90_PYCCI/10-173     AC A0A060SR90.1
#=GS A0A0L9UWE1_PHAAN/3-166      AC A0A0L9UWE1.1
#=GS A0A087STH6_AUXPR/10-175     AC A0A087STH6.1
#=GS A0A0N5DGF6_TRIMR/10-175     AC A0A0N5DGF6.1
#=GS H2S676_TAKRU/10-175         AC H2S676.1
#=GS A0A059B3E7_EUCGR/58-223     AC A0A059B3E7.1
#=GS A0A0R3PB76_ANGCS/101-151    AC A0A0R3PB76.1
#=GS G1NFA1_MELGA/10-175         AC G1NFA1.2
#=GS A0A167TG90_9PEZI/25-192     AC A0A167TG90.1
#=GS F4WXJ8_ACREC/37-220         AC F4WXJ8.1
#=GS M2T688_COCH5/23-228         AC M2T688.1
#=GS G3R6P3_GORGO/47-231         AC G3R6P3.1
#=GS A0A093H533_PICPB/10-175     AC A0A093H533.1
#=GS A0A0M8ZVI6_9HYME/10-175     AC A0A0M8ZVI6.1
#=GS A0A0E0LY62_ORYPU/10-175     AC A0A0E0LY62.1
#=GS A0A0D9QS50_PLAFR/183-345    AC A0A0D9QS50.1
#=GS A0A093J7E8_EURHL/1-141      AC A0A093J7E8.1
#=GS A0A0K9PM83_ZOSMR/3-167      AC A0A0K9PM83.1
#=GS T1I5E1_RHOPR/4-188          AC T1I5E1.1
#=GS A0A0B2X748_9HYPO/24-191     AC A0A0B2X748.1
#=GS A0A0P7BAJ7_9HYPO/26-193     AC A0A0P7BAJ7.1
#=GS A0A084W1A0_ANOSI/53-237     AC A0A084W1A0.1
#=GS G3UEL4_LOXAF/10-175         AC G3UEL4.1
#=GS W9RQ05_9ROSA/3-101          AC W9RQ05.1
#=GS F4K753_ARATH/1-113          AC F4K753.1
#=GS A5K4Y5_PLAVS/10-175         AC A5K4Y5.1
#=GS A0A0V0S371_9BILA/10-175     AC A0A0V0S371.1
#=GS W2ZJH7_PHYPR/37-201         AC W2ZJH7.1
#=GS A0A0V1NNY3_9BILA/546-729    AC A0A0V1NNY3.1
#=GS V5EEC2_KALBG/10-174         AC V5EEC2.1
#=GS A0A093QTN5_PHACA/23-207     AC A0A093QTN5.1
#=GS A0A0L0VSX0_9BASI/10-176     AC A0A0L0VSX0.1
#=GS A0A0P4UI92_ROSNE/1-80       AC A0A0P4UI92.1
#=GS N1JK20_BLUG1/21-188         AC N1JK20.1
#=GS A0A0L0GCU8_9EUKA/12-136     AC A0A0L0GCU8.1
#=GS E7KNP5_YEASL/15-219         AC E7KNP5.1
#=GS A0A0L1I7A1_PLAFA/11-175     AC A0A0L1I7A1.1
#=GS W7A7D1_9APIC/10-175         AC W7A7D1.1
#=GS G0N8A9_CAEBE/10-175         AC G0N8A9.1
#=GS A0A0B1T4B6_OESDE/113-297    AC A0A0B1T4B6.1
#=GS A0A0K0FA69_9BILA/6-171      AC A0A0K0FA69.1
#=GS F7CZ30_MACMU/10-176         AC F7CZ30.1
#=GS A0A0R3X512_HYDTA/10-175     AC A0A0R3X512.1
#=GS A0A0L1IBQ2_PLAFA/173-335    AC A0A0L1IBQ2.1
#=GS B0D223_LACBS/10-173         AC B0D223.1
#=GS W1QC60_OGAPD/14-179         AC W1QC60.1
#=GS A0A158NUY7_ATTCE/37-220     AC A0A158NUY7.1
#=GS A0A0A0MRN0_HUMAN/2-120      AC A0A0A0MRN0.1
#=GS M9LTE5_PSEA3/10-174         AC M9LTE5.1
#=GS A0A0K8L2H4_9EURO/21-209     AC A0A0K8L2H4.1
#=GS D4AX30_ARTBC/21-222         AC D4AX30.1
#=GS A0A091VKU0_NIPNI/25-209     AC A0A091VKU0.1
#=GS A0A0N4UD64_DRAME/10-175     AC A0A0N4UD64.1
#=GS U6JTB6_EIMAC/135-297        AC U6JTB6.1
#=GS C3ZFR3_BRAFL/10-175         AC C3ZFR3.1
#=GS K3YT29_SETIT/10-175         AC K3YT29.1
#=GS D8QUJ9_SELML/10-175         AC D8QUJ9.1
#=GS M4BZA9_HYAAE/9-147          AC M4BZA9.1
#=GS A0A139AS28_GONPR/11-222     AC A0A139AS28.1
#=GS W6KZR3_9TRYP/4-141          AC W6KZR3.1
#=GS H3ATS7_LATCH/10-175         AC H3ATS7.1
#=GS Q4Y906_PLACH/157-319        AC Q4Y906.1
#=GS A0A183LYE7_9TREM/4-75       AC A0A183LYE7.1
#=GS A0A0L0HMA2_SPIPN/10-174     AC A0A0L0HMA2.1
#=GS A0A061H922_9BASI/10-174     AC A0A061H922.1
#=GS M5XCM3_PRUPE/1-41           AC M5XCM3.1
#=GS R4GD49_ANOCA/32-216         AC R4GD49.1
#=GS W5JA90_ANODA/10-175         AC W5JA90.1
#=GS B4GH52_DROPE/10-175         AC B4GH52.1
#=GS A4RVT9_OSTLU/18-191         AC A4RVT9.1
#=GS D3ZGL5_RAT/10-175           AC D3ZGL5.1
#=GS E3LKU1_CAERE/55-239         AC E3LKU1.1
#=GS M4BIY1_HYAAE/37-168         AC M4BIY1.1
#=GS G3PQV1_GASAC/24-208         AC G3PQV1.1
#=GS A0A183T2T2_SCHSO/10-175     AC A0A183T2T2.1
#=GS A0A0F8A580_9HYPO/24-192     AC A0A0F8A580.1
#=GS H2TYE1_TAKRU/22-206         AC H2TYE1.1
#=GS A0A0D9QTL7_PLAFR/10-175     AC A0A0D9QTL7.1
#=GS A0A183DZ28_9BILA/2-96       AC A0A183DZ28.1
#=GS A0A087XDU8_POEFO/25-209     AC A0A087XDU8.2
#=GS A0A0E0A4V5_9ORYZ/4-150      AC A0A0E0A4V5.1
#=GS F6UKW2_XENTR/35-219         AC F6UKW2.1
#=GS K0SGM5_THAOC/41-200         AC K0SGM5.1
#=GS L8H6U6_ACACA/87-250         AC L8H6U6.1
#=GS Q4N084_THEPA/10-175         AC Q4N084.1
#=GS J3P436_GAGT3/24-191         AC J3P436.1
#=GS W5FVI4_WHEAT/10-175         AC W5FVI4.1
#=GS H0V3G0_CAVPO/48-232         AC H0V3G0.1
#=GS A0A0L9UT28_PHAAN/1-70       AC A0A0L9UT28.1
#=GS S9WYR5_9TRYP/4-144          AC S9WYR5.1
#=GS E0VHT3_PEDHC/1-176          AC E0VHT3.1
#=GS T0KFN0_COLGC/1-66           AC T0KFN0.1
#=GS F6I4Q5_VITVI/10-175         AC F6I4Q5.1
#=GS A0A093J1G4_EURHL/1-135      AC A0A093J1G4.1
#=GS A0A0V0VGV7_9BILA/62-227     AC A0A0V0VGV7.1
#=GS B0WP85_CULQU/10-175         AC B0WP85.1
#=GS C0PCD4_MAIZE/3-167          AC C0PCD4.1
#=GS A0A068XDW1_HYMMI/27-211     AC A0A068XDW1.1
#=GS W9C3G0_9HELO/21-188         AC W9C3G0.1
#=GS Q4U8Q2_THEAN/128-301        AC Q4U8Q2.1
#=GS R7Z359_CONA1/20-205         AC R7Z359.1
#=GS A0A137PCB3_CONC2/7-170      AC A0A137PCB3.1
#=GS A0A0D2Q6L2_9AGAR/10-173     AC A0A0D2Q6L2.1
#=GS A0A061EDX2_THECC/3-165      AC A0A061EDX2.1
#=GS A0A091P601_APAVI/1-108      AC A0A091P601.1
#=GS A0A091IIP3_CALAN/10-194     AC A0A091IIP3.1
#=GS A0A0D2XW34_FUSO4/26-192     AC A0A0D2XW34.1
#=GS A0A091RVT0_NESNO/1-181      AC A0A091RVT0.1
#=GS W9S3F4_9ROSA/21-93          AC W9S3F4.1
#=GS A0A0N4UBE8_DRAME/12-155     AC A0A0N4UBE8.1
#=GS A0A090MUW1_STRRB/13-194     AC A0A090MUW1.1
#=GS V4TZ97_9ROSI/4-144          AC V4TZ97.1
#=GS A0A022RAJ0_ERYGU/10-174     AC A0A022RAJ0.1
#=GS G0RPR5_HYPJQ/26-193         AC G0RPR5.1
#=GS T0RRR2_9STRA/9-173          AC T0RRR2.1
#=GS M2Z5Y8_PSEFD/16-183         AC M2Z5Y8.1
#=GS A0A0N4Z164_PARTI/30-211     AC A0A0N4Z164.1
#=GS B3L5D4_PLAKH/10-175         AC B3L5D4.1
#=GS F0YB92_AURAN/58-222         AC F0YB92.1
#=GS I4Y8C3_WALMC/10-173         AC I4Y8C3.1
#=GS D3BAL0_POLPA/67-160         AC D3BAL0.1
#=GS M3D6M0_SPHMS/19-186         AC M3D6M0.1
#=GS X6N3G1_RETFI/102-235        AC X6N3G1.1
#=GS A0A0B2QJB0_GLYSO/10-175     AC A0A0B2QJB0.1
#=GS G3IJU9_CRIGR/2-120          AC G3IJU9.1
#=GS A0A0J0XCS7_9TREE/8-171      AC A0A0J0XCS7.1
#=GS U6J7B2_ECHGR/27-211         AC U6J7B2.1
#=GS H3ERC6_PRIPA/1-44           AC H3ERC6.1
#=GS M7BW90_CHEMY/1-176          AC M7BW90.1
#=GS C0NU08_AJECG/21-213         AC C0NU08.1
#=GS A0A0P7UMF5_9TELE/30-214     AC A0A0P7UMF5.1
#=GS A0A139GXK9_9PEZI/19-186     AC A0A139GXK9.1
#=GS L8GYB7_ACACA/10-175         AC L8GYB7.1
#=GS F4X868_ACREC/10-175         AC F4X868.1
#=GS A0A0A1NVB9_9FUNG/9-173      AC A0A0A1NVB9.1
#=GS A9RTY4_PHYPA/10-175         AC A9RTY4.1
#=GS A0A0A8L5Y3_9SACH/14-213     AC A0A0A8L5Y3.1
#=GS A0A077ZK60_TRITR/10-192     AC A0A077ZK60.1
#=GS A0A0D2VQS3_CAPO3/6-173      AC A0A0D2VQS3.1
#=GS A0A165Z6Q5_9HOMO/10-173     AC A0A165Z6Q5.1
#=GS A0A183L565_9TREM/10-101     AC A0A183L565.1
#=GS A0A0M3K6D9_ANISI/10-174     AC A0A0M3K6D9.1
#=GS E7Q418_YEASB/15-219         AC E7Q418.1
#=GS N1PRZ9_DOTSN/19-186         AC N1PRZ9.1
#=GS A0A0U1LW96_9EURO/21-204     AC A0A0U1LW96.1
#=GS D8LWJ8_BLAHO/10-174         AC D8LWJ8.1
#=GS C5MCZ6_CANTT/17-194         AC C5MCZ6.1
#=GS M5W7Z5_PRUPE/24-176         AC M5W7Z5.1
#=GS W7TQL1_9STRA/10-174         AC W7TQL1.1
#=GS A4I1H4_LEIIN/271-441        AC A4I1H4.1
#=GS A0A024G6E6_9STRA/44-209     AC A0A024G6E6.1
#=GS I6ND91_ERECY/14-229         AC I6ND91.1
#=GS W4XFI6_STRPU/10-175         AC W4XFI6.1
#=GS R1CRP3_EMIHU/49-231         AC R1CRP3.1
#=GS A0A0D2A1B5_9EURO/20-185     AC A0A0D2A1B5.1
#=GS B8MD54_TALSN/21-183         AC B8MD54.1
#=GS A0A0N4T6E4_BRUPA/10-175     AC A0A0N4T6E4.1
#=GS J9J8A1_9SPIT/306-471        AC J9J8A1.1
#=GS R0F627_9BRAS/1-113          AC R0F627.1
#=GS A0A087H484_ARAAL/10-175     AC A0A087H484.1
#=GS A8NG64_COPC7/10-173         AC A8NG64.2
#=GS G6CYI7_DANPL/22-206         AC G6CYI7.1
#=GS A0A067LVA7_9HOMO/10-173     AC A0A067LVA7.1
#=GS A0A0G2H3B7_9PEZI/20-207     AC A0A0G2H3B7.1
#=GS A0A0E0PI94_ORYRU/3-166      AC A0A0E0PI94.1
#=GS W4FS00_9STRA/9-173          AC W4FS00.1
#=GS A0A0D1ZHM0_9EURO/19-185     AC A0A0D1ZHM0.1
#=GS S2JJG8_MUCC1/10-170         AC S2JJG8.1
#=GS A0A0T6B203_9SCAR/10-175     AC A0A0T6B203.1
#=GS G9NT24_HYPAI/26-193         AC G9NT24.1
#=GS M2S990_COCSN/23-231         AC M2S990.1
#=GS M5XBU6_PRUPE/4-166          AC M5XBU6.1
#=GS W7MMC8_GIBM7/26-192         AC W7MMC8.1
#=GS G2WYK7_VERDV/26-193         AC G2WYK7.1
#=GS J9HJD8_AEDAE/67-225         AC J9HJD8.1
#=GS F8Q691_SERL3/10-173         AC F8Q691.1
#=GS A0A067R513_ZOONE/39-223     AC A0A067R513.1
#=GS C5Z170_SORBI/3-167          AC C5Z170.1
#=GS S3BY96_OPHP1/26-192         AC S3BY96.1
#=GS G3GW00_CRIGR/10-175         AC G3GW00.1
#=GS I1IIQ1_BRADI/10-175         AC I1IIQ1.1
#=GS F0VM92_NEOCL/10-175         AC F0VM92.1
#=GS A0A0G2EGI9_9EURO/21-186     AC A0A0G2EGI9.1
#=GS A0A0G4GZA6_VITBC/10-175     AC A0A0G4GZA6.1
#=GS A0A0K0ER33_STRER/30-211     AC A0A0K0ER33.1
#=GS F0XXJ0_AURAN/10-174         AC F0XXJ0.1
#=GS A0A158P6F2_ANGCA/490-653    AC A0A158P6F2.1
#=GS A0A0G2HNQ7_9EURO/21-214     AC A0A0G2HNQ7.1
#=GS K7H0X5_CAEJA/52-236         AC K7H0X5.1
#=GS A0A0L0SKP2_ALLMA/464-623    AC A0A0L0SKP2.1
#=GS U6MKH2_9EIME/136-300        AC U6MKH2.1
#=GS A0A178EG83_9PLEO/23-209     AC A0A178EG83.1
#=GS A0A024VIV8_PLAFA/160-331    AC A0A024VIV8.1
#=GS A0A084QD51_9HYPO/25-192     AC A0A084QD51.1
#=GS W9WA46_9EURO/19-185         AC W9WA46.1
#=GS A0A0E0A4V4_9ORYZ/4-150      AC A0A0E0A4V4.1
#=GS A0A0A1TWQ7_ENTIV/2-162      AC A0A0A1TWQ7.1
#=GS A0A0R3T8F5_HYMNN/10-175     AC A0A0R3T8F5.1
#=GS C5DR46_ZYGRC/14-208         AC C5DR46.1
#=GS A0A0L1JFH0_ASPNO/21-209     AC A0A0L1JFH0.1
#=GS PR38A_MOUSE/10-175          AC Q4FK66.1
#=GS A0A0N5BNF5_STREA/30-211     AC A0A0N5BNF5.1
#=GS M7TF93_EUTLA/22-189         AC M7TF93.1
#=GS M1VHD9_CYAM1/26-187         AC M1VHD9.1
#=GS A0A0K0FMJ1_9BILA/30-211     AC A0A0K0FMJ1.1
#=GS Q2U457_ASPOR/21-209         AC Q2U457.1
#=GS B7P4Y8_IXOSC/14-198         AC B7P4Y8.1
#=GS A0A086TDT6_ACRC1/24-191     AC A0A086TDT6.1
#=GS A0A0C9ZG06_9HOMO/97-159     AC A0A0C9ZG06.1
#=GS C5L5B5_PERM5/95-139         AC C5L5B5.1
#=GS A0A0A0LFY3_CUCSA/10-175     AC A0A0A0LFY3.1
#=GS B6TYH0_MAIZE/10-175         AC B6TYH0.1
#=GS F0ZBH7_DICPU/5-166          AC F0ZBH7.1
#=GS A0A109FHW1_9BASI/10-174     AC A0A109FHW1.1
#=GS A0A091K1J7_COLST/1-141      AC A0A091K1J7.1
#=GS A0A087TQR2_9ARAC/10-175     AC A0A087TQR2.1
#=GS G5AX24_HETGA/10-161         AC G5AX24.1
#=GS A0A077Z5Z3_TRITR/438-620    AC A0A077Z5Z3.1
#=GS A0A183AT90_9TREM/32-216     AC A0A183AT90.1
#=GS A0A068XCD3_HYMMI/10-175     AC A0A068XCD3.1
#=GS E1GF58_LOALO/10-175         AC E1GF58.2
#=GS Q6BW00_DEBHA/13-188         AC Q6BW00.1
#=GS E9GW90_DAPPU/10-175         AC E9GW90.1
#=GS A0A183PCN6_9TREM/26-73      AC A0A183PCN6.1
#=GS A0A061GG73_THECC/10-175     AC A0A061GG73.1
#=GS M2XT21_GALSU/10-174         AC M2XT21.1
#=GS A7TN57_VANPO/14-211         AC A7TN57.1
#=GS A0A0M0KXG3_9EUKA/15-172     AC A0A0M0KXG3.1
#=GS A7SXQ7_NEMVE/10-175         AC A7SXQ7.1
#=GS B7S4A9_PHATC/10-166         AC B7S4A9.1
#=GS A0A0E0L7N7_ORYPU/101-262    AC A0A0E0L7N7.1
#=GS E3N791_CAERE/10-175         AC E3N791.1
#=GS E7KCV7_YEASA/15-219         AC E7KCV7.1
#=GS D8R3L1_SELML/5-169          AC D8R3L1.1
#=GS A0A0V0TZN6_9BILA/2-84       AC A0A0V0TZN6.1
#=GS J3MB67_ORYBR/4-166          AC J3MB67.1
#=GS S9WUU7_9TRYP/1-95           AC S9WUU7.1
#=GS A0A094KRX5_9AVES/1-80       AC A0A094KRX5.1
#=GS A0A0M9EYH7_9HYPO/26-192     AC A0A0M9EYH7.1
#=GS A0A0C2D4S6_9BILA/1-32       AC A0A0C2D4S6.1
#=GS E7LUN2_YEASV/15-219         AC E7LUN2.1
#=GS A0A067QAN7_9HOMO/10-173     AC A0A067QAN7.1
#=GS A0A0A0AG99_CHAVO/10-175     AC A0A0A0AG99.1
#=GS B0WBK3_CULQU/28-154         AC B0WBK3.1
#=GS A0A1B6P710_SORBI/1-113      AC A0A1B6P710.1
#=GS A0A0N4XCA9_NIPBR/461-626    AC A0A0N4XCA9.1
#=GS A0A183VNI8_TRIRE/27-120     AC A0A183VNI8.1
#=GS T1KXQ5_TETUR/69-253         AC T1KXQ5.2
#=GS E5S6X1_TRISP/427-610        AC E5S6X1.1
#=GS U6LKK7_9EIME/85-141         AC U6LKK7.1
#=GS A0A0D1ZK06_9EURO/19-185     AC A0A0D1ZK06.1
#=GS A0A0G4L1S5_9PEZI/26-193     AC A0A0G4L1S5.1
#=GS A9RSQ4_PHYPA/6-170          AC A9RSQ4.1
#=GS A0A0A1USL5_9HYPO/24-191     AC A0A0A1USL5.1
#=GS U7PR73_SPOS1/26-192         AC U7PR73.1
#=GS Q4WUN3_ASPFU/34-222         AC Q4WUN3.1
#=GS F1S580_PIG/50-234           AC F1S580.1
#=GS A0A0R3WNB8_HYDTA/27-211     AC A0A0R3WNB8.1
#=GS A0A091G328_9AVES/1-80       AC A0A091G328.1
#=GS V7BIY7_PHAVU/10-175         AC V7BIY7.1
#=GS F6ZP02_CIOIN/10-175         AC F6ZP02.2
#=GS Q0CIC3_ASPTN/21-209         AC Q0CIC3.1
#=GS A0A0C2IZB7_THEKT/10-175     AC A0A0C2IZB7.1
#=GS A0A183LYE7_9TREM/70-113     AC A0A183LYE7.1
#=GS K3ZVF4_SETIT/1-99           AC K3ZVF4.1
#=GS A0A0A2JPC8_PENEN/21-204     AC A0A0A2JPC8.1
#=GS G6DFN0_DANPL/10-175         AC G6DFN0.1
#=GS A0A0D2US18_GOSRA/10-175     AC A0A0D2US18.1
#=GS B3LAT7_PLAKH/162-322        AC B3LAT7.1
#=GS A0A0F4ZI01_9PEZI/24-191     AC A0A0F4ZI01.1
#=GS U3JJ31_FICAL/50-200         AC U3JJ31.1
#=GS U3IDW8_ANAPL/1-111          AC U3IDW8.1
#=GS H9JWH7_BOMMO/10-175         AC H9JWH7.1
#=GS A0A0L1L023_9EUGL/103-269    AC A0A0L1L023.1
#=GS M0Z3R6_HORVD/3-165          AC M0Z3R6.1
#=GS A0A0N8DCH8_9CRUS/32-216     AC A0A0N8DCH8.1
#=GS Q4YX53_PLABA/179-341        AC Q4YX53.1
#=GS A0A0E0L7N6_ORYPU/101-262    AC A0A0E0L7N6.1
#=GS A0A078JHH0_BRANA/4-168      AC A0A078JHH0.1
#=GS A0A0R3SBV3_HYMDI/41-225     AC A0A0R3SBV3.1
#=GS E6ZP67_SPORE/10-174         AC E6ZP67.1
#=GS B8NUH3_ASPFN/21-209         AC B8NUH3.1
#=GS A0A078F0Q5_BRANA/10-175     AC A0A078F0Q5.1
#=GS A0A067K8T2_JATCU/1-123      AC A0A067K8T2.1
#=GS D6WU66_TRICA/10-175         AC D6WU66.1
#=GS A0A059J1T7_9EURO/21-222     AC A0A059J1T7.1
#=GS Q7RLR8_PLAYO/1-56           AC Q7RLR8.1
#=GS X2JF51_DROME/24-141         AC X2JF51.1
#=GS A0A096Q427_MAIZE/1-86       AC A0A096Q427.1
#=GS A0A078GCR5_BRANA/10-175     AC A0A078GCR5.1
#=GS Q86IV3_DICDI/48-212         AC Q86IV3.1
#=GS A0A0D2E8Z4_9EURO/19-185     AC A0A0D2E8Z4.1
#=GS J9JZ53_ACYPI/30-214         AC J9JZ53.2
#=GS U4L199_PYROM/27-190         AC U4L199.1
#=GS A0A0N4X4R7_HAEPC/1-161      AC A0A0N4X4R7.1
#=GS W2R409_PHYPN/9-173          AC W2R409.1
#=GS A0A180H0H8_PUCT1/10-148     AC A0A180H0H8.1
#=GS K1Q5L4_CRAGI/7-191          AC K1Q5L4.1
#=GS A0A135UGP3_9PEZI/24-191     AC A0A135UGP3.1
#=GS A0A0V1NSJ9_9BILA/62-227     AC A0A0V1NSJ9.1
#=GS A0A078CCT6_BRANA/4-168      AC A0A078CCT6.1
#=GS M1C6B4_SOLTU/5-167          AC M1C6B4.1
#=GS X6NM44_RETFI/10-176         AC X6NM44.1
#=GS A0A015NFA3_9GLOM/10-174     AC A0A015NFA3.1
#=GS B8C555_THAPS/10-167         AC B8C555.1
#=GS F6V7L2_ORNAN/39-223         AC F6V7L2.1
#=GS F2UNQ1_SALR5/10-175         AC F2UNQ1.1
#=GS A0A023BDW0_GRENI/56-217     AC A0A023BDW0.1
#=GS A0A0D3GCQ3_9ORYZ/4-150      AC A0A0D3GCQ3.1
#=GS H2ARW2_KAZAF/14-209         AC H2ARW2.1
#=GS C4WV68_ACYPI/10-175         AC C4WV68.1
#=GS A0A091GZB5_BUCRH/28-187     AC A0A091GZB5.1
#=GS G4N721_MAGO7/23-190         AC G4N721.1
#=GS G5BQU6_HETGA/49-233         AC G5BQU6.1
#=GS A0A091DHP7_FUKDA/10-70      AC A0A091DHP7.1
#=GS A0A093QD96_9PASS/10-175     AC A0A093QD96.1
#=GS G3JII3_CORMM/24-191         AC G3JII3.1
#=GS H0XNF3_OTOGA/49-233         AC H0XNF3.1
#=GS A0A0G2JEW4_MOUSE/48-138     AC A0A0G2JEW4.1
#=GS B4L223_DROMO/28-212         AC B4L223.1
#=GS A0A183PCN6_9TREM/70-160     AC A0A183PCN6.1
#=GS Q29IQ7_DROPS/30-214         AC Q29IQ7.2
#=GS G7E6U1_MIXOS/10-174         AC G7E6U1.1
#=GS B7FY05_PHATC/41-205         AC B7FY05.1
#=GS A0A0J6Y9X5_COCIT/21-209     AC A0A0J6Y9X5.1
#=GS F7ALV5_CALJA/25-209         AC F7ALV5.1
#=GS A0A0P1ARB7_9STRA/9-173      AC A0A0P1ARB7.1
#=GS A0A0K0JVC6_BRUMA/73-120     AC A0A0K0JVC6.1
#=GS M7YUL5_TRIUA/10-175         AC M7YUL5.1
#=GS W5AB44_WHEAT/3-166          AC W5AB44.1
#=GS A0A016WJT5_9BILA/10-175     AC A0A016WJT5.1
#=GS A8IDN7_CHLRE/1-167          AC A8IDN7.1
#=GS A0A0C9MEM5_9FUNG/10-170     AC A0A0C9MEM5.1
#=GS A0A016STJ3_9BILA/62-272     AC A0A016STJ3.1
#=GS A0A0L8GDY2_OCTBM/10-97      AC A0A0L8GDY2.1
#=GS A0A0C3NGM6_PHLGI/10-173     AC A0A0C3NGM6.1
#=GS M2Y140_GALSU/5-87           AC M2Y140.1
#=GS G3N166_BOVIN/47-231         AC G3N166.1
#=GS A0A0B2UEZ7_9MICR/2-161      AC A0A0B2UEZ7.1
#=GS W5DUT1_WHEAT/1-85           AC W5DUT1.1
#=GS A7APG3_BABBO/171-333        AC A7APG3.1
#=GS T1HNK6_RHOPR/10-175         AC T1HNK6.1
#=GS A0A183ERW8_9BILA/1-32       AC A0A183ERW8.1
#=GS A0A091QWJ4_9GRUI/1-141      AC A0A091QWJ4.1
#=GS Q7JVL3_DROME/10-175         AC Q7JVL3.1
#=GS B6HM45_PENRW/21-204         AC B6HM45.1
#=GS W7AWH2_PLAVN/10-175         AC W7AWH2.1
#=GS L5K4Z1_PTEAL/49-233         AC L5K4Z1.1
#=GS A0A154PJ62_9HYME/37-221     AC A0A154PJ62.1
#=GS K6UDH3_9APIC/43-122         AC K6UDH3.1
#=GS A0A0A0AJE5_CHAVO/33-217     AC A0A0A0AJE5.1
#=GS T1EG64_HELRO/7-191          AC T1EG64.1
#=GS A0A0A0KT86_CUCSA/8-91       AC A0A0A0KT86.1
#=GS E1C6A8_CHICK/10-175         AC E1C6A8.1
#=GS A0A0T6AZN8_9SCAR/31-176     AC A0A0T6AZN8.1
#=GS M1CAV6_SOLTU/10-175         AC M1CAV6.1
#=GS K7V8Q5_MAIZE/76-246         AC K7V8Q5.1
#=GS A0A0V1M1H2_9BILA/1-81       AC A0A0V1M1H2.1
#=GS A0A068SG10_9FUNG/10-173     AC A0A068SG10.1
#=GS W3XIF8_9PEZI/20-186         AC W3XIF8.1
#=GS A0A183H881_9BILA/74-258     AC A0A183H881.1
#=GS E2AHT2_CAMFO/35-218         AC E2AHT2.1
#=GS I3MQ15_ICTTR/10-175         AC I3MQ15.1
#=GS H2ZFB4_CIOSA/10-175         AC H2ZFB4.1
#=GS Q57XW0_TRYB2/205-343        AC Q57XW0.1
#=GS U9UJB9_RHIID/7-167          AC U9UJB9.1
#=GS W5MMD1_LEPOC/32-216         AC W5MMD1.1
#=GS A0A0A1NZQ0_9FUNG/11-122     AC A0A0A1NZQ0.1
#=GS A0A096RF19_MAIZE/1-55       AC A0A096RF19.1
#=GS A0A0D0DXK7_9HOMO/10-173     AC A0A0D0DXK7.1
#=GS K2N6A4_TRYCR/38-206         AC K2N6A4.1
#=GS A0A165HA15_9APHY/10-173     AC A0A165HA15.1
#=GS A0A151Z6Y5_9MYCE/4-168      AC A0A151Z6Y5.1
#=GS L1ICQ1_GUITH/10-169         AC L1ICQ1.1
#=GS C1H036_PARBA/21-214         AC C1H036.2
#=GS A0A0P7V7J0_9TELE/41-225     AC A0A0P7V7J0.1
#=GS C5K8A2_PERM5/121-216        AC C5K8A2.1
#=GS A0A0L1HPK7_9PLEO/23-231     AC A0A0L1HPK7.1
#=GS C4LZA0_ENTHI/2-162          AC C4LZA0.1
#=GS A2Q158_MEDTR/10-175         AC A2Q158.1
#=GS A0A165H573_9PEZI/21-184     AC A0A165H573.1
#=GS A0A177BXT3_9PLEO/18-214     AC A0A177BXT3.1
#=GS Q28XW5_DROPS/10-175         AC Q28XW5.2
#=GS F7G6K1_MONDO/12-177         AC F7G6K1.1
#=GS G3Y0M7_ASPNA/21-209         AC G3Y0M7.1
#=GS I1EAR9_AMPQE/1-144          AC I1EAR9.1
#=GS A8X8F6_CAEBR/10-175         AC A8X8F6.1
#=GS A0A132A7Z0_SARSC/10-175     AC A0A132A7Z0.1
#=GS A0A0V0XSG6_TRIPS/126-309    AC A0A0V0XSG6.1
#=GS A0A0M3JW10_ANISI/46-229     AC A0A0M3JW10.1
#=GS F6QPW1_MACMU/47-231         AC F6QPW1.1
#=GS J3M4G7_ORYBR/3-166          AC J3M4G7.1
#=GS U6PD84_HAECO/69-253         AC U6PD84.1
#=GS M1W229_CLAP2/24-191         AC M1W229.1
#=GS L1J4V0_GUITH/160-321        AC L1J4V0.1
#=GS W2QD97_PHYPN/37-201         AC W2QD97.1
#=GS A0A0A1N932_9FUNG/9-173      AC A0A0A1N932.1
#=GS C5X6Q2_SORBI/10-175         AC C5X6Q2.1
#=GS R9P9R0_PSEHS/10-175         AC R9P9R0.1
#=GS A0A088A0G8_APIME/10-175     AC A0A088A0G8.1
#=GS A0A0B0P1S4_GOSAR/10-175     AC A0A0B0P1S4.1
#=GS A0A0F8UXB5_9EURO/21-212     AC A0A0F8UXB5.1
#=GS E5RYR9_TRISP/10-175         AC E5RYR9.1
#=GS E1BVP9_CHICK/50-234         AC E1BVP9.2
#=GS A0A0J8QQH2_COCIT/21-209     AC A0A0J8QQH2.1
#=GS A0A0L7LKK1_9NEOP/87-152     AC A0A0L7LKK1.1
#=GS A0A093HAH5_STRCA/1-139      AC A0A093HAH5.1
#=GS W5AKT7_WHEAT/3-166          AC W5AKT7.1
#=GS K1WAK9_MARBU/21-188         AC K1WAK9.1
#=GS T1JGX1_STRMM/10-175         AC T1JGX1.1
#=GS W7X6X1_TETTS/10-175         AC W7X6X1.1
#=GS A0A183VNI8_TRIRE/118-184    AC A0A183VNI8.1
#=GS E9EM03_METRA/24-191         AC E9EM03.2
#=GS A0A0N4X5Z2_HAEPC/70-254     AC A0A0N4X5Z2.1
#=GS C5K487_PERM5/83-217         AC C5K487.1
#=GS G1SEF5_RABIT/10-175         AC G1SEF5.1
#=GS Q54J00_DICDI/3-165          AC Q54J00.2
#=GS A0A0D9WLP6_9ORYZ/3-166      AC A0A0D9WLP6.1
#=GS A0A0P1BIZ5_9BASI/10-175     AC A0A0P1BIZ5.1
#=GS X0J3G6_FUSOX/26-192         AC X0J3G6.1
#=GS A0A096RF20_MAIZE/2-80       AC A0A096RF20.1
#=GS I3JV42_ORENI/25-209         AC I3JV42.1
#=GS K3ZF04_SETIT/3-166          AC K3ZF04.1
#=GS W7AKF8_9APIC/252-414        AC W7AKF8.1
#=GS G1THN5_RABIT/1-139          AC G1THN5.2
#=GS B2ATX0_PODAN/63-230         AC B2ATX0.1
#=GS V8PH37_OPHHA/10-175         AC V8PH37.1
#=GS A0A0F9XUE7_TRIHA/26-193     AC A0A0F9XUE7.1
#=GS H2MLH7_ORYLA/25-209         AC H2MLH7.1
#=GS W5MME7_LEPOC/32-216         AC W5MME7.1
#=GS B4QGS9_DROSI/10-175         AC B4QGS9.1
#=GS V7BAP5_PHAVU/3-165          AC V7BAP5.1
#=GS Q7PMU1_ANOGA/45-223         AC Q7PMU1.4
#=GS A0A0S4KHF4_BODSA/9-161      AC A0A0S4KHF4.1
#=GS A0A094A3V8_9PEZI/1-139      AC A0A094A3V8.1
#=GS A0A093GN88_TYTAL/1-141      AC A0A093GN88.1
#=GS K6UDH3_9APIC/10-45          AC K6UDH3.1
#=GS B8P4M7_POSPM/8-160          AC B8P4M7.1
#=GS G8BDC4_CANPC/23-200         AC G8BDC4.1
#=GS B7F7E9_ORYSJ/3-166          AC B7F7E9.1
#=GS A0A0D2USY9_GOSRA/10-175     AC A0A0D2USY9.1
#=GS A0A194SAL1_RHOGW/10-174     AC A0A194SAL1.1
#=GS L7JXS8_TRAHO/4-152          AC L7JXS8.1
#=GS F9X714_ZYMTI/19-186         AC F9X714.1
#=GS A0A163AMV6_DIDRA/23-241     AC A0A163AMV6.1
#=GS N6U570_DENPD/23-207         AC N6U570.1
#=GS B4M6P8_DROVI/28-212         AC B4M6P8.1
#=GS A0A022R4J6_ERYGU/6-166      AC A0A022R4J6.1
#=GS V9DTB5_PHYPR/11-61          AC V9DTB5.1
#=GS Q7RLR7_PLAYO/177-256        AC Q7RLR7.1
#=GS B2WHZ6_PYRTR/23-234         AC B2WHZ6.1
#=GS C5LD14_PERM5/10-181         AC C5LD14.1
#=GS A0A167KJK7_PHYB8/9-165      AC A0A167KJK7.1
#=GS A0A091KAI8_9AVES/1-111      AC A0A091KAI8.1
#=GS A0A074Z976_9PEZI/19-183     AC A0A074Z976.1
#=GS B4HSN2_DROSE/10-175         AC B4HSN2.1
#=GS R1F3N7_EMIHU/15-180         AC R1F3N7.1
#=GS Q7SHZ0_NEUCR/24-191         AC Q7SHZ0.2
#=GS E7NHW7_YEASO/15-219         AC E7NHW7.1
#=GS G2R425_THITE/24-192         AC G2R425.1
#=GS E3KGQ2_PUCGT/10-176         AC E3KGQ2.1
#=GS A0A0B2S9W3_GLYSO/4-166      AC A0A0B2S9W3.1
#=GS A0A058ZG82_9EUKA/14-178     AC A0A058ZG82.1
#=GS A0A183QLW9_9TREM/26-210     AC A0A183QLW9.1
#=GS A0A0R3UJQ0_9CEST/26-210     AC A0A0R3UJQ0.1
#=GS A0A0E0AZ81_9ORYZ/10-175     AC A0A0E0AZ81.1
#=GS Q95Y35_CAEEL/55-239         AC Q95Y35.1
#=GS J9B997_WUCBA/47-231         AC J9B997.1
#=GS A0A074RWM6_9HOMO/10-173     AC A0A074RWM6.1
#=GS A0A183DZ28_9BILA/94-186     AC A0A183DZ28.1
#=GS A0A183FVP2_HELBK/10-175     AC A0A183FVP2.1
#=GS E9AIG4_LEIBR/4-153          AC E9AIG4.1
#=GS A0A0G2JGW4_MOUSE/48-93      AC A0A0G2JGW4.1
#=GS A0A074XVB6_AURPU/19-183     AC A0A074XVB6.1
#=GS A0A067DF16_CITSI/4-97       AC A0A067DF16.1
#=GS K7JAP2_NASVI/32-188         AC K7JAP2.1
#=GS PR38A_DANRE/10-175          AC Q6DHU4.1
#=GS A5K1F2_PLAVS/159-321        AC A5K1F2.1
#=GS A0A0C3D9I8_9PEZI/1-157      AC A0A0C3D9I8.1
#=GS K7H0X6_CAEJA/52-236         AC K7H0X6.1
#=GS A0A0R3SDC1_HYMDI/10-175     AC A0A0R3SDC1.1
#=GS S6EYV6_ZYGB2/14-210         AC S6EYV6.1
#=GS M2MPP1_BAUCO/19-184         AC M2MPP1.1
#=GS K1W8G5_TRIAC/59-194         AC K1W8G5.1
#=GS A0A132AFB3_SARSC/21-116     AC A0A132AFB3.1
#=GS A0A183EQT3_9BILA/51-133     AC A0A183EQT3.1
#=GS W6Q0P6_PENRF/21-204         AC W6Q0P6.1
#=GS G3I797_CRIGR/6-94           AC G3I797.1
#=GS A0A0D2CFM8_9EURO/19-185     AC A0A0D2CFM8.1
#=GS A0A0D9WDE8_9ORYZ/3-166      AC A0A0D9WDE8.1
#=GS A0A0L0GFE0_9EUKA/10-175     AC A0A0L0GFE0.1
#=GS Q756P8_ASHGO/14-224         AC Q756P8.1
#=GS A0A0N0DUZ1_9TRYP/258-435    AC A0A0N0DUZ1.1
#=GS C5Z3V3_SORBI/3-166          AC C5Z3V3.1
#=GS R8BK18_TOGMI/23-190         AC R8BK18.1
#=GS M7NMD2_PNEMU/15-179         AC M7NMD2.1
#=GS A0A0L0N1A5_9HYPO/24-191     AC A0A0L0N1A5.1
#=GS W6MI80_9ASCO/16-181         AC W6MI80.1
#=GS G2XP06_BOTF4/21-188         AC G2XP06.1
#=GS Q4Z0V3_PLABA/10-175         AC Q4Z0V3.1
#=GS A0A0V1NSK1_9BILA/62-227     AC A0A0V1NSK1.1
#=GS B6K0B4_SCHJY/16-179         AC B6K0B4.1
#=GS G8ZTX6_TORDC/14-208         AC G8ZTX6.1
#=GS A9V7J1_MONBE/525-692        AC A9V7J1.1
#=GS A0A0V1L1W8_9BILA/35-218     AC A0A0V1L1W8.1
#=GS A0A058Z0D6_9EUKA/4-170      AC A0A058Z0D6.1
#=GS A4HYV7_LEIIN/4-146          AC A4HYV7.1
#=GS H3H0K3_PHYRM/37-201         AC H3H0K3.1
#=GS A0A0N4YCI5_NIPBR/1-176      AC A0A0N4YCI5.1
#=GS A0A091Q0Z9_LEPDC/17-201     AC A0A091Q0Z9.1
#=GS K3WW49_PYTUL/39-203         AC K3WW49.1
#=GS I2FP71_USTH4/10-174         AC I2FP71.1
#=GS A0A180GN67_PUCT1/10-176     AC A0A180GN67.1
#=GS Q6FNB5_CANGA/14-216         AC Q6FNB5.1
#=GS G1KHK2_ANOCA/10-175         AC G1KHK2.2
#=GS A0A0L0CXQ8_PLAFA/2-136      AC A0A0L0CXQ8.1
#=GS A0A0R3TRU6_HYMNN/27-211     AC A0A0R3TRU6.1
#=GS T5ACD4_OPHSC/26-193         AC T5ACD4.1
#=GS K3XXF9_SETIT/3-166          AC K3XXF9.1
#=GS A0A183TIV1_SCHSO/28-212     AC A0A183TIV1.1
#=GS F4PA36_BATDJ/1-156          AC F4PA36.1
#=GS A0A0D3H3F9_9ORYZ/10-175     AC A0A0D3H3F9.1
#=GS A0A0V0ZZH3_9BILA/35-219     AC A0A0V0ZZH3.1
#=GS D2VCT3_NAEGR/48-213         AC D2VCT3.1
#=GS A0A096UWA6_WHEAT/3-165      AC A0A096UWA6.1
#=GS V5G3J8_BYSSN/21-207         AC V5G3J8.1
#=GS A0A0L0P213_9ASCO/2-178      AC A0A0L0P213.1
#=GS H0ZFB3_TAEGU/10-175         AC H0ZFB3.1
#=GS H2KVI1_CLOSI/10-175         AC H2KVI1.1
#=GS I1CST4_RHIO9/3-153          AC I1CST4.1
#=GS M2RIP2_CERS8/10-173         AC M2RIP2.1
#=GS A0A0N5CXD3_THECL/10-175     AC A0A0N5CXD3.1
#=GS I1MBS7_SOYBN/4-166          AC I1MBS7.1
#=GS A0A0J8C706_BETVU/4-167      AC A0A0J8C706.1
#=GS A0A024VKM8_PLAFA/173-301    AC A0A024VKM8.1
#=GS I1QLT6_ORYGL/10-175         AC I1QLT6.1
#=GS A0A0A1T126_9HYPO/24-191     AC A0A0A1T126.1
#=GS B6AGF3_CRYMR/3-168          AC B6AGF3.1
#=GS I1F011_AMPQE/7-103          AC I1F011.1
#=GS A0A061DC29_BABBI/10-175     AC A0A061DC29.1
#=GS Q4Q9W3_LEIMA/270-441        AC Q4Q9W3.1
#=GS W9QIC3_9ROSA/10-174         AC W9QIC3.1
#=GS E9IFJ0_SOLIN/10-175         AC E9IFJ0.1
#=GS A0A0V0VGZ7_9BILA/62-227     AC A0A0V0VGZ7.1
#=GS I1PSX7_ORYGL/3-166          AC I1PSX7.1
#=GS A0A091LHI4_CATAU/12-196     AC A0A091LHI4.1
#=GS B3S4R2_TRIAD/10-175         AC B3S4R2.1
#=GS A0A139AJN0_GONPR/10-175     AC A0A139AJN0.1
#=GS G7XH18_ASPKW/21-207         AC G7XH18.1
#=GS A0A0V1HJ47_9BILA/542-725    AC A0A0V1HJ47.1
#=GS A0A0N4UBE6_DRAME/47-98      AC A0A0N4UBE6.1
#=GS A0A158PEY3_ANGCS/493-658    AC A0A158PEY3.1
#=GS M7XZP0_RHOT1/10-174         AC M7XZP0.1
#=GS Q4QCT1_LEIMA/4-144          AC Q4QCT1.1
#=GS A0A0G4IQ99_PLABS/427-592    AC A0A0G4IQ99.1
#=GS F6SUR6_MONDO/10-175         AC F6SUR6.2
#=GS A0A0N0U780_9HYME/37-71      AC A0A0N0U780.1
#=GS E1ZPB8_CHLVA/2-179          AC E1ZPB8.1
#=GS A0A0H5S2F2_BRUMA/10-175     AC A0A0H5S2F2.1
#=GS W2S0L2_9EURO/19-185         AC W2S0L2.1
#=GS J3MVI2_ORYBR/10-175         AC J3MVI2.1
#=GS A0A0L1KXD1_9EUGL/17-211     AC A0A0L1KXD1.1
#=GS A0A0B2Q8E4_GLYSO/10-175     AC A0A0B2Q8E4.1
#=GS F0XVG8_AURAN/1-161          AC F0XVG8.1
#=GS A0A0A2VHG9_BEABA/24-191     AC A0A0A2VHG9.1
#=GS A0A074XMF4_9PEZI/19-183     AC A0A074XMF4.1
#=GS A4HE72_LEIBR/304-441        AC A4HE72.1
#=GS H2KT99_CLOSI/29-213         AC H2KT99.1
#=GS PR38A_HUMAN/10-175          AC Q8NAV1.1
#=GS PR38A_HUMAN/10-175          DR PDB; 4RZ9 A; 10-175;
#=GS PR38A_HUMAN/10-175          DR PDB; 4RZA A; 10-175;
#=GS PR38A_HUMAN/10-175          DR PDB; 5F5S A; 10-175;
#=GS A0A0H1BL65_9EURO/21-214     AC A0A0H1BL65.1
#=GS A0A0C2ZA08_9HOMO/10-173     AC A0A0C2ZA08.1
#=GS A4RRH8_OSTLU/10-175         AC A4RRH8.1
#=GS A0A0D2WQ43_CAPO3/10-175     AC A0A0D2WQ43.1
#=GS A0A178AI16_9PLEO/25-232     AC A0A178AI16.1
#=GS A0A0J7LB91_LASNI/37-224     AC A0A0J7LB91.1
#=GS A0A087R9K3_APTFO/25-209     AC A0A087R9K3.1
#=GS H2R123_PANTR/10-175         AC H2R123.1
#=GS G3VUT2_SARHA/10-175         AC G3VUT2.1
#=GS A0A0V1CKQ0_TRIBR/10-175     AC A0A0V1CKQ0.1
#=GS A0A0V1HJH3_9BILA/45-228     AC A0A0V1HJH3.1
#=GS A3GFM9_PICST/15-192         AC A3GFM9.2
#=GS A0A078A0F3_STYLE/218-371    AC A0A078A0F3.1
#=GS A0A0E0QYC5_ORYRU/23-76      AC A0A0E0QYC5.1
#=GS PR38B_RAT/47-231            AC Q6AXY7.1
#=GS G3TY10_LOXAF/47-231         AC G3TY10.1
#=GS L9KRQ0_TUPCH/10-175         AC L9KRQ0.1
#=GS B4NCI0_DROWI/29-213         AC B4NCI0.2
#=GS Q4GZ20_TRYB2/36-209         AC Q4GZ20.1
#=GS D7MIA4_ARALL/4-168          AC D7MIA4.1
#=GS U3IFV6_ANAPL/4-188          AC U3IFV6.1
#=GS A0A0D9S7A0_CHLSB/1-34       AC A0A0D9S7A0.1
#=GS G5B2Y6_HETGA/1-99           AC G5B2Y6.1
#=GS A0A0D0BBL9_9HOMO/10-173     AC A0A0D0BBL9.1
#=GS U5FR78_POPTR/10-175         AC U5FR78.1
#=GS A0A067TR38_9AGAR/10-173     AC A0A067TR38.1
#=GS A0A094GDZ7_9PEZI/22-189     AC A0A094GDZ7.1
#=GS A0A166AGB7_EXIGL/10-173     AC A0A166AGB7.1
#=GS H0WS15_OTOGA/10-175         AC H0WS15.1
#=GS Q8II38_PLAF7/11-175         AC Q8II38.1
#=GS E3RUL4_PYRTT/23-233         AC E3RUL4.1
#=GS V9FB38_PHYPR/37-201         AC V9FB38.1
#=GS A0A093L358_FULGA/1-111      AC A0A093L358.1
#=GS A0A067D0W8_SAPPC/50-213     AC A0A067D0W8.1
#=GS A0A183AZC0_9TREM/10-175     AC A0A183AZC0.1
#=GS B4NNL6_DROWI/10-175         AC B4NNL6.1
#=GS A0A059ADM4_EUCGR/1-112      AC A0A059ADM4.1
#=GS Q6CS55_KLULA/14-213         AC Q6CS55.1
#=GS E6NU38_JATCU/10-175         AC E6NU38.1
#=GS A0A0W4ZL05_PNEJI/15-179     AC A0A0W4ZL05.1
#=GS A0A0V1MZ07_9BILA/438-621    AC A0A0V1MZ07.1
#=GS A0A0R3W7J4_TAEAS/27-211     AC A0A0R3W7J4.1
#=GS A0A158NBQ6_ATTCE/10-175     AC A0A158NBQ6.1
#=GS G8YR38_PICSO/12-187         AC G8YR38.1
#=GS A0A0V0R7M2_PSEPJ/10-175     AC A0A0V0R7M2.1
#=GS I3ND88_ICTTR/50-234         AC I3ND88.1
#=GS G1Q147_MYOLU/28-211         AC G1Q147.1
#=GS A0A168IF30_CORDF/24-191     AC A0A168IF30.1
#=GS A0A087RHR9_APTFO/10-175     AC A0A087RHR9.1
#=GS A0A091MUQ9_9PASS/1-141      AC A0A091MUQ9.1
#=GS Q7PX02_ANOGA/10-175         AC Q7PX02.4
#=GS W7TLT3_9STRA/33-198         AC W7TLT3.1
#=GS W4IUL8_PLAFP/173-301        AC W4IUL8.1
#=GS W6XT96_COCCA/23-228         AC W6XT96.1
#=GS A0A0D2IT05_9EURO/19-185     AC A0A0D2IT05.1
#=GS A0A087VRT3_BALRE/10-175     AC A0A087VRT3.1
#=GS F2TX53_SALR5/105-247        AC F2TX53.1
#=GS A0A063BZU8_9HYPO/25-192     AC A0A063BZU8.1
#=GS A0A066XD06_COLSU/24-191     AC A0A066XD06.1
#=GS PR38B_HUMAN/47-231          AC Q5VTL8.1
#=GS F7HY13_CALJA/10-175         AC F7HY13.1
#=GS A0A0D2GU34_9EURO/20-185     AC A0A0D2GU34.1
#=GS A0A0B7MVN4_9FUNG/11-178     AC A0A0B7MVN4.1
#=GS C1GJF7_PARBD/21-214         AC C1GJF7.1
#=GS A0A0G4PH36_PENCA/21-204     AC A0A0G4PH36.1
#=GS A0A151M4G2_ALLMI/10-175     AC A0A151M4G2.1
#=GS W7JYK7_PLAFO/173-335        AC W7JYK7.1
#=GS G3QMW7_GORGO/10-175         AC G3QMW7.1
#=GS Q9FHS8_ARATH/4-159          AC Q9FHS8.1
#=GS A0A0F4GLW9_9PEZI/19-186     AC A0A0F4GLW9.1
#=GS N4VSA6_COLOR/24-191         AC N4VSA6.1
#=GS A0A0E0A4V7_9ORYZ/4-166      AC A0A0E0A4V7.1
#=GS I1RQR3_GIBZE/26-192         AC I1RQR3.1
#=GS J3K8Q1_COCIM/21-209         AC J3K8Q1.2
#=GS J6E9Q7_SACK1/15-219         AC J6E9Q7.1
#=GS A0A0V0TYL1_9BILA/1-71       AC A0A0V0TYL1.1
#=GS R1EHA8_BOTPV/20-176         AC R1EHA8.1
#=GS G0VC19_NAUCC/15-211         AC G0VC19.1
#=GS A0A024W143_PLAFA/173-335    AC A0A024W143.1
#=GS A0A0N1IAW4_PAPMA/22-206     AC A0A0N1IAW4.1
#=GS V4ZI95_TOXGV/10-175         AC V4ZI95.1
#=GS A0A175YMA7_DAUCA/6-165      AC A0A175YMA7.1
#=GS PR38B_DANRE/25-209          AC Q6P7Y3.1
#=GS A0A085NTX6_9BILA/422-604    AC A0A085NTX6.1
#=GS H2ZEL3_CIOSA/29-213         AC H2ZEL3.1
#=GS U6L8R2_EIMTE/10-173         AC U6L8R2.1
#=GS A0A0F8C5Y3_LARCR/1-124      AC A0A0F8C5Y3.1
#=GS A0A167R152_9BASI/10-173     AC A0A167R152.1
#=GS M7YZV4_TRIUA/3-103          AC M7YZV4.1
#=GS B8B2Q7_ORYSI/4-173          AC B8B2Q7.1
#=GS B3MXQ1_DROAN/35-219         AC B3MXQ1.1
#=GS A0A0C2FSM3_9BILA/5-81       AC A0A0C2FSM3.1
#=GS A0A0J7L2G9_LASNI/10-175     AC A0A0J7L2G9.1
#=GS A0A0D1CL78_USTMA/10-174     AC A0A0D1CL78.1
#=GS W4KIC8_9HOMO/10-173         AC W4KIC8.1
#=GS A7F153_SCLS1/21-188         AC A7F153.1
#=GS A0A0D2MW08_9CHLO/10-175     AC A0A0D2MW08.1
#=GS L8X0R2_THACA/10-163         AC L8X0R2.1
#=GS A0A151U559_CAJCA/10-175     AC A0A151U559.1
#=GS A0A194PRK7_PAPXU/22-206     AC A0A194PRK7.1
#=GS A0A067P368_PLEOS/10-173     AC A0A067P368.1
#=GS K3W962_PYTUL/10-174         AC K3W962.1
#=GS A0A087SCL4_AUXPR/45-210     AC A0A087SCL4.1
#=GS B7QBZ1_IXOSC/10-175         AC B7QBZ1.1
#=GS M3Y690_MUSPF/10-175         AC M3Y690.1
#=GS A0A0W8E100_PHYNI/40-203     AC A0A0W8E100.1
#=GS A2G7A6_TRIVA/40-204         AC A2G7A6.1
#=GS K4B140_SOLLC/10-175         AC K4B140.1
#=GS A0A0V0Z8G5_9BILA/10-175     AC A0A0V0Z8G5.1
#=GS A0A165Y4A4_9HOMO/10-173     AC A0A165Y4A4.1
#=GS E9QD55_DANRE/25-170         AC E9QD55.1
#=GS A0A026WAG5_CERBI/37-224     AC A0A026WAG5.1
#=GS A0A0K9RIM5_SPIOL/10-174     AC A0A0K9RIM5.1
#=GS A0A061J015_TRYRA/27-195     AC A0A061J015.1
#=GS A0A091R870_MERNU/1-109      AC A0A091R870.1
#=GS A0A0V0UWK2_9BILA/578-761    AC A0A0V0UWK2.1
#=GS A0A183HLN6_9BILA/1-124      AC A0A183HLN6.1
#=GS A0A176VPQ7_MARPO/10-175     AC A0A176VPQ7.1
#=GS A0A165D0E2_9BASI/10-173     AC A0A165D0E2.1
#=GS M8A466_TRIUA/3-166          AC M8A466.1
#=GS A0A061GA69_THECC/5-76       AC A0A061GA69.1
#=GS A0A0D9ZUW6_9ORYZ/3-166      AC A0A0D9ZUW6.1
#=GS A0A0E9NPH2_9ASCO/27-194     AC A0A0E9NPH2.1
#=GS A0A0E0PTE3_ORYRU/4-158      AC A0A0E0PTE3.1
#=GS A0A081CIH8_PSEA2/10-174     AC A0A081CIH8.1
#=GS A0A016STM2_9BILA/62-272     AC A0A016STM2.1
#=GS A0A0V0S2D9_9BILA/10-175     AC A0A0V0S2D9.1
#=GS A0A0B2V767_TOXCA/180-345    AC A0A0B2V767.1
#=GS S9XEH7_SCHCR/14-177         AC S9XEH7.1
#=GS W4ZVL3_WHEAT/3-166          AC W4ZVL3.1
#=GS E9IDC1_SOLIN/82-265         AC E9IDC1.1
#=GS A0A0N0P7I3_LEPSE/4-150      AC A0A0N0P7I3.1
#=GS A0A0V1CJ22_TRIBR/10-175     AC A0A0V1CJ22.1
#=GS A0A010R8A1_9PEZI/24-191     AC A0A010R8A1.1
#=GS A0A0N0DS04_9TRYP/4-156      AC A0A0N0DS04.1
#=GS A0A166SWN1_9HOMO/10-173     AC A0A166SWN1.1
#=GS A0A067MDA3_9HOMO/10-173     AC A0A067MDA3.1
#=GS C9S9P5_VERA1/26-193         AC C9S9P5.1
#=GS W9YWJ5_9EURO/19-185         AC W9YWJ5.1
#=GS A0A0C3JVJ5_PISTI/10-173     AC A0A0C3JVJ5.1
#=GS B6QEC1_TALMQ/21-208         AC B6QEC1.1
#=GS F4PZZ0_DICFS/118-283        AC F4PZZ0.1
#=GS A0A0N0PD08_PAPMA/10-175     AC A0A0N0PD08.1
#=GS H3FY63_PRIPA/61-245         AC H3FY63.1
#=GS A0A0M9VVN1_9HYPO/25-192     AC A0A0M9VVN1.1
#=GS A0A165Q648_9APHY/10-173     AC A0A165Q648.1
#=GS D8SIA1_SELML/5-138          AC D8SIA1.1
#=GS Q8SUF7_ENCCU/2-164          AC Q8SUF7.1
#=GS I1HL97_BRADI/3-166          AC I1HL97.1
#=GS S9YKY6_CAMFR/13-80          AC S9YKY6.1
#=GS G3WWZ2_SARHA/30-174         AC G3WWZ2.1
#=GS A0A0C9M8H9_9FUNG/20-185     AC A0A0C9M8H9.1
#=GS M3XUF9_MUSPF/49-233         AC M3XUF9.1
#=GS R4X9K4_TAPDE/21-184         AC R4X9K4.1
#=GS E2BCA0_HARSA/10-175         AC E2BCA0.1
#=GS E4XHG4_OIKDI/82-282         AC E4XHG4.1
#=GS H3B6U1_LATCH/36-219         AC H3B6U1.1
#=GS A0A016ST41_9BILA/62-272     AC A0A016ST41.1
#=GS A0A0D8Y6S7_DICVI/41-225     AC A0A0D8Y6S7.1
#=GS A0A0D2F1Q1_9EURO/19-185     AC A0A0D2F1Q1.1
#=GS A0A0L7LKK1_9NEOP/22-89      AC A0A0L7LKK1.1
#=GS G4U7T3_NEUT9/24-191         AC G4U7T3.1
#=GS PRP38_YEAST/15-219          AC Q00723.1
#=GS I1F795_AMPQE/2-83           AC I1F795.1
#=GS A0A096MBN3_POEFO/10-175     AC A0A096MBN3.1
#=GS W6KQG9_9TRYP/3-189          AC W6KQG9.1
#=GS M0U4G2_MUSAM/3-166          AC M0U4G2.1
#=GS A0A0G4IHW0_PLABS/154-314    AC A0A0G4IHW0.1
#=GS A0A0N5CN93_THECL/1-176      AC A0A0N5CN93.1
#=GS A0A0V0XEX3_TRIPS/10-175     AC A0A0V0XEX3.1
#=GS A0A026WC55_CERBI/10-175     AC A0A026WC55.1
#=GS A0A0E0PTE4_ORYRU/4-157      AC A0A0E0PTE4.1
#=GS A0A074SWX5_HAMHA/10-175     AC A0A074SWX5.1
#=GS A0A078JU74_BRANA/10-175     AC A0A078JU74.1
#=GS K7HSD9_CAEJA/1-166          AC K7HSD9.1
#=GS R9ACJ1_WALI9/10-173         AC R9ACJ1.1
#=GS G1XLI7_ARTOA/22-185         AC G1XLI7.1
#=GS C8VB07_EMENI/21-212         AC C8VB07.1
#=GS B8BCS7_ORYSI/10-175         AC B8BCS7.1
#=GS A0A091UVU1_NIPNI/10-175     AC A0A091UVU1.1
#=GS A0A068RMB9_9FUNG/9-173      AC A0A068RMB9.1
#=GS F4K754_ARATH/4-105          AC F4K754.1
#=GS F7H0L0_MACMU/47-189         AC F7H0L0.1
#=GS A0A0D9S6K8_CHLSB/47-231     AC A0A0D9S6K8.1
#=GS A0A095ADL6_SCHHA/19-203     AC A0A095ADL6.1
#=GS F2SN07_TRIRC/21-222         AC F2SN07.1
#=GS G5C765_HETGA/10-78          AC G5C765.1
#=GS W5EZF1_WHEAT/1-99           AC W5EZF1.1
#=GS A0A135LL62_PENPA/21-204     AC A0A135LL62.1
#=GS A0A0L7L5T5_9NEOP/10-175     AC A0A0L7L5T5.1
#=GS A0A024WI92_PLAFA/173-335    AC A0A024WI92.1
#=GS A0A164QQA9_9HOMO/10-173     AC A0A164QQA9.1
#=GS F0VCL2_NEOCL/132-293        AC F0VCL2.1
#=GS A0A093I1A2_STRCA/1-115      AC A0A093I1A2.1
#=GS PR38B_MOUSE/48-232          AC Q80SY5.1
#=GS B9PT26_TOXGV/142-303        AC B9PT26.1
#=GS A0A0E0PTE5_ORYRU/4-166      AC A0A0E0PTE5.1
#=GS M0Z3R7_HORVD/3-165          AC M0Z3R7.1
#=GS J4W4G8_BEAB2/24-191         AC J4W4G8.1
#=GS D2V594_NAEGR/1-165          AC D2V594.1
#=GS H0V990_CAVPO/21-205         AC H0V990.1
#=GS M3VYN3_FELCA/10-175         AC M3VYN3.1
#=GS A0A0L9TZB1_PHAAN/10-175     AC A0A0L9TZB1.1
#=GS PR38A_XENTR/10-175          AC Q28H87.1
#=GS A0A139IKE7_9PEZI/19-186     AC A0A139IKE7.1
#=GS A0A024W6R0_PLAFA/11-175     AC A0A024W6R0.1
#=GS H0V4L8_CAVPO/10-175         AC H0V4L8.1
#=GS A0A015N4G5_9GLOM/7-171      AC A0A015N4G5.1
#=GS A0A0D9XBE9_9ORYZ/10-175     AC A0A0D9XBE9.1
#=GS A0A094KVV9_ANTCR/1-113      AC A0A094KVV9.1
#=GS A0A0C9MMM3_9FUNG/440-622    AC A0A0C9MMM3.1
#=GS W4ZSU7_WHEAT/50-203         AC W4ZSU7.1
#=GS H2ZEL4_CIOSA/4-188          AC H2ZEL4.1
#=GS A0A075A663_9TREM/10-175     AC A0A075A663.1
#=GS Q4UCH1_THEAN/10-175         AC Q4UCH1.1
#=GS M0X6G7_HORVD/3-166          AC M0X6G7.1
#=GS B4F7Y9_MAIZE/3-166          AC B4F7Y9.1
#=GS I3JLV3_ORENI/10-175         AC I3JLV3.1
#=GS G0PED8_CAEBE/1-148          AC G0PED8.1
#=GS V4AYJ2_LOTGI/4-188          AC V4AYJ2.1
#=GS U6MUF7_9EIME/120-282        AC U6MUF7.1
#=GS A0A0J8U8G6_COCIT/28-216     AC A0A0J8U8G6.1
#=GS A0A0F0ILI8_ASPPU/21-209     AC A0A0F0ILI8.1
#=GS A0A091SL58_9AVES/25-209     AC A0A091SL58.1
#=GS G1NUQ8_MYOLU/10-176         AC G1NUQ8.1
#=GS B4JL98_DROGR/29-213         AC B4JL98.1
#=GS S8D204_9LAMI/10-175         AC S8D204.1
#=GS A0A0B2V767_TOXCA/10-175     AC A0A0B2V767.1
#=GS K7GEC3_PELSI/50-234         AC K7GEC3.1
#=GS A0A0L0GAZ2_9EUKA/4-171      AC A0A0L0GAZ2.1
#=GS Q2H4I5_CHAGB/24-112         AC Q2H4I5.1
#=GS Q9VYE9_DROME/24-208         AC Q9VYE9.1
#=GS D8QIS6_SCHCM/10-173         AC D8QIS6.1
#=GS M7BDA2_CHEMY/30-111         AC M7BDA2.1
#=GS U6LVE5_9EIME/1-146          AC U6LVE5.1
#=GS A0A094HRM8_9PEZI/22-189     AC A0A094HRM8.1
#=GS N4U2P3_FUSC1/26-192         AC N4U2P3.1
#=GS Q4CZI2_TRYCC/9-176          AC Q4CZI2.1
#=GS R7SBP5_TREMS/8-160          AC R7SBP5.1
#=GS B4KQL3_DROMO/10-175         AC B4KQL3.2
#=GS G1PFY0_MYOLU/28-212         AC G1PFY0.1
#=GS G0QNU7_ICHMG/10-175         AC G0QNU7.1
#=GS A0A0B7MXN5_9FUNG/10-170     AC A0A0B7MXN5.1
#=GS A0A072NZS4_9EURO/19-185     AC A0A072NZS4.1
#=GS A0A090N2S3_OSTTA/10-175     AC A0A090N2S3.1
#=GS A0A0C2XB17_9HOMO/10-173     AC A0A0C2XB17.1
#=GS C5DED7_LACTC/14-227         AC C5DED7.1
#=GS M3XER9_FELCA/48-232         AC M3XER9.1
#=GS A0A091GE25_9AVES/48-232     AC A0A091GE25.1
#=GS A0A084W0J8_ANOSI/10-175     AC A0A084W0J8.1
#=GS G5AUI5_HETGA/10-175         AC G5AUI5.1
#=GS A0A0V0UWK7_9BILA/545-728    AC A0A0V0UWK7.1
#=GS A0A024GSS3_9STRA/10-174     AC A0A024GSS3.1
#=GS E9DBR1_COCPS/21-209         AC E9DBR1.1
#=GS A0A090M5Y6_OSTTA/20-189     AC A0A090M5Y6.1
#=GS F1Q7F0_DANRE/25-209         AC F1Q7F0.1
#=GS B4J994_DROGR/10-175         AC B4J994.1
#=GS S2JQG7_MUCC1/11-174         AC S2JQG7.1
#=GS A0A0V0RLN2_9BILA/598-781    AC A0A0V0RLN2.1
#=GS A0A0V0ZYC7_9BILA/427-610    AC A0A0V0ZYC7.1
#=GS G5A621_PHYSP/9-173          AC G5A621.1
#=GS T1JA16_STRMM/13-197         AC T1JA16.1
#=GS A0A094I083_9PEZI/22-189     AC A0A094I083.1
#=GS G9N2S0_HYPVG/26-193         AC G9N2S0.1
#=GS M9PHQ4_DROME/24-177         AC M9PHQ4.1
#=GS B4R4A9_DROSI/197-381        AC B4R4A9.1
#=GS A0A0V0ZZ04_9BILA/35-218     AC A0A0V0ZZ04.1
#=GS Q8RWB1_ARATH/4-168          AC Q8RWB1.1
#=GS Q0U5G5_PHANO/25-223         AC Q0U5G5.1
#=GS A0A067H243_CITSI/1-124      AC A0A067H243.1
#=GS L5LXA6_MYODS/1-171          AC L5LXA6.1
#=GS W2THV3_NECAM/65-249         AC W2THV3.1
#=GS G8C0B1_TETPH/14-216         AC G8C0B1.1
#=GS A0A0H5S0N7_BRUMA/37-84      AC A0A0H5S0N7.1
#=GS I0YZI6_COCSC/10-175         AC I0YZI6.1
#=GS M5ELW3_MALS4/10-174         AC M5ELW3.1
#=GS B8C9N6_THAPS/41-204         AC B8C9N6.1
#=GS A0A0D7B6C2_9HOMO/10-173     AC A0A0D7B6C2.1
#=GS M3ZTE6_XIPMA/10-175         AC M3ZTE6.1
#=GS V6U1Q1_GIAIN/1-137          AC V6U1Q1.1
#=GS A0A151VGZ8_HYPMA/10-173     AC A0A151VGZ8.1
#=GS T0QUG7_9STRA/50-213         AC T0QUG7.1
#=GS Q7RC31_PLAYO/10-175         AC Q7RC31.1
#=GS A0A151Z730_9MYCE/13-176     AC A0A151Z730.1
#=GS A0A0D1YVV0_9EURO/19-185     AC A0A0D1YVV0.1
#=GS A0A136JAV4_9PEZI/1-163      AC A0A136JAV4.1
#=GS K0SK04_THAOC/10-174         AC K0SK04.1
#=GS M5G439_DACPD/10-173         AC M5G439.1
#=GS A0A0D2I6Q8_9EURO/20-185     AC A0A0D2I6Q8.1
#=GS A0A0N0U780_9HYME/67-183     AC A0A0N0U780.1
#=GS A0A0G2FQ87_9PEZI/23-190     AC A0A0G2FQ87.1
#=GS A0A0D2VLI7_GOSRA/2-93       AC A0A0D2VLI7.1
#=GS M4EH49_BRARP/4-168          AC M4EH49.1
#=GS F4RZW6_MELLP/10-173         AC F4RZW6.1
#=GS U5FGX6_POPTR/3-167          AC U5FGX6.1
#=GS A0A0Q3RIA5_AMAAE/10-175     AC A0A0Q3RIA5.1
#=GS K0KUA6_WICCF/15-175         AC K0KUA6.1
#=GS I1H1P3_BRADI/3-165          AC I1H1P3.1
#=GS S7NM55_MYOBR/1-94           AC S7NM55.1
#=GS U5GDA8_POPTR/33-124         AC U5GDA8.1
#=GS A0A0L7QPS5_9HYME/37-221     AC A0A0L7QPS5.1
#=GS H2N7E1_PONAB/19-176         AC H2N7E1.1
#=GS F0ULM3_AJEC8/21-214         AC F0ULM3.1
#=GS A0A0N4ZGG7_PARTI/6-171      AC A0A0N4ZGG7.1
#=GS M0T4J1_MUSAM/3-166          AC M0T4J1.1
#=GS H3CJ03_TETNG/10-177         AC H3CJ03.1
#=GS Q18942_CAEEL/10-175         AC Q18942.1
#=GS F7GLJ8_MONDO/12-196         AC F7GLJ8.1
#=GS A0A096MRX0_PAPAN/10-175     AC A0A096MRX0.1
#=GS A0A024TH67_9STRA/55-219     AC A0A024TH67.1
#=GS A0A0P1ARE8_9STRA/37-201     AC A0A0P1ARE8.1
#=GS A0A0K0J8G0_BRUMA/10-175     AC A0A0K0J8G0.2
#=GS F4PGM1_DICFS/1-133          AC F4PGM1.1
#=GS A0A094CWW4_9PEZI/22-189     AC A0A094CWW4.1
#=GS A0A093GLK3_PICPB/50-234     AC A0A093GLK3.1
#=GS W5DV57_WHEAT/3-53           AC W5DV57.1
#=GS K6VGZ7_9APIC/165-327        AC K6VGZ7.1
#=GS E9GQD3_DAPPU/32-216         AC E9GQD3.1
#=GS J4DQ33_THEOR/129-289        AC J4DQ33.1
#=GS A0A0N4TPH1_BRUPA/47-231     AC A0A0N4TPH1.1
#=GS S9XCT7_CAMFR/1-124          AC S9XCT7.1
#=GS A0A0C3QJB6_9HOMO/10-173     AC A0A0C3QJB6.1
#=GS A0A017SNM0_9EURO/21-202     AC A0A017SNM0.1
#=GS I1BHD0_RHIO9/11-174         AC I1BHD0.1
#=GS F6UK93_HORSE/47-231         AC F6UK93.1
#=GS A0A165T9L8_9HOMO/10-173     AC A0A165T9L8.1
#=GS T1EDF2_HELRO/10-175         AC T1EDF2.1
#=GS H1VMK2_COLHI/24-191         AC H1VMK2.1
#=GS A0A0D0BI99_9AGAR/10-173     AC A0A0D0BI99.1
#=GS A0A067CBH5_SAPPC/9-173      AC A0A067CBH5.1
#=GS G1LRX0_AILME/10-175         AC G1LRX0.1
#=GS A0A0L0BU41_LUCCU/26-210     AC A0A0L0BU41.1
#=GS Q17D08_AEDAE/10-175         AC Q17D08.1
#=GS A0A0D3C5H0_BRAOL/10-175     AC A0A0D3C5H0.1
#=GS A0A0L8GDQ2_OCTBM/1-80       AC A0A0L8GDQ2.1
#=GS D7LFT1_ARALL/10-175         AC D7LFT1.1
#=GS C4R8X3_KOMPG/19-184         AC C4R8X3.1
#=GS A0A0V0TYM9_9BILA/59-224     AC A0A0V0TYM9.1
#=GS E1ZNW2_CHLVA/10-175         AC E1ZNW2.1
#=GS G3PQV2_GASAC/24-208         AC G3PQV2.1
#=GS A0A0S7E150_9EURO/21-209     AC A0A0S7E150.1
#=GS K9FM30_PEND2/21-204         AC K9FM30.1
#=GS A0A067DBD0_CITSI/1-27       AC A0A067DBD0.1
#=GS D8LU65_ECTSI/4-146          AC D8LU65.1
#=GS H2PZJ2_PANTR/47-231         AC H2PZJ2.1
#=GS K2R9I0_MACPH/20-208         AC K2R9I0.1
#=GS A0A067GPW5_CITSI/2-84       AC A0A067GPW5.1
#=GS A0A0C3BMH8_9HOMO/10-173     AC A0A0C3BMH8.1
#=GS A0A0C2DPA8_9BILA/1-62       AC A0A0C2DPA8.1
#=GS A0A0V1M198_9BILA/10-97      AC A0A0V1M198.1
#=GS H3G9C3_PHYRM/9-173          AC H3G9C3.1
#=GS X0BDR0_FUSOX/26-192         AC X0BDR0.1
#=GS A0A091CPG3_FUKDA/10-175     AC A0A091CPG3.1
#=GS A0CFN0_PARTE/86-247         AC A0CFN0.1
#=GS V4NLP3_EUTSA/4-168          AC V4NLP3.1
#=GS A0A0M9VNM6_9BASI/10-174     AC A0A0M9VNM6.1
#=GS L9KRH9_TUPCH/54-238         AC L9KRH9.1
#=GS K4BPW0_SOLLC/5-167          AC K4BPW0.1
#=GS A0A061DDF0_BABBI/167-343    AC A0A061DDF0.1
#=GS E4UUK9_ARTGP/21-208         AC E4UUK9.1
#=GS A0A0P7UWJ7_9TELE/10-175     AC A0A0P7UWJ7.1
#=GS A0A177E1V1_ALTAL/23-227     AC A0A177E1V1.1
#=GS C1ML42_MICPC/10-175         AC C1ML42.1
#=GS A0A0L8HZH2_OCTBM/7-191      AC A0A0L8HZH2.1
#=GS A0A166WPY7_9PEZI/24-191     AC A0A166WPY7.1
#=GS F7AMT8_CALJA/47-190         AC F7AMT8.1
#=GS A0A162YZJ2_MUCCL/1-163      AC A0A162YZJ2.1
#=GS E7QER7_YEASZ/15-219         AC E7QER7.1
#=GS W4IT64_PLAFP/11-175         AC W4IT64.1
#=GS E2B9R7_HARSA/37-220         AC E2B9R7.1
#=GS A0A0R3S653_9BILA/10-175     AC A0A0R3S653.1
#=GS A0A183NJV6_9TREM/6-148      AC A0A183NJV6.1
#=GS S9VCB1_9TRYP/46-244         AC S9VCB1.1
#=GS A0A0B2S496_GLYSO/4-166      AC A0A0B2S496.1
#=GS A0A091J8Z8_9AVES/22-206     AC A0A091J8Z8.1
#=GS A0A0W8CIY7_PHYNI/9-173      AC A0A0W8CIY7.1
#=GS A0A0C9UAC3_9HOMO/10-173     AC A0A0C9UAC3.1
#=GS A0A177WV65_BATDE/5-132      AC A0A177WV65.1
#=GS A0A0D7AAP4_9AGAR/10-183     AC A0A0D7AAP4.1
#=GS B3SEX8_TRIAD/10-175         AC B3SEX8.1
#=GS N6TV19_DENPD/10-175         AC N6TV19.1
#=GS A0A0N5AD73_9BILA/46-230     AC A0A0N5AD73.1
#=GS A0A158Q7H4_9BILA/47-231     AC A0A158Q7H4.1
#=GS A0A093ZLY5_9PEZI/22-189     AC A0A093ZLY5.1
#=GS M7YZV4_TRIUA/100-177        AC M7YZV4.1
#=GS S9X1J3_CAMFR/10-175         AC S9X1J3.1
#=GS A0A137P1R7_CONC2/12-176     AC A0A137P1R7.1
#=GS A0A022QWG5_ERYGU/5-166      AC A0A022QWG5.1
#=GS E6X8B2_CELAD/97-274         AC E6X8B2.1
#=GS A0A0V0VH30_9BILA/62-227     AC A0A0V0VH30.1
#=GS A0A094L0J4_ANTCR/21-205     AC A0A094L0J4.1
#=GS A0A091TJ42_PHALP/12-196     AC A0A091TJ42.1
#=GS A0A094FSS4_9PEZI/22-189     AC A0A094FSS4.1
#=GS A0A0L0DEE5_THETB/10-174     AC A0A0L0DEE5.1
#=GS A0A135TLH6_9PEZI/24-191     AC A0A135TLH6.1
#=GS V4T5N8_9ROSI/10-175         AC V4T5N8.1
#=GS A0A151X9C1_9HYME/10-175     AC A0A151X9C1.1
#=GS U3JST2_FICAL/1-134          AC U3JST2.1
#=GS D3B1N8_POLPA/3-164          AC D3B1N8.1
#=GS G3TI91_LOXAF/47-231         AC G3TI91.1
#=GS A0A0D2LM13_9CHLO/1-166      AC A0A0D2LM13.1
#=GS A0A0W0G801_9AGAR/10-191     AC A0A0W0G801.1
#=GS W7J6P1_PLAFA/173-335        AC W7J6P1.1
#=GS G3VXQ4_SARHA/1-133          AC G3VXQ4.1
#=GS A0A093YW19_9PEZI/22-189     AC A0A093YW19.1
#=GS A0A0K9QJA2_SPIOL/1-148      AC A0A0K9QJA2.1
#=GS A0A0M3ILB4_ASCLU/165-201    AC A0A0M3ILB4.1
#=GS D8TND3_VOLCA/10-177         AC D8TND3.1
#=GS B9SR85_RICCO/3-167          AC B9SR85.1
#=GS U5HBW6_USTV1/10-174         AC U5HBW6.1
#=GS M5XQR0_PRUPE/1-124          AC M5XQR0.1
#=GS D8SIA0_SELML/5-72           AC D8SIA0.1
#=GS A0A091HKR1_CALAN/10-175     AC A0A091HKR1.1
#=GS E2LWB8_MONPE/48-120         AC E2LWB8.1
#=GS M4DKE9_BRARP/10-175         AC M4DKE9.1
#=GS S8A531_DACHA/22-185         AC S8A531.1
#=GS G1QM59_NOMLE/48-232         AC G1QM59.1
#=GS G7KFW5_MEDTR/3-166          AC G7KFW5.1
#=GS R0K0D1_SETT2/23-218         AC R0K0D1.1
#=GS A0A0L0H982_SPIPN/13-177     AC A0A0L0H982.1
#=GS A0A164N7J1_9CRUS/10-175     AC A0A164N7J1.1
#=GS Q4XAT0_PLACH/10-175         AC Q4XAT0.1
#=GS A1DES8_NEOFI/21-209         AC A1DES8.1
#=GS B3MDH3_DROAN/10-175         AC B3MDH3.1
#=GS C1FDQ5_MICCC/10-174         AC C1FDQ5.1
#=GS A0A0E0KZ63_ORYPU/3-166      AC A0A0E0KZ63.1
#=GS A0A024UKU5_9STRA/9-173      AC A0A024UKU5.1
#=GS A0A150V0C9_9PEZI/20-184     AC A0A150V0C9.1
#=GS U1GVC6_ENDPU/20-185         AC U1GVC6.1
#=GS A0A161YQ56_DAUCA/10-174     AC A0A161YQ56.1
#=GS W4GR42_9STRA/57-221         AC W4GR42.1
#=GS A0A183W1H1_TRIRE/10-170     AC A0A183W1H1.1
#=GS Q4N1F1_THEPA/128-239        AC Q4N1F1.1
#=GS PR38A_BOVIN/10-175          AC Q0P5I6.1
#=GS L0B1D3_THEEQ/121-233        AC L0B1D3.1
#=GS A0A0Q9WI28_DROVI/1-69       AC A0A0Q9WI28.1
#=GS A0A0W4ZH86_PNECA/15-179     AC A0A0W4ZH86.1
#=GS A0A0J8FEL6_BETVU/10-175     AC A0A0J8FEL6.1
#=GS D8TKN7_VOLCA/1-167          AC D8TKN7.1
#=GS A0A068Y424_ECHMU/1-99       AC A0A068Y424.1
#=GS I1LB75_SOYBN/10-175         AC I1LB75.1
#=GS A0A0C7MMX2_9SACH/14-227     AC A0A0C7MMX2.1
#=GS A0A151S0K7_CAJCA/3-165      AC A0A151S0K7.1
#=GS A5DTV1_LODEL/38-215         AC A5DTV1.1
#=GS A8IJK3_CHLRE/10-175         AC A8IJK3.1
#=GS L2GTU9_VAVCU/4-152          AC L2GTU9.1
#=GS I1NJ40_SOYBN/10-175         AC I1NJ40.1
#=GS A0A0V0VH23_9BILA/62-227     AC A0A0V0VH23.1
#=GS A0A0N5C737_STREA/6-171      AC A0A0N5C737.1
#=GS A0A101MS26_9EURO/21-204     AC A0A101MS26.1
#=GS W1NQE5_AMBTC/3-166          AC W1NQE5.1
#=GS M7U0A7_BOTF1/21-188         AC M7U0A7.1
#=GS B4ME55_DROVI/10-175         AC B4ME55.1
#=GS A0A0V1A017_9BILA/546-729    AC A0A0V1A017.1
#=GS D8T1B4_SELML/10-168         AC D8T1B4.1
#=GS A5DGC7_PICGU/7-183          AC A5DGC7.1
#=GS A0A023B5L5_GRENI/10-174     AC A0A023B5L5.1
#=GS U6KXF4_EIMTE/120-282        AC U6KXF4.1
#=GS A0A183KSQ5_9TREM/26-210     AC A0A183KSQ5.1
#=GS E0VES7_PEDHC/10-175         AC E0VES7.1
#=GS A0A091WGY7_OPIHO/1-113      AC A0A091WGY7.1
#=GS J9NZD6_CANLF/48-232         AC J9NZD6.1
#=GS A0A067K178_JATCU/3-166      AC A0A067K178.1
#=GS A0A0M0K198_9EUKA/55-233     AC A0A0M0K198.1
#=GS A0A087XEK0_POEFO/10-175     AC A0A087XEK0.2
#=GS A0A151GPH8_9HYPO/23-190     AC A0A151GPH8.1
#=GS V9ES07_PHYPR/9-173          AC V9ES07.1
#=GS A0A093SL62_9PASS/20-204     AC A0A093SL62.1
#=GS A7RN21_NEMVE/18-202         AC A7RN21.1
#=GS A0A183CCA7_GLOPA/31-196     AC A0A183CCA7.1
#=GS A0A078DXJ9_BRANA/10-198     AC A0A078DXJ9.1
#=GS A0A183IS23_9BILA/37-220     AC A0A183IS23.1
#=GS W7KEH1_PLAFO/11-168         AC W7KEH1.1
#=GS A0A0F8DAS5_CERFI/24-191     AC A0A0F8DAS5.1
#=GS A8X281_CAEBR/57-204         AC A8X281.2
#=GS A0A137QTB7_9AGAR/10-173     AC A0A137QTB7.1
#=GS H3DCW8_TETNG/25-209         AC H3DCW8.1
#=GS G5C765_HETGA/85-176         AC G5C765.1
#=GS A0A151WST0_9HYME/1-180      AC A0A151WST0.1
#=GS G1S8M8_NOMLE/1-148          AC G1S8M8.1
#=GS A0A0R3W616_TAEAS/10-175     AC A0A0R3W616.1
#=GS A9TDL8_PHYPA/6-170          AC A9TDL8.1
#=GS A0A0L6VIQ5_9BASI/10-176     AC A0A0L6VIQ5.1
#=GS Q59WJ8_CANAL/17-194         AC Q59WJ8.1
#=GS A0A094AGC6_9PEZI/22-189     AC A0A094AGC6.1
#=GS A0A0Q3U491_AMAAE/50-234     AC A0A0Q3U491.1
#=GS E5A0N9_LEPMJ/24-234         AC E5A0N9.1
#=GS S7MJI8_MYOBR/1-34           AC S7MJI8.1
#=GS A0A0L7R1H9_9HYME/10-175     AC A0A0L7R1H9.1
#=GS A0A087W133_ECHMU/27-211     AC A0A087W133.1
#=GS A0A059LRU5_9CHLO/10-175     AC A0A059LRU5.1
#=GS F6HI04_VITVI/3-166          AC F6HI04.1
#=GS A0A0B1TH01_OESDE/490-655    AC A0A0B1TH01.1
#=GS C5GJR6_AJEDR/21-214         AC C5GJR6.2
#=GS A0A0D1YMY3_9PEZI/20-211     AC A0A0D1YMY3.1
#=GS A0A0H5C1I8_CYBJA/16-169     AC A0A0H5C1I8.1
#=GS U5CUR3_AMBTC/1-70           AC U5CUR3.1
#=GS G3BAA6_CANTC/7-180          AC G3BAA6.1
#=GS D7FPC2_ECTSI/167-227        AC D7FPC2.1
#=GS A0A0Q9WN88_DROMO/1-69       AC A0A0Q9WN88.1
#=GS D5GP15_TUBMM/20-183         AC D5GP15.1
#=GS J7RRK2_KAZNA/15-210         AC J7RRK2.1
#=GS A0A0D2T6W8_GOSRA/10-175     AC A0A0D2T6W8.1
#=GS S8ESL2_FOMPI/10-173         AC S8ESL2.1
#=GS A9UQL8_MONBE/10-172         AC A9UQL8.1
#=GS A0A0B4GRE7_9HYPO/24-191     AC A0A0B4GRE7.1
#=GS A0A024VK41_PLAFA/10-82      AC A0A024VK41.1
#=GS A0A059LNV7_9CHLO/42-209     AC A0A059LNV7.1
#=GS I3LP32_PIG/10-97            AC I3LP32.1
#=GS A0A0M8P2W3_9EURO/73-256     AC A0A0M8P2W3.1
#=GS M0X6G8_HORVD/3-153          AC M0X6G8.1
#=GS S7PSV6_MYOBR/10-175         AC S7PSV6.1
#=GS W5P5R7_SHEEP/10-175         AC W5P5R7.1
#=GS A0A0K0DK53_ANGCA/45-229     AC A0A0K0DK53.1
#=GS Q69K06_ORYSJ/10-175         AC Q69K06.1
#=GS A0A099P229_PICKU/22-191     AC A0A099P229.1
#=GS Q8IM21_PLAF7/173-335        AC Q8IM21.1
#=GS D7FPC2_ECTSI/52-172         AC D7FPC2.1
#=GS A0A094E0S4_9PEZI/22-189     AC A0A094E0S4.1
#=GS A0A066WLJ0_9HOMO/10-172     AC A0A066WLJ0.1
#=GS B4IGQ6_DROSE/1-166          AC B4IGQ6.1
#=GS G3AGB8_SPAPN/17-194         AC G3AGB8.1
#=GS I1GG42_AMPQE/33-217         AC I1GG42.1
#=GS I1EKT3_AMPQE/1-78           AC I1EKT3.1
#=GS A0A0V0XET8_TRIPS/10-175     AC A0A0V0XET8.1
#=GS G1N3A5_MELGA/1-182          AC G1N3A5.2
#=GS A0DJV2_PARTE/10-175         AC A0DJV2.1
#=GS A0A0V1CJ71_TRIBR/10-175     AC A0A0V1CJ71.1
#=GS H2TYE2_TAKRU/22-164         AC H2TYE2.1
#=GS A0A095BZN2_SCHHA/10-175     AC A0A095BZN2.1
#=GS I2H5J2_TETBL/16-212         AC I2H5J2.1
#=GS R1EUR9_EMIHU/44-217         AC R1EUR9.1
#=GS A0A067BPW6_SAPPC/9-173      AC A0A067BPW6.1
#=GS C4M949_ENTHI/7-169          AC C4M949.1
#=GS A0A0V0S2G5_9BILA/10-175     AC A0A0V0S2G5.1
#=GS A0A0D2P7T1_GOSRA/1-112      AC A0A0D2P7T1.1
#=GS I1JHT5_SOYBN/4-166          AC I1JHT5.1
#=GS A0A0N1PBP9_LEPSE/285-423    AC A0A0N1PBP9.1
#=GS J4C3Z9_THEOR/10-175         AC J4C3Z9.1
#=GS L5K6N9_PTEAL/10-175         AC L5K6N9.1
#=GS D0NNV1_PHYIT/37-201         AC D0NNV1.1
#=GS A0A0C2FU65_9BILA/1-176      AC A0A0C2FU65.1
#=GS A7ARD6_BABBO/10-175         AC A7ARD6.1
#=GS G4VNB2_SCHMA/10-175         AC G4VNB2.1
#=GS A0A098VUZ7_9MICR/10-175     AC A0A098VUZ7.1
#=GS A0A091QL98_MERNU/1-137      AC A0A091QL98.1
#=GS H6BS57_EXODN/19-185         AC H6BS57.1
#=GS W7X5L5_TETTS/175-341        AC W7X5L5.1
#=GS A0A0B2VGD8_TOXCA/46-230     AC A0A0B2VGD8.1
#=GS A0A183IE68_9BILA/1-119      AC A0A183IE68.1
B0WBK2_CULQU/28-212                    ..............................................l-PLWGNESTMNLNPLILANIQG..S.SY.FKVSLFKLKT................................YHEVVDEIYYQ..VKHLEP..............WERG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAFCLLYKL.YTLRLTRK..........QVN.GLLT......................................................HTDSP..YIRALGFM....Y...L.....RYTQP........................PADL....YD.WYE.....EY..LLDEE.---------...................EIDVKa..gGGQSITIGLMCR.QFL.......TKLDW...FS..T..LFPRIPVPIQKQIQ-q....................................................................
A0A0C9XDF4_9AGAR/10-173                ..............................................q-AIHGQNPQFLVETVIRNRIYE..S.TY.WKEHCFALTA................................-ESLIDKALQ-..VRFIGG..............-VYG.NQR.............................................-P.TEFLCLLLKL.LQIQPEKE..........ILV.EYLQ......................................................ADEFK..YLRALAAL....Y...I.....RMTFR........................AVEV....YE.LLE.....PL..LKDYR.KLRQRNMGG...................-----....-YALTFMDEFVY.ALL.......VEERV...CD..I..ILPRLIKRQVLEEN-g....................................................................
B9H3J6_POPTR/3-167                     .............................................vq--TNGKPIDSLFEKVLCMNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDNVEP..............WMTG.NCR.............................................GP.STSFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HKDSP..YIRAVGFL....Y...L.....RYAGD........................PKTL....WN.WFE.....PY..IKDDE.---------...................EFSPG...sSGRKTTIGIYVR.DLL.......LGQYY...FD..T..LFPRIPVPVLR----qita.................................................................
I0Z2X4_COCSC/2-166                     ............................................eqy----GNTATFNVESVLQKNIVN..S.EY.YRDTCMKLGT................................WEEVVDEIYYS..VQDVEP..............WMSG.NAR.............................................GA.SSAFCLLYRL.FTLVPSKP..........QIK.NLLD......................................................HTDSP..YIRAVGFL....Y...L.....RYAAN........................PRTL....WE.WIQ.....PY..VRDSE.---------...................EIDPSp.egHGKTVTMGEFVR.DVF.......LEQYY...FE..T..IFPRIPKPVH-----ddf..................................................................
G0W4U6_NAUDC/16-222                    ...............................................KQLNNSSVSLVIPRITRDKIHN..S.IY.YKVNLTSQSLrg............................ntMVQLIQVIVRD..FGKLKSqshshssdtmvvrnHLV-.---.............................................GG.TEFKCLLMKI.IELKPTIE..........QIW.ILLEdh.................................................ddtEFDNK..YITVLIIT....Y...I.....RIQYFfigk................ndslARKF....QD.IFQ.....KC..LNNYT.KLKCFQLDAdcw............spslSLSEE....SVRIIYMDEVVD.WLL.......TKDNI...WG..I..PLGKCQWVAE-----igav.................................................................
A0A093EJ78_9AVES/1-102                 ..............................................t----------------------..-.--.----------................................-----------..------..............----.---.............................................--.-------LKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HEERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
C5FIK5_ARTOC/25-209                    .........................................vnpatl----------------------..-.--.FEKACFGLNA................................-ATLCDRAVE-..LTYIGG..............-TYG.VGQ.............................................KP.TPFLCLAFKL.LQLAPERD..........VIL.EYLNfhdpeadkeensgdggnnp...............gadddpddaqdkadaailkaTGDFK..YLRALAAF....Y...V.....RLTFE........................PVEI....YK.TLE.....PL..LMDYR.KLKRRTKEG...................-----....-FLLTHMDQFVD.DLL.......TKDRV...CG..T..SLWKIPARTMLEDL-d....................................................................
A0A0V1L665_9BILA/78-243                ..............................................a-SLKGTNPQYLIEKVTRSRIYD..S.RY.WKEECFALSA................................-ELLVDRGME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLLLKM.LQIQPEKD..........IVI.EFIR......................................................QEDSK..YIRALGAL....Y...L.....RMTFS........................YVEV....YK.YLE.....PL..LNDYR.KLRWINKQG...................-----....KFELIHMDEFVD.KLL.......REERF...CD..V..QLPRLQKRAFLEE--tn...................................................................
C5K6I2_PERM5/108-276                   ............................................vvv----NQGPLYGLYPTLVQNIQS..S.DY.FNKGLRGMST................................VEEVVEEVERA..VEHAEP..............YNVG.ALN.............................................IP.STMFCCLYKL.CSKGQARP..........SWS.LSLG......................................................TASRR..YVVCLGLL....Y...L.....RCVAQ........................PSSL....WT.WFY.....PV..LFDTT.VFHPEEV--...................TGEAQ....AAESMMLGRYAE.LLL.......LTHKY...FT..V..NLNRLPETIL-----qky..................................................................
PRP38_ARATH/10-175                     ...............................................KNIRGTNPQNLVEKIVRTKIYQ..H.TF.WKEQCFGLTA................................-ETLVDKAME-..LDHLGG..............-TFG.GSR.............................................KP.TPFLCLILKM.LQIQPEKE..........IVV.EFIK......................................................NDDYK..YVRILGAF....Y...L.....RLTGT........................DVDV....YR.YLE.....PL..YNDYR.KVRQKLSDG...................-----....KFSLTHVDEVIE.ELL.......TKDYS...CD..I..AMPRLKKRWTLEQN-g....................................................................
A0A0F7TUV8_9EURO/21-204                ..............................................l--VRGVNPVTLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LSFVGG..............-TYG.VSE.............................................KP.SPFLCLAFKL.LQLNPSKD..........IIL.EYLNfsdpgsddeg..................................dnpdnailqtRGDFK..YLRVLAAF....Y...V.....RLTFN........................AVDV....YK.TLE.....PL..LLDYR.KIKRRVRDA...................-----....-YTLTYVDQFVD.DLL.......TKDRV...CG..T..SLWKLPPRQQLEDL-e....................................................................
A0A091TZ82_PHORB/1-183                 ...............................................--LWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKTI--dq...................................................................
D3BAL0_POLPA/154-210                   ...............................................----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................----....-K.YLE.....PL..YNDYR.TIRLQLDIG...................-----....-YRKLSMDEFVE.ELL.......TTNYS...LD..I..ALPHLPPRSSLEA--na...................................................................
A0A067RRD2_ZOONE/10-175                ..............................................k-SVRGTNPQYLIEKIIRSRIYD..C.KY.WKEECFALSA................................-ELLVDKAME-..LRFLGG..............-VYG.GNI.............................................KP.TPFLCLVLKM.LQIQPEKD..........IIV.EFIK......................................................NEEFK..YVRALGAT....Y...M.....RLVGT........................SLDC....YK.YLE.....PL..FNDSR.KLRRQNRQG...................-----....QFELIHMDEFID.ELL.......REERL...CD..I..ILPRIQKRHVLEEN-n....................................................................
W7J9T8_PLAFA/11-175                    ............................................knf----GSNPQYLISNIIRSKIYD..S.PY.WKEKCFALTS................................-ESIIDQAIN-..LKYVGG..............-TYG.GNR.............................................KP.TRFLCLILKL.LQIQPDKD..........IIY.EYIK......................................................NEDFV..YLRALGIF....Y...L.....RLIGK........................SLEV....YN.HLE.....PI..LFDYR.KIRMRLQNG...................-----....TFEKIYMDVFVD.NCL.......ILNNF...LD..V..DFPTLTKRQVLEEN-n....................................................................
A0A154PH93_9HYME/10-175                ...............................................KSIRGTNPQYLVEKIIRSRVYD..S.KY.WKEECFALTA................................-ELLVDKAME-..LRFIGG..............-VYG.GNV.............................................KP.TPFLCLILKM.LQIQPEKD..........IIV.EFIK......................................................NEEFK..YVRALGAL....Y...M.....RLTGS........................SLDC....YK.YLE.....PL..FNDNR.KLRKQNKQG...................-----....QFELIHMDEFID.ELL.......RDERS...CD..V..ILPRIQKRHVLEEN-n....................................................................
S0DNK7_GIBF5/26-192                    .............................................ap---NGLNPATIMEKAVKDRIVD..S.YF.YKEQCFALNE................................-ADIVDRVVEH..VNFIGG..............-TYG.VTQ.............................................KP.SPFLCLAFKL.LELSPSDA..........VLM.EYLKy....................................................gGEAFK..YLRALACF....Y...F.....RLTRQ........................AKDV....YE.MLE.....PF..LEDRR.KLRRRGRAG...................-----....-VVLTFMDEFVD.ELL.......TKERV...CG..T..SLWKMPKREVLEDL-e....................................................................
A0A0N1NXL0_9EURO/19-185                .............................................pl--IRGQNPALLIETATRDRITD..S.LY.WKEQCFGLNA................................-ATLLDRAVE-..LTYIGG..............-TYG.VGM.............................................KP.TPFLCLAFKL.LTIVPDRD..........IVL.EYLNr....................................................gGDEWK..YLRALAAF....Y...V.....RLTFA........................PTEV....YK.TLE.....PF..LEDSR.KLRRRRKEA...................-----....-YVLTYMDEFVD.ELL.......TKKRS...MG..T..ALWELPSRQALEDL-d....................................................................
J9I2Y7_9SPIT/195-356                   ..........................................cdykn---------GNLPEMIRNTILS..C.QY.FK-DLYNLKT................................FKEVIEEIKTH..VSYTEP..............WIVG.ANG.............................................VP.STLFCCLYKF.MLMRLNEK..........QVQ.TLLR......................................................YKLSP..YVRACGAL....Y...V.....RFLSP........................NDQL....FD.RLS.....PY..MLDEQ.---------...................SFSYSi..eKSQSLTFGEYVE.RLL.......SEKNY...FS..I..LLPRIPVI-------qfrelqk..............................................................
A0A093XH37_9PEZI/1-164                 ..............................................g-----LNPATIFEKPVRERIID..C.YF.WKDQCFALNE................................-ADIVSRVVEH..VQFVAG..............-TYG.DSQ.............................................RP.SPFLCLAFKL.LQLGPGDD..........ILK.EYLEy....................................................gGEKFK..YLRALACF....Y...V.....RLTRP........................AKEV....YE.TLE.....PF..LSDER.KLRRRGRQG...................-----....-TSLTFMDQFVD.ELL.......TKERV...CA..T..SLWKMPKREVLEDL-e....................................................................
A0A0E0PTE6_ORYRU/4-166                 ........................................qssgrpi--------DVLMEKVLSVNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.SSAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAVGFL....Y...L.....RYVAE........................PKTL....WS.WYE.....PY..IKDDE.---------...................EFSPG...sNGKMTTMGVYVR.DLL.......LGQYY...FD..S..LLPRVPLPI------lrqvt................................................................
A0A0N5AFH1_9BILA/10-174                ..............................................s-TVKGTNPQYLVEKIIRTRIYD..S.KY.WKEECFALTA................................-ELLVDKGME-..LRYVGG..............-IYA.GNV.............................................KP.TPFLCLCLKM.LQIQPEKD..........IVV.EFIS......................................................QEEYK..YIRALGAM....Y...L.....RLTFS........................SIEV....YK.YLE.....PL..YNDYR.KLRYMDKTG...................-----....HFELVHMDEFID.HLL.......RDERY...CD..I..QLPRLQKREALE---si...................................................................
A0A177WQJ2_BATDE/9-159                 ...............................................KNIHGTNPQFLIEKILRERIYE..S.AY.WKEKLFGVSA................................-ETLLDRAVE-..LQAIGG..............-QFG.SQ-.............................................KP.TEFICLALKI.LQLQPDDE..........IIT.LFLT......................................................NSDFK..YLTALAAF....Y...I.....RLTES........................HSQV....YR.RLE.....PL..LQDRR.KLRRRTN--...................-----....------------.DLL.......LEDRM...CD..T..ILPRLTKRYILEDQ-g....................................................................
H2MEA7_ORYLA/10-179                    ..............................................n-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTE................................MLIIFKRFENRgxXXFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRLLGAM....Y...M.....RLTGT........................AVDC....YK.YLE.....PL..YNDYR.KIKTQNRNG...................-----....EFELMHVDEFID.ELL.......HAERV...CD..I..ILPRLQRRQVLEEA-e....................................................................
G4TPS2_SERID/10-173                    ..............................................k-AIHGANPQSLVEEVIRLRIWE..S.AY.WKEECFGLTA................................-VSLIDKAIK-..LSAIGG..............-VYD.NTK.............................................-P.TQFICLLLKL.LQIQPEKE..........ILV.EYLL......................................................VEEYK..YLRALAAM....Y...I.....RMTFG........................AAEV....YQ.LLE.....PL..LNDYR.KLRLLSMNG...................-----....-FSLTYMDEFVD.KLL.......TEDRV...CD..I..ILPRLPKREILEQ--te...................................................................
A0A132BC42_9HELO/21-188                ............................................lap---NGLNPATIMEKPVRERIVD..C.YF.WKDQCFAVNE................................-ADIVNRVVDH..VHFIGG..............-TYG.DAQ.............................................RP.SPFLCLAFKL.LQLGPGDD..........VLR.EYLEf....................................................gGEKFK..YLRALALF....Y...V.....RLTRQ........................AKDV....YL.FLE.....PF..LKDYR.KLKRRGRTG...................-----....-TSLTFMDEFVD.DLL.......VKERV...CG..T..TLWKMPKREILEDL-d....................................................................
L2G882_COLGN/24-191                    ............................................lap---NGENPATIMEKAVRERIID..A.YF.YKEQCFAVNE................................-ADIVDRVVEH..VTFIGG..............-TYG.VTQ.............................................KP.TPFLCLAFKL.LQLAPSDE..........ILE.TYLGf....................................................gGEKFK..YLRALAVF....Y...I.....RMTRK........................AKDV....YL.LLE.....PF..LEDRR.KLRRKGRAG...................-----....-TSLTYMDEFVD.DLL.......TKSRV...CA..T..SFRELPKRVDLVD--lg...................................................................
C4Y6R0_CLAL4/3-178                     ...........................................rskv-----LNKAHLIESIVRNRIQD..S.LF.YKQHLFLTNE................................-SNILDVIVQQ..VKYLGG..............MD--.SGG.............................................RP.SPFLCCLLRL.LELEPSDE..........IIE.MYLSq...................................................ngYNEFK..YLTALTLL....Y...C.....RLVWK........................PKEF....YT.LYD.....KY..IQDHR.KLRIQLKSP...................EFVNHl.pvHFKLTYMDEWID.RLA.......EDDRV...VD..I..IMPYITPRQTLAE--kg...................................................................
C6HES4_AJECH/21-214                    ..............................................l--IRGVNPATLFEKAVRDRITE..S.YY.WKEQCFGLNA................................-ATLCDRAAE-..LSYIGG..............-TYG.LAQ.............................................KP.TPFLCLAFKL.LQLAPEKE..........IVL.EYLNfhdpenghvegsemn........................gleeeqggasgvvkaVGDFK..YLRALAAF....Y...I.....RLTFD........................AADI....YK.SLE.....PL..LTDYR.KLKRRMKDG...................-----....-FVLTYIDQFVD.DLL.......TKDRV...CG..T..SLWKLPSRHQLEDL-d....................................................................
U9TVS5_RHIID/10-166                    ..............................................i-AVHGTNPQYLIEKIMRTRIYE..S.LY.WKEFCFGLTA................................-ETLIDRAIE-..LTSFGG..............-EYG.N-Q.............................................KP.TEFLCLTLKL.LQLQPNKD..........IVM.EFIR......................................................NEDYK..YLRVLGAF....Y...L.....RLVGN........................SLEI....YQ.TLE.....PL..LNDYR.KLRKRTSGD...................-----....-FEIVCVDEFIE.ELL.......KEERV...CD..T..ILPRMLK--------r....................................................................
A0A0D3G3V7_9ORYZ/3-166                 ............................................iqt---SGKPIDLLMEKVLCMNIMS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKIL....WT.WYE.....PY..LKDDE.---------...................EFSPG...sNGRMTTMGVYVR.DLI.......LGQYY...FD..S..LLPRVPLPV------irqvt................................................................
A0A091LHF6_CATAU/1-111                 ..............................................i----------------------..-.--.----------................................-----------..------..............----.---.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HEERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
U3JLV7_FICAL/10-175                    .............................................lg--IHGTNPQYLVEKIIRTRIYE..C.RY.WKEECFGLTA................................-ELVLDKAME-..LKYVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.ELIK......................................................NKDFK..YVRMLGAL....Y...M.....RLTGA........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRKG...................-----....EFELMHVDEFID.ELL.......HEERV...CD..I..ILPRLQKRYVVEE--ae...................................................................
F2PU74_TRIEC/21-222                    ..............................................l--IRGVNPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LTYIGG..............-TYG.VGQ.............................................KP.TPFLCLAFKL.LQLAPEKE..........VIL.EYLNfhdpeadeedsntrgdsad................adgdaddaqdradaailraTGDFK..YLRALAAF....Y...I.....RLTFE........................PVEI....YK.TLE.....PL..LTDYR.KLKRRTKEG...................-----....-FLLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKIPTRTMLEDL-d....................................................................
N1R8N2_FUSC4/26-192                    .............................................ap---NGLNPATIMEKAVKDRIVD..S.YF.YKEQCFALNE................................-ADIVDRVVEH..VNFIGG..............-TYG.VTQ.............................................KP.SPFLCLAFKL.LELSPSDA..........VLM.EYLKy....................................................gGEAFK..YLRALACF....Y...F.....RLTRQ........................AKDV....YE.MLE.....PF..LEDRR.KLRRRGRAG...................-----....-VVLTFMDEFVD.ELL.......TKERV...CG..T..SLWKMPKREVLEDL-e....................................................................
A0A0L7M0N4_PLAF4/173-289               ............................................lem----TNTTTYNVNTLLRNNILS..S.EY.FK-SLIPIKT................................FKEVVDEIHSY..ADHVEP..............YCIG.SNR.............................................AP.STLFCCLYKF.FTMQLSEK..........QLK.SLIE......................................................NKDSC..YIRACGFL....Y...L.....RYVHS........................PANV....KK.KI-.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------knkkk................................................................
G5AIQ4_PHYSP/37-201                    ..............................................l-PIYGNDSTYNLNTLLHQNILQ..S.AY.FH-ELYKLRT................................YHEVVDEIYYR..VDLAEP..............WSPG.TAR.............................................IP.SSCFCLLHKF.FLMRLTRK..........QMQ.GLLR......................................................HTDSP..YIRVVGFL....Y...L.....RFTCD........................PEEL....WT.WFE.....PY..LEDPE.---------...................EFNASa..nPSLKTTIGEWLI.SLL.......EENNY...FG..T..ILPRIPKKIE-----dgik.................................................................
G8YPM8_PICSO/12-188                    ............................................dkr---NVLNKASLVEPIVRHRVQD..S.IF.YKQYLYLTNE................................-STILNVIIEH..VHYIGG..............--TS.ANG.............................................KP.SPFLCCMVRL.LELEPKQE..........IIQ.MYLSq...................................................mgTNTFK..YLTAMTLM....Y...I.....RFVGS........................SEEI....YS.ILE.....EY..YKDYR.KLRFQLKYPr................ehNGVHK....LYTLTYMDEWVD.DLL.......HKERL...VD..L..ILPRLAPRRFLQ---dag..................................................................
W5KVG4_ASTMX/10-175                    ..............................................n-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LKFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRLLGAT....Y...M.....RLTGT........................SVDC....YK.YLE.....PL..YNDYR.KIKTQNRNG...................-----....EFEIMHVDEFID.ELL.......HAERV...CD..V..ILPRLQKRQVLEEA-e....................................................................
H2S675_TAKRU/10-175                    ..............................................n-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LKFVGG..............-VYG.GNI.............................................KP.TPFICLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRLLGAM....Y...M.....RLTGT........................AVDC....YK.YLE.....PL..YNDYR.KVKTQNRNG...................-----....EFELMHVDEFID.ELL.......HSERM...CD..I..ILPRLQKRHVLEET-e....................................................................
W2YXI6_PHYPR/11-61                     ..............................................q-SVHGVNPQTLVEKIMRNRIYA..S.IY.WKEQCFGLTA................................-EALVDKILS-..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------rqqegsw..............................................................
W5FCD2_WHEAT/10-175                    ..............................................r-SIHGTNPQNLVEKIVRAKIYQ..S.NY.WKEQCFGLTA................................-ETLVDKAME-..LDHTGG..............-THG.GNR.............................................RP.TPFLCLALKM.LQIQPDKE..........IVV.EFIK......................................................NEDYK..YVRVLGAF....Y...L.....RLTGT........................VADV....YQ.YLE.....PL..YNDYR.KIRQKLSDG...................-----....KFTLTHVDEFID.ELL.......TKDYS...CD..T..ALPRIQKRWILEA--sg...................................................................
A0A091VKC1_PHORB/1-108                 ...............................................----------------------..-.--.----------................................-----------..------..............----.---.............................................--.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HEERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
H0Z2D2_TAEGU/48-232                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKAI--dq...................................................................
G3N4L7_GASAC/1-34                      ...............................................----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....----MHVDEFMD.ELL.......HAERM...CD..I..ILPRLQKRHVLEEA-e....................................................................
A0A091DJ53_FUKDA/1-176                 ...............................................---------MNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
A0A167E2X0_9PEZI/24-191                ............................................lap---NGENPATIMEKAVRERIID..S.YF.YKEQCFAVNE................................-ADIVDRVVEH..VSFIGG..............-TYG.VTQ.............................................KP.TPFLCLAFKL.LQLAPSDE..........VLE.TYLKf....................................................gGEKFK..YLRALACF....Y...I.....RMTRK........................ARDV....YL.LLE.....PF..LEDRR.KLRRKGRQG...................-----....-TSLTYMDDFVD.DLL.......TKTRV...CA..T..SFRELPKRSDLVD--ld...................................................................
A8BAJ9_GIAIC/1-145                     ...............................................-----------MEHATRRAILN..S.PL.YLMEFKHLGV................................IGLLKDVLVT-..-RNIDL..............-EYG.--Q.............................................EP.SRLLCSLVRL.YMLRPDRS..........IVH.EILS......................................................ARGFA..YATAFAAI....H...V.....RSYWS........................SLDI....HK.ALT.....PL..LNNYT.KIRVSGLKT...................---LG....LQGHVPLDVFVE.ALL.......HQPST...LS..-..---------------tcsgtf...............................................................
A0A074W0U8_9PEZI/19-183                .............................................tl--IRGQNPLLLFEKAVRDRIVD..S.YY.WKEQCFGLNA................................-ATLCDRAVD-..LTFIGG..............-TYG.VGQ.............................................KP.TPFLCLAFKL.LQLTPEKE..........IIL.HYLQ......................................................QEDWK..YLRALAAF....Y...I.....RLTWE........................PKDI....YE.TLE.....AY..LSDFR.KLKRRTRDA...................-----....-YTLSYIDQFID.DLL.......TKDRV...CA..T..SLWKMPSRTQLEDL-d....................................................................
W7HV93_9PEZI/23-186                    .............................................pt--IHSMNPVRLIEKIIRERIID..S.MY.WKEQAWGLNA................................-ATLMDRAVD-..LTYVGG..............-QY-.ANQ.............................................KP.TAFICLVLKL.LQLNPERD..........IIL.EYLN......................................................DDEFK..YLRALAAF....Y...I.....RLTWP........................AAEV....YK.TLE.....PL..MRDYR.KLRLRTIAG...................-----....-FRLTFVDEFID.ELL.......TKERV...CD..I..ALPRIPTRMQLEDT-d....................................................................
T1H306_MEGSC/10-175                    ...............................................KNVHGTNPQYLIEKIIRSRIYD..S.KY.WKEKCFALTA................................-ELLVDKAME-..IRFIGG..............-VYG.GNI.............................................KP.TEFLCLTLKM.LQIQPEKD..........IVV.EFIK......................................................NDEFK..YVRALGAF....Y...L.....RLTGT........................SVDC....YK.YLE.....PL..YNDNR.KLRRQNRSG...................-----....QFELVYMDDFID.ELL.......RSDRV...CD..I..ILPRIQKRDVLEEN-n....................................................................
W5MGQ8_LEPOC/10-175                    ..............................................n-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LKYVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRLLGAL....Y...M.....RLTGS........................SVDC....YK.YLE.....PL..YNDYR.KIKNQNRNG...................-----....EFELMHVDEYID.ELL.......HSERV...CD..I..ILPRLQKRQVLEEA-e....................................................................
W5L4F4_ASTMX/24-208                    ..............................................l-PLWGNEKTMNLNPMILTNVLS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHAEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PADL....IE.WYE.....PF..LDDEE.---------...................ELDVKa..gGGCVMTVGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKMI--dq...................................................................
A0A0D2QSW4_GOSRA/3-162                 .......................................iqtcgkpi--------DSLLEKVLCMNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYAAD........................PKTL....WS.WFE.....PY..IKDEE.---------...................EFSPG...sSGRMTTMGVYVR.DLL.......LGQV-...--..-..---------------tsnlekmklptkps.......................................................
A0A085M8W0_9BILA/10-175                ..............................................s-TVKGTNPQYLIEKVVRSRIYD..S.RY.WKEECFALSA................................-ELLVDKGME-..LRFVGG..............-VFG.GNV.............................................KP.SPFLCLQLKM.LQIQPDKE..........IVI.EFIR......................................................QEDSK..YIRALGAM....Y...L.....RLTFS........................SIEV....YQ.YLE.....PL..LNDYR.KLRWMSKQG...................-----....KFELMHMDEFVD.RLL.......REERF...CD..I..QLPRLQKRDVLEE--tg...................................................................
W9XE09_9EURO/20-185                    ..............................................l--VRGQNPALLLETAMRDRITD..S.LY.WKEQCFGLNA................................-ATLCDRAVE-..LSYIGG..............-TYG.VAM.............................................KP.TPFICLAFKL.LTLVPDRE..........IVL.EYLQn....................................................gGEEWK..YLRALAAF....Y...V.....RLTFE........................PADI....YK.TLE.....PF..LEDSR.KLRQRRKES...................-----....-YVLIHMDEFVD.NLL.......TKDRV...CG..T..SLWKLPARQLLEDL-e....................................................................
A0A0R3QY60_9BILA/10-175                .............................................vt--VKGTNPQYLVEKIIRTRIYD..S.KY.WKEECFALTA................................-ELLVDKGME-..LRYIGG..............-IYA.GNV.............................................KP.TPFLCLCLKM.LQIQPEKD..........IAV.EFIR......................................................QEEYK..YIRALGAM....Y...I.....RLTFT........................SIEV....YK.YLE.....PL..YNDYR.KLRMMNNEG...................-----....RFEIVHMDEFID.NLL.......RDERY...CD..I..HLPRIQKRITLEE--vg...................................................................
A0A066VG41_9BASI/10-174                ..............................................q-QIHSTNPQFLVEKVIRARIYS..N.NY.WREQCFALTA................................-ESVIDKALD-..LKYIGG..............-TYG.P-Q.............................................IP.SPFVCLLLKL.LQLQPQKE..........IIL.EYLT......................................................ADEFK..YLRALAAL....Y...V.....RLTFP........................SMEV....YE.VLE.....PM..LNDYR.RLRYRNQGG...................-----....CYTITHMDEFID.DLL.......TQERV...CE..L..ILPRLTRRDVLEES-e....................................................................
W2XZF6_PHYPR/9-173                     ..............................................q-SVHGVNPQTLVEKIMRNRIYA..S.IY.WKEQCFGLTA................................-ETLVDKAVE-..LQEFGG..............-TFG.GNQ.............................................QP.THFLCLLLKM.LQLQPELE..........VVK.QFIE......................................................NEDYK..YVTVLGAV....Y...L.....RLVGK........................PLEV....YT.LLE.....PL..LSDYR.KIRKRNVIG...................-----....-WEITHVDEIAD.ALL.......HEEYY...ID..L..ALPRLADRELLEKN-e....................................................................
A0A0N4VGU5_ENTVE/46-253                ..............................................l-PLWGNNHTMNLNSLVLENIIQ..C.TY.YKNYLAEANG................................FQQLTEEIYY-..-NVFDN..............MFKN.GSGfepynelhlrnglhvkhlepwergtrktqgmtgmcggvrgvgaggVV.STAFCLLYKL.FTIRLTRK..........QLV.SMIN......................................................NRDSP..YIRGIGFM....F...I.....RFCQP........................PADL....WA.WME.....PY..LDDEE.---------...................QIDPRs..gGGDIMTIGQVVK.MML.......TKLDW...YG..T..LFPRIPVPIQV----sn...................................................................
S7QHR4_GLOTA/10-173                    ..............................................q-AIHGQNPQYLVETVIRNRIYE..S.PY.WKEQCFALTA................................-ETLIDKAID-..LKCIGG..............-VYG.N-Q.............................................KP.TAFLCLLLKL.LQIQPEKE..........ILI.EYLQ......................................................ADEFK..YLRALAAM....Y...I.....RMTFR........................SVEV....YE.ILE.....PL..LKDYR.KLRYRTNTG...................-----....-YTLTYMDEFVD.NLL.......REERV...CD..I..ILPRLAKRSVLEE--tg...................................................................
I3MZU9_ICTTR/10-159                    ..............................................h-SIYGTNPQYLVEKIIRTRIYE..S.KY.WKEECVGLTA................................-ELVVDKAME-..------..............-LYG.GNI.............................................KP.TPFLCLTLKM.FQIQPEKD..........IIV.EF-K......................................................NEDFK..YVCMLG-L....Y...M.....RLTGT........................VIDC....YK.YLE.....PL..YNDCR.KIKSQNRNG...................-----....EFELMHVDEFID.E--.......-----...-H..I..ILPRLQ---------kcyvleeae............................................................
F6UQW2_HORSE/10-175                    ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A0U5FWE5_9EURO/21-212                ..............................................l--VRGLNPAMLFEKAVRDRITE..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LSFLGG..............-TYG.VSE.............................................KA.SPFLCLAFKL.LQLNPDRE..........IIL.EYLNfsdpeleadeadqd..........................tspeeraqssvvkhRGDFK..YLRALAAF....Y...V.....RLTWE........................PVEV....YK.TLE.....PL..LLDYR.KLKRRVRDS...................-----....-FVLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKLPSRQQLEDL-d....................................................................
A0A117DYI4_ASPNG/21-207                ..............................................l--VRGVNPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LTCIGG..............-VYG.VSE.............................................KP.SPFLCLAFKL.LQLNPERD..........IIL.EYLNfsdpdneptnd...............................esyeegdgvvkaRGDFK..YLRALAAF....Y...V.....RLTFE........................PVEV....YK.TLE.....PL..LLDYR.KLKRRVRDS...................-----....-FTLTYMDQFVD.ELL.......TKERV...CG..T..SLWKLPARQVLEDL-d....................................................................
A0A151M474_ALLMI/50-234                ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKAI--dq...................................................................
A0A0S4KG86_BODSA/222-355               ...............................evidgprlleehkdfv----------------------..-.--.----------................................---------SS..VKAAAV..............YTEP.GSG.............................................EA.SPFACLLWCL.FAMPVSHE..........ELT.ITLG......................................................THQNR..YLRAAAMY....Y...A.....RYLCP........................LEHL....AS.VFA.....PS..MDDET.IIACAGDA-...................-----....-SETRSMKDLAR.KLL.......LEDEV...DE..A..WLPT-----------yskwwl...............................................................
V3ZLZ8_LOTGI/10-175                    ..............................................h-SIKGTNPQYLIEKIIRTRIYE..C.RY.WKEECFALTA................................-ALLVDKAME-..LKYIGG..............-VFG.GNV.............................................KP.TDFLCLILKM.LQIQPEKD..........IVV.EFIK......................................................NEDFK..YVRALGAI....Y...M.....RLTGT........................SLDC....YK.YLE.....PL..YLDYR.KMKRMNRNG...................-----....EFEILHMDEFID.ELL.......REERV...VD..I..ILPRLQKRQVLEES-n....................................................................
A0A0V1NN14_9BILA/427-610               ..............................................l-NFWGNKETMNLNHLVLENIVS..S.PY.YKNTLLPLKT................................HFEVIDEIYYN..VEHLEP..............WEKG.TRKttgqtgmcg...........................gvrgvgaggVV.SSAFCLLYKL.FTLKLTRK..........QLT.AILN......................................................HPDSC..YIRGLGFM....Y...I.....RFCLH........................PATF....WS.WYE.....PY..FDDSE.---------...................EIDPKa..gGGDLMTIGEMVK.SLL.......TKLDW...YS..T..LFPRIPVPIQKEI--d....................................................................
M4A2I4_XIPMA/25-209                    ..............................................l-PLWGNEKTMNLNPMILTNVLS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHIEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....LD.WYN.....DF..LDDEE.--KTVQKAS...................-----....GETKKKEGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKAI--dq...................................................................
F7A5D9_CALJA/47-231                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
M3K4S3_CANMX/17-194                    ............................................dkr---YTQNKGNLIEPIIRHRIQD..S.IF.YKQHLYLTNE................................-ATLLPVITNH..VHYISG..............--TD.SSN.............................................RP.SPFISCLFRM.LELEPSKE..........IID.TYLTq...................................................lnFNEFK..YLTALTLI....Y...I.....RLVYK........................SEDI....YR.LFD.....PY..FKDFR.KLRVRLKNPmf...............dsMQIPK....HYKISYIDEWVD.ELL.......TNDRV...ID..L..ILPRLVPRISLVE--kg...................................................................
A0A0C9ZG06_9HOMO/10-99                 ..............................................l-AIHGQNPQFLVETVIRNRIWE..S.AY.WKEHCFALTA................................-ESLIDKAIG-..LRYIGG..............-VYG.NQR.............................................-P.TEFLSLLLKL.LQIQPEKE..........ILI.EYLQ......................................................ADEFK..W-------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------ah...................................................................
A0A0A1NZE8_9FUNG/11-174                .............................................tg--VHGRHPMHLVEKIIRERIQE..S.IY.WKEKCYGLTA................................-ATLMERAVE-..IDYIGG..............-TFG.NLQ.............................................-P.TEFLCLLLKL.LQLLPERE..........III.EYIM......................................................QDDFK..YLRALGAF....Y...L.....RLTGK........................SVEI....YK.YLE.....PL..LLDYR.KLRVRGKDG...................-----....-YSITYMDVFID.DLL.......TKDRV...CD..I..ILPRIMARHILEQN-d....................................................................
S8BH21_PENO1/21-204                    ..............................................l--VRGVNPVTLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LSCVGG..............-TYG.VSE.............................................KP.TPFICLAFKL.LQLNPSRD..........IVL.EYLNfsdpgsddeg..................................enpdsgvvqtRGDFK..YLRVLAAF....Y...V.....RLTFD........................AVDV....YK.TLE.....PL..LLDYR.KIKRRVRDS...................-----....-FTLTYVDQFID.DLL.......TKDRV...CG..T..SLWKLPPRQQLEDL-d....................................................................
M0SG80_MUSAM/10-174                    ...............................................KSIHGTNPQNLVEKILRSKIYQ..N.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHLGG..............-TYG.GSR.............................................KP.TPFMCLILKM.LQIQPDKE..........IVV.EFIK......................................................NDEYK..YVRVLGAF....Y...M.....RLTGS........................VTDV....YR.YLE.....PL..YNDYR.KLRLKLSEG...................-----....KFCLTHVDEVID.ELL.......TKDYS...CD..I..ALPRVQKRWTLE---ac...................................................................
A0A087SV61_9ARAC/13-197                ..............................................l-PLWGNEKTMNLNNLILTNILS..S.HY.FKVNLYQLKT................................YHEVIDEIYYQ..VTHLEP..............WEKG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAFCILYKL.FTLKLTRK..........QVV.GLIN......................................................HNDSP..YIRALGFI....Y...I.....RYTQP........................PVDL....WD.WYE.....PY..LEDEE.---------...................EIDVKa..gGGQVMTIGEMLR.HFL.......SKLEW...FS..T..LFPRIPVPIQKD---ler..................................................................
A0A0V0WEJ5_9BILA/427-610               ..............................................l-NFWGNKETMNLNHLVLENIVS..S.PY.YKNTLLPLKT................................HFEVIDEIYYN..VEHLEP..............WEKG.TRKttgqtgmcg...........................gvrgvgaggVV.SSAFCLLYKL.FTLKLTRK..........QLT.AILN......................................................HPDSC..YIRGLGFM....Y...I.....RFCLH........................PATF....WS.WYE.....PY..FDDSE.---------...................EIDPKa..gGGDLMTIGEMVK.SLL.......TKLDW...YS..T..LFPRIPVPIQKEI--d....................................................................
A1CAF4_ASPCL/21-209                    ..............................................l--IRGVNPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LSSIGG..............-TYG.VAE.............................................KP.TPFLCLAFKL.LQLNPERD..........VIL.EYLNytdpgsdeeaea.............................taeeqarngvagqKGDFK..YLRALAAF....Y...V.....RLTFD........................AVDV....YK.TLE.....PL..LLDYR.KLKRRVRDS...................-----....-FVLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKLPSRQQLEDL-d....................................................................
Q4YH72_PLABA/10-175                    ...........................................iksf----GSNPQFLISNIIRNKIYD..S.PY.WKEKCFALTS................................-ESIIDQAVN-..LKYAGG..............-TYG.GNR.............................................KP.TRFLCLVLKL.LQLQPDKD..........IIY.EFIK......................................................NEEFI..YLRALGIF....Y...L.....RLIGK........................GIEI....YK.NIE.....PI..LFDYR.KIRIRLQDG...................-----....SFQKMYMDVFAD.NCL.......VFNNF...LD..V..DFPPLTKRIVLEEN-n....................................................................
A0A091P9S9_APAVI/1-141                 ..............................................f----------------------..-.--.----------................................----------Q..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKTI--dq...................................................................
L8FWG2_PSED2/22-189                    ............................................lap---NGLNPATIFEKPVRERIID..C.YF.WKDQCFALNE................................-ADIVSRVVEH..VHFVAG..............-TYG.DSQ.............................................RP.SPFLCLAFKL.LQLGPGDD..........ILK.EYLGy....................................................gGERFK..YLRALACF....Y...V.....RLTRP........................AKEV....YE.TLE.....PY..LEDGR.KLRRRGRQG...................-----....-TSLTFVDQFVD.ELL.......TKERI...CA..T..SLWKMPKREVLEDL-e....................................................................
D8LWY4_BLAHO/35-198                    ..............................................v-PINGNAESFNLGDIMVSNIME..S.RY.FF-KVLDLTD................................IEEVINEIKRE..VHDLEP..............LVIG.SSR.............................................HP.SSAFCILYKL.SRMRITYQ..........ELS.ELIH......................................................CLDNS..YVRGIGYL....Y...I.....RFAIA........................PREL....WK.FYA.....PY..FDDNT.S--------...................-LVPF...sDKTPTTIGRFVT.GLI.......TNKRY...QT..V..MLPTIPIVVK-----rdwe.................................................................
W2SQD8_NECAM/544-708                   ..............................................h-TVRGTNPQFLIEKIIRQRIYD..S.KY.WKEYCFALSA................................-DLVVDRALE-..LRYIGG..............-IYA.GNV.............................................KP.TPFLCLSLKM.LQIQPEKD..........III.EFIQ......................................................QEQSK..YARALGAM....Y...L.....RLTFT........................SVEI....YK.YLE.....PL..FNDYR.KLRYMNKQG...................-----....RFELVYMDEFID.NLL.......REERY...CD..I..QLPRLQVC-------aywhtd...............................................................
E2A1P6_CAMFO/10-175                    ...............................................KSIRGTNPQYLVEKIIRSRIYD..S.KY.WKEECFALTA................................-ELLVDKAME-..LRFLGG..............-VYG.GNV.............................................KP.TPFLCLILKM.LQIQPEKD..........IIV.EFIK......................................................NEEFK..YVRALGAL....Y...M.....RLTGS........................SLDC....YK.YLE.....PL..FNDNR.KLRIQNKQG...................-----....VFELIHMDEFID.HLL.......REERC...CD..V..ILPRIQKRYVLEEN-n....................................................................
A0A0K0EJ62_STRER/6-171                 ..............................................r-TIRGTRSTFLIEKIIRTRINE..S.LY.WKEECFGLSA................................-ETVIDKGAE-..LRYVGG..............-IYA.GNT.............................................KP.TPYLCLMLKL.LELAPEKD..........III.EYIK......................................................QEDFK..YIRALGAM....Y...I.....RLTFP........................SVEI....YQ.YLE.....PL..YNDYR.KLRYMNRMG...................-----....RFELMYMDDFID.KLL.......HEELF...CD..I..HLPKIQGRQLLEQN-d....................................................................
A0A0L9SRI6_9HYPO/24-191                ............................................lap---NGLNPATIMEKAVRDRITN..S.YF.YQEQCFFANE................................-ADMVDRAVEY..VNFIGG..............-THG.ADQ.............................................KP.SPFLCLAFKL.LELAPSED..........IVA.EYLAy....................................................gGERFK..YLRALACF....Y...V.....RLTRP........................AAEV....YR.LLE.....PF..LEDRR.KLRRRRRDG...................-----....-CFLSFVDEFVD.DLL.......TKERV...CA..T..SLWKMPARETLEDA-e....................................................................
G0QNS3_ICHMG/118-284                   ..............................................f-QIWGDETSGNINPKLRTNIMN..C.SY.FRIDLFSLKT................................YHEVIEEIQKN..VNHAEP..............WARG.ATG.............................................VP.SSMFCCLYKF.MLMKLTVK..........QVR.GLVE......................................................YKFSP..MVRAAGFL....Y...I.....RFCCD........................PKYM....FA.WFK.....KY..LLDDE.DFKPGA---...................---DK....NSPSMTIGDYVE.GLL.......NNQEY...YN..T..RLPRIPTKYET----klk..................................................................
Q2H4I5_CHAGB/105-167                   ..........................................yprlw----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................----....RR.EVQ.....PF..LEDRR.KLRRKGRDG...................-----....-TTLTYMDVFVD.DLL.......TKDRV...CA..T..SLWKMRKRDILEDL-e....................................................................
F6SY19_ORNAN/10-56                     ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTG................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------erldapgmklrp.........................................................
D6X552_TRICA/24-208                    ..............................................l-PLWGNERTMNLNPLILTNIQS..S.HY.FKVNLYELKT................................YHEVVDEIYYK..VNHLEP..............WEKG.SRRtsgqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.FTLKLTRK..........QLN.GLIN......................................................HCDSP..YIRALGFM....Y...I.....RYTLP........................PKDL....LE.WYE.....DY..LEDEE.---------...................ELDVKa..gGGQMMTIGTMLR.QWL.......VKLEW...FS..T..LFPRIPVPIQQKIQ-k....................................................................
A0A183N3X9_9TREM/26-210                ..............................................l-KLWGNPQTMNLNTMIYTNIAQ..S.PY.FKANLVELKT................................YHEVIDEIYYK..VEHLEP..............WERG.SRRiggqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.FTLKLTRK..........QLK.GLLD......................................................HPDSP..YIRALGFM....Y...I.....RYCIP........................PEDF....WW.WYS.....PY..LSDPE.---------...................ELDVKa..gGGCVMTIGNMLE.HWL.......TKLDW...FS..T..LFPRIPVPVQKK---lee..................................................................
A0A0C4E3X3_MAGP6/24-191                ............................................lap---NGLNPARIMEKAVVDRIID..S.YF.WKEQCFGLNE................................-ADIVDRVVDH..VHFIGG..............-ITG.PSQ.............................................KP.TPFLCLALKL.LQLAPGDD..........VLA.EYLHf....................................................gGEKFK..YLRALALF....Y...V.....RLTRA........................PKDV....YA.TIE.....PF..LEDYR.KLRRKGRAG...................-----....-TSLTYIDDFAD.DLL.......VKDRV...CA..T..SLYKLTKRDVLEDL-d....................................................................
A0A0K6G8X0_9HOMO/10-173                ..............................................i-HIHGQNPQFLVEKVIRTRIWE..S.AF.WKEQCFALTA................................-ESLIDKAIE-..LNSIGG..............-VYG.NQR.............................................-P.THFICLLLKL.LQIQPEKE..........ILI.EYLM......................................................VDEFK..YLRALAAM....Y...I.....RMTFP........................AVEI....YE.LLE.....PL..LKDYR.KIRLRNMAG...................-----....-YSLTYMDEFVD.QLL.......TEERV...CD..I..ILPRMAKREVLEDT-e....................................................................
A0A095C2R6_CRYGR/9-163                 ..............................................t-AVHGSNPQYLIEKVIRARIYD..S.LY.WKEHCFALTE................................-----------..LRAIGG..............--VT.DRQ.............................................TP.TPFICLVLKL.LQLQPEKE..........ILI.EYLL......................................................AEEFK..YLRALAAF....Y...V.....RLTFR........................SLEV....YE.ILE.....PL..MKDYR.KLRVVHAGG...................-----....-YSLTYFDEFID.ELL.......TQERV...CD..I..ILPRLTQRSVLEET-e....................................................................
A0A074T919_HAMHA/142-303               ............................................emt-----DSTTYNVNALLRSNILS..S.EY.FK-SLHELKT................................VPEVVEEITQY..AQHAEP..............YCSG.SSR.............................................AP.STLFCCLYKL.FTMKLTTK..........QLE.QLLD......................................................YSDSP..YVRCTGFL....Y...L.....RYVHP........................PEKL....WK.WYE.....QY..FLDDE.-VFAASSD-...................-----....AKRTTTMGEYVE.SLI.......MEDKY...FN..T..VLPRLPVKVK-----nly..................................................................
A0A099Z750_TINGU/50-234                ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKTI--dq...................................................................
L5LMJ2_MYODS/10-175                    ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKGECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFKK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSPNRNG...................-----....EFELMHVDEFID.DLL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
Q4E0F0_TRYCC/9-176                     .............................................wn--LKGRSAVAALDPSTRHRIMQ..S.HA.MASSFHKPLL................................-ATLEVLITP-..-QYVGG..............-LTG.PLQ.............................................KP.EPFICHVTRL.LQITPDPS..........IVL.AMLH......................................................QDVHK..YLRVAALF....I...I.....RLIGN........................EAMM....RE.AMR.....VG..WEDYR.KIRVYGYVE...................-----....------------.---.......-----...--..-..---------------dlagtidskennapdeeegfvrapaygimcvdeitdrlfnv............................
W4FTM1_9STRA/9-142                     .............................................fs--VHGVNPQHLVEKILRNRIYD..S.MY.WKEQCFGLTA................................-ETLVDKAIE-..LTHIGG..............-HFG.GNQ.............................................QP.TPFLCLLLKM.LQIQPDME..........IVV.EFIK......................................................NGDYK..YVTMLGAF....Y...L.....RLVGK........................PTDV....YP.ILE.....EL..LADYR.KIRKRNTL-...................-----....------------.---.......-----...--..-..---------------gpslvhl..............................................................
Q4N1F2_THEPA/1-29                      ...............................................----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------MGEYVE.SLL.......MEDKY...YH..T..ILPRLPVRVK-----nl...................................................................
T1K3B4_TETUR/10-175                    ...............................................KSIHQTNPQYLVEKIIRGRIYE..S.RF.WKEDCFGINE................................-ESLVDKATE-..LKYIGG..............-IYG.GNI.............................................KP.TPFMCLILKM.LQIQPHKD..........ITI.EFIK......................................................QPHFK..YARALGAY....Y...L.....RLTAV........................SLDV....YK.YLE.....PL..YADYR.KLRYIDRMG...................-----....KFSIIHMDEFID.MLL.......REDRV...FD..V..ILPRIKARRIHEEN-d....................................................................
A0A0M3ILB4_ASCLU/10-168                .............................................vt--VKGTNPQYLVEKIIRTRIYD..S.KY.WKEECFALTA................................-ELVVDRGIE-..LRYVGG..............-IYA.GNV.............................................KP.TPFLCLSLKL.LQIQPEKD..........IIV.EFIR......................................................QEEYK..YIRALGAM....Y...L.....RLTFS........................SIEV....YK.YLE.....PL..YNDYR.KLRYMNKDG...................-----....RFELVYMDEFID.NLL.......RQERY...CD..I..QLPRLQ---------lv...................................................................
H2WNF1_CAEJA/10-112                    ..............................................k-TVKGTNPQFLVEKIIRQRIYD..S.MY.WKEHCFALTA................................-ELVVDKGMD-..LRYIGG..............-IYA.GNI.............................................KP.TPFLCLALKM.LQIQPDKD..........IVX.X---......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------xxxxxpyrvsashddrrdrrdkk..............................................
A0A074ZRA8_9TREM/29-213                ..............................................l-KLWGNQQTMNLNTMVYTNIVQ..S.PY.FKANLIELRT................................YHEVIDEIYYK..VEHLEP..............WERG.SRRvggqsgmcg...........................gvrgvgaggIV.STAFCLLYKL.FTLKLTRK..........QLK.GLLD......................................................HPDSP..YIRALGFM....Y...I.....RYCLP........................PEDF....WW.WYA.....PY..LDDTE.---------...................EIDVKa..gGGSMMTIGSMIQ.HWL.......TKLDW...FG..T..LFPRIPVPVQKK---lee..................................................................
W4GRF9_9STRA/57-221                    ..............................................l-PIHGNQTTYNFNTLLYDNVMN..S.DY.FR-KLYELAT................................YHEVVDEIYYR..VDHAEP..............WAAG.TSR.............................................IP.STCFCLLMKF.CTMRLTVN..........QMQ.GLLK......................................................HVDSP..FIRCVGFL....Y...L.....RYTCD........................PELL....WE.WYE.....PF..LDDEE.---------...................EFNASs..nDAILTTMGAWIR.SLL.......EDLNY...FN..T..ILPRIPKKIQ-----dgik.................................................................
F0XUL2_GROCL/26-192                    .............................................ap---NGLNPATIMEKAVRERIVD..S.YF.WKEQCFGVNE................................-ADVVDRVVDH..VNCIGG..............-TTG.TAQ.............................................KP.TPFLCLAFKL.LQLAPNDE..........ILA.AYLQh....................................................gGERFK..YLRALALF....Y...V.....RLTRP........................ADAV....YR.TLE.....PF..LADRR.KLRRRGRAG...................-----....-TTLTFVDDFVD.DLL.......VKPRV...CA..T..SLWKLPSRDVLED--lg...................................................................
A0A0C2Z7C8_HEBCY/10-173                ..............................................q-AIHGQNPQFLVETVIRNRIYE..S.TF.WKEHCFALTA................................-ESLIDKAIE-..VRFIGG..............-VYG.NQR.............................................-P.TEFLCLLLKL.LQIQPEKE..........ILV.EYLR......................................................AEEFK..YLRALAAL....Y...I.....RMTFR........................AVDV....YE.LLE.....PL..LKDYR.KLRERNMAG...................-----....-YSLLFMDEFIY.SLL.......TEERV...CD..I..IMPRLAKRQVLEEN-g....................................................................
A0A0L6WW45_9AGAR/10-168                ..............................................l-AIHGKNPQFLVETVIRNRIYE..S.NY.WKEHCFALTA................................-ESLIDKAIE-..VTYIGG..............-VYG.NQR.............................................-P.TSFMCLVLKL.LQIQPEKE..........ILV.EYLR......................................................AE--E..YLRALAAL....Y...I.....RLTFR........................AVDV....YE.LLE.....PL..LKDYS.KIRLRGMGG...................-----....-YSLTFMDEYVY.SLL.......TEERG...LG..-..---------------rvvfwmqskeram........................................................
A0A075AYX0_9FUNG/10-174                ..............................................f-QVHGVDPQFLIEKITRTRIYE..S.QY.WKENCFGLNI................................-ETLVDKAVK-..LDHIGG..............-LFG.T-N.............................................IP.TPFLCLVLKM.LQLAPTKD..........IVF.EFVR......................................................NGDYK..YVRALGVF....Y...L.....RLVGS........................GLEI....YR.ELE.....PL..LADYR.KLRLRNKDR...................-----....SYTIIHMDEFVD.ELL.......TQERT...FD..T..ILPRIVKRHVLAE--tg...................................................................
M7YQW6_TRIUA/1-102                     ..............................................m----------------------..-.--.----------................................----------E..LDHTGG..............-THD.GNR.............................................RP.PPFLCLALKV.LQIQPNKE..........IVL.EFIK......................................................NEDYK..YVRVLGAF....Y...L.....RLTGT........................VADV....YQ.YLE.....PL..YNDYR.KISQKLSDG...................TS---....------------.---.......-----...--..-..---------------rtleprrsaleddf.......................................................
U6Q036_HAECO/10-175                    ..............................................h-TVKGTNPQFLVEKIIRQRIYD..S.KY.WKESCFALSA................................-DLIVDRALD-..LRYIGG..............-IYA.GNV.............................................KP.TPFLCLALKM.LQIQPEKD..........III.EFIQ......................................................QEQSK..YARALGAM....Y...L.....RLTFS........................SVEI....YK.YLE.....PL..FNDYR.KLRYMNKLG...................-----....RFELVYMDEFID.NLL.......REERY...CD..I..QLPRLQKRQALED--ag...................................................................
A0A091EHF6_CORBR/1-141                 ..............................................f----------------------..-.--.----------................................----------Q..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKAI--dq...................................................................
A0A0C2X5H9_AMAMU/10-173                ..............................................k-AIHGQNPQHLVETVIRSRIYE..A.QY.WKEHCFALTA................................-ASLIDKATE-..LKYVGG..............-VYG.NQR.............................................-P.TEFLCLLLKL.LQIQPEKE..........ILV.EYLQ......................................................ADEFK..YLRALSAM....Y...V.....RMTFR........................AAEV....YE.ILE.....PL..LKDYR.KLRVRSMTG...................-----....-YSLTYMDEFVY.ALM.......TEERV...CD..L..ILPRIAKRQVLEE--tg...................................................................
S7NNI0_MYOBR/1-75                      ..............................................m----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..----LGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....LL..YNDYR.KIKNQNQNG...................-----....EFELMHVVEFID.ELL.......HSERV...CD..I..ILPWLQKCYMLEE--ae...................................................................
A0A0V0TYI5_9BILA/59-224                ..............................................a-SLKGTNPQYLIEKVTRSRIYD..S.RY.WKEECFALSA................................-ELLVDRGME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLLLKM.LQIQPEKD..........IVI.EFIR......................................................QEDSK..YIRALGAL....Y...L.....RMTFS........................YVEV....YK.YLE.....PL..LNDYR.KLRWINKQG...................-----....KFELIHMDEFVD.KLL.......REERF...CD..V..QLPRLQKRAFLEE--tn...................................................................
A0A0D3B635_BRAOL/10-175                ...............................................KNIRGTNPQNLVEKIVRTKIYN..H.TF.WKEQCFGLTA................................-ETLVDKAME-..LDHVGG..............-TFG.GNR.............................................KP.TPFLCLILKM.LQIQPEKE..........IVV.EFIK......................................................NDDYK..YVRILGAF....Y...L.....RLTGS........................DVDV....YR.YLE.....PL..YNDYR.KVRQKLSDG...................-----....RFSLTHVDEVIE.ELL.......TKDYS...CD..I..AMPRLKKRWTLEQN-g....................................................................
C1E4N5_MICCC/10-173                    ............................................tgr----DNGKSYNMERVLRSNILN..S.DY.FV-QLSKIED................................FMDLVDEIYNE..VDHVEP..............WMSG.NAR.............................................GP.STAFCLLYRL.FTMELDDR..........NVN.HLIR......................................................HRDSP..YIRAIGFL....Y...V.....RYVRD........................PKEF....GR.WFD.....PF..FKDDE.---------...................EFAPM...pGGKNVTIGAFVR.DLV.......LDQYY...FE..T..IFPRCPEVT------rralvd...............................................................
F7GLK3_MONDO/52-236                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
F2EBP1_HORVD/3-150                     ...........................................lqts----GRPIEVLMEKVLSMNIVS..S.DY.FK-ELYKIKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKL.FTMKLTVN..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYAAD........................PKTL....WT.WYE.....PY..IQDDE.---------...................EFSPG...sNGKMTTMGVYVR.DVI.......L----...--..-..---------------gqvyl................................................................
G8F4J3_MACFA/47-231                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
A2QN12_ASPNC/21-209                    ..............................................l--VRGVNPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LTSIGG..............-VYG.VSE.............................................KP.SPFLCLAFKL.LQLNPERD..........IIL.EYLNfsdpandedstg.............................heerehddgvvkaRGDFK..YLRALAAF....Y...V.....RLTFE........................PVEV....YK.TLE.....PL..LLDYR.KLKRRVRDS...................-----....-FTLTYMDQFVD.ELL.......TKERV...CG..T..SLWKLPARQVLEDL-d....................................................................
B8AYN3_ORYSI/3-166                     ............................................iqt---SGKPIDLLMEKVLCMNIMS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKIL....WT.WYE.....PY..LKDDE.---------...................EFSPG...sNGRMTTMGVYVR.DLI.......LGQYY...FD..S..LLPRVPLPV------irqvt................................................................
A0A0F4YPS0_TALEM/21-208                ..............................................l--IRGVNPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LKSIGG..............-TYG.ASQ.............................................KP.TPFLCLAFKM.LQLAPERE..........IVL.EYLNftdpgsdaedad..............................gepnengavvkaRGDFK..YLRALAAF....Y...I.....RLTFD........................PVDV....YK.TLE.....PL..LLDYR.KLRRRMRDH...................-----....-YVLTTMDQFVD.DLL.......TKDRV...CG..T..SLWKLPSRQQLEDL-d....................................................................
A0A091RT37_9GRUI/1-134                 ............................................lla----------------------..-.--.----------................................-ELVVDKAME-..LKYVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.RLL.......HEERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
E2QU96_CANLF/10-175                    ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A0A2KNT9_PENIT/21-204                ..............................................l--VRGVNPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..MTSIGG..............-TYG.VSE.............................................KP.TPFLCLAFKL.LQLGPDRD..........VIL.ELLNytdpgsgdea..................................enpddalvkdRGDFK..YLRALAAF....Y...V.....RLTFD........................PVDV....YK.TLE.....PL..LLDYR.KLKRRVRDT...................-----....-FTLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKLPPRAQLEDL-d....................................................................
A0A183EQT3_9BILA/10-58                 .............................................vt--VKGTNPQYLVEKIIRTRIYD..S.KY.WKEECFALTG................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------tmlltnfclnipll.......................................................
F7ISR6_CALJA/47-92                     ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIY--..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------fk...................................................................
C5LME5_PERM5/21-137                    ............................................lql----TNTTTYNYPQMLHQQLAK..S.AY.YH-SIQPLDT................................PEAIIDEIKTR..CKDAEP..............YAPG.SHT.............................................AP.STMFCCLYRL.FVMRINSK..........VLG.QLIN......................................................YHGAP..YVRCAGFL....Y...V.....RFGLS........................PRDY....WS.FLQ.....PH..L----.---------...................-----....------------.---.......-----...--..-..---------------l....................................................................
G3NPB2_GASAC/10-174                    ..............................................n-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LKYVGG..............-VFG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..NVRLLGAM....Y...M.....RLTGT........................AVDC....YK.YLE.....PL..YNDYR.KEKNQNRNG...................-----....EFELMHVDEFID.ELL.......HAERM...CD..I..ILPRLQRHV-LE---eae..................................................................
A0A0D3BZE4_BRAOL/4-168                 ..............................................i-QTNGRAYESLLEKVLSMNIVS..S.DY.FK-ELYGLKT................................YHEVIDEIYNQ..VSHVEP..............WMGG.NCR.............................................GP.STAYCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HTDSP..YIRAVGFL....Y...L.....RYVAD........................AKTL....WT.WYE.....PY..IKDDE.---------...................EFAPG...sNGRTTTMGVYVR.DLL.......LGLYY...FD..T..LFPRIPVPVMR----qivs.................................................................
W5QC53_SHEEP/39-223                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
J4G8D4_9APHY/10-193                    ..............................................q-AIHGQNPQFLVETVIRNRIYE..S.PY.WKEHCFALTGmhilmyarn.............trdglmnefpAETLIDKALE-..LNSIGG..............-VYG.N-Q.............................................KP.TEFLCLLLKL.LQIQPEKE..........ILL.EYLR......................................................ADEFK..YMRALAAI....Y...I.....RMTFT........................SIDV....YE.ILE.....PL..LKDYR.KLRYRGMNG...................-----....-YSLTHMDEFVD.NLL.......IDERV...CD..I..ILPRLTKRDVLEDN-q....................................................................
F7VQJ3_SORMK/24-191                    ............................................lap---NGLNPATIMEKAVRERIID..S.YF.YKEQCFGVNE................................-ADIVDRVVEH..VDYIGG..............-VAG.TVQ.............................................KP.TPFLCLAFKL.LQLAPSDD..........ILN.EYLQf....................................................gGEKFK..YLRALALF....Y...I.....RLTRK........................DHDV....YK.TLE.....PF..LEDRR.KLRRKGRNG...................-----....-TSLTYMDVFVD.DLL.......TKDRV...CA..T..SLWKMRKRDILEDL-d....................................................................
A0A0R3R2G3_9BILA/1-84                  ...............................................----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.-MIN......................................................NSDSP..YIRGIGFM....Y...I.....RFCQP........................PQDL....WA.WME.....PY..LDDEE.---------...................QIDPRs..gGGDVMVMAQVVK.MML.......TKLDW...YG..T..LFPRIPVPIQKEI--el...................................................................
C4JLP1_UNCRE/21-208                    ..............................................l--IRGVNPATLFEKAVRDRITD..S.YY.WKEQCFALNA................................-ATLCDRAVE-..LSYIGG..............-TYG.ANQ.............................................KP.TPFLCLAFKL.LQLAPEKE..........VVL.EYLNfhdpaaddddvd..............................eeggdgaavlkaVGDFK..YLRALAAF....Y...I.....RLTFD........................PVEA....YT.VLE.....PL..LSDYR.KLKRRTKDG...................-----....-FVLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKLPARRVLEDL-d....................................................................
H2N6K2_PONAB/47-231                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
A0A091T598_PHALP/10-175                ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LKYVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HEERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A078A1R7_STYLE/10-175                ...............................................KQIHGTNPQFLIDTVMRKNIHN..D.PY.YKEKCFALTA................................-ETLVDRAIE-..LKYVGG..............-TYG.GNS.............................................RP.TKFMCLILKM.LQIQPDTD..........IVL.EFIK......................................................NTDYK..YIRLLGAF....Y...W.....RLTAK........................GQDV....FK.VLE.....PI..YSDYR.RVAFRKKDG...................-----....QFEAMHIDEFID.HLI.......RDEIF...CD..V..SFPRINKRHVYEED-n....................................................................
L1LC98_THEEQ/10-175                    .............................................nm--VHGTNPQYLFSKIMRDKVYN..S.IY.WKESCFGLTS................................-ESIIDKAIE-..IEYIGG..............-TFG.GNR.............................................QP.SPFICLVLKL.LQIQPELD..........IVE.EYIK......................................................NEDYK..YLRALGVY....Y...L.....RLVGD........................PVRV....YK.TLE.....PL..LSDYR.RLRFRGPDG...................-----....SYTIKHMDEFVD.DCL.......RSSTY...LD..V..DLPPLAKRINLENS-n....................................................................
A0A0V0XEY1_TRIPS/10-175                ..............................................a-SLKGTNPQYLIEKVTRSRIYD..S.RY.WKEECFALSA................................-ELLVDRGME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLLLKM.LQIQPEKD..........IVI.EFIR......................................................QEDSK..YIRALGAL....Y...L.....RMTFS........................YVEV....YK.YLE.....PL..LNDYR.KLRWINKQG...................-----....KFELIHMDEFVD.KLL.......REERF...CD..V..QLPRLQKRALLEET-n....................................................................
A0A0R3U8G8_9CEST/10-175                ..............................................h-TLHGTNPQYLIEKIIRSRIYE..C.QF.WKEHCFALTS................................-ELLVDKAVE-..LKYVGG..............-TYS.GLN.............................................KP.TPFLCLVLKM.LQIQPDKD..........IVI.EFIK......................................................QEDYK..YARALGAF....Y...L.....RLVGE........................SVEI....YK.YLE.....AL..YNDFR.KLKQQDTAG...................-----....KFSIIRMDEFID.QLL.......NEERV...CD..V..ILPRLQKRSVLEDN-n....................................................................
F4P219_BATDJ/9-173                     ...............................................KNIHGTNPQFLIEKILRERIYE..S.AY.WKEKLFGVSA................................-ETLLDRAVE-..LQAIGG..............-QFG.SQ-.............................................KP.TEFICLALKI.LQLQPDDE..........IIT.LFLT......................................................NSDFK..YLTALAAF....Y...I.....RLTES........................HSQV....YR.RLE.....PL..LQDRR.KLRRRTNVG...................-----....GYELTFMDQFIS.DLL.......LEDRM...CD..T..ILPRLTKRYILEDQ-g....................................................................
G2PZZ7_MYCTT/24-191                    ............................................lap---NGLNPATIMEKAVRERIVE..S.YF.FKEQCFGVNE................................-ADIVDRVVEH..VDHVGG..............-VTG.TSQ.............................................RP.TPFLCLAFKL.LQLAPGDD..........ILD.EYLHf....................................................gGDKFK..YLRALAAF....Y...I.....RLTRP........................DRDV....YI.RLE.....PF..LEDRR.KLRKKGRNG...................-----....-TTLTYMDEFID.DLL.......TKDRV...CS..T..SLWKMRRRDILEDL-d....................................................................
A0A0V0WDJ5_9BILA/541-724               ..............................................l-NFWGNKETMNLNHLVLENIVS..S.PY.YKNTLLPLKT................................HFEVIDEIYYN..VEHLEP..............WEKG.TRKttgqtgmcg...........................gvrgvgaggVV.SSAFCLLYKL.FTLKLTRK..........QLT.AILN......................................................HPDSC..YIRGLGFM....Y...I.....RFCLH........................PATF....WS.WYE.....PY..FDDSE.---------...................EIDPKa..gGGDLMTIGEMVK.SLL.......TKLDW...YS..T..LFPRIPVPIQKEI--d....................................................................
A0A0D2R045_GOSRA/3-166                 .......................................iqtcgkpi--------DSLLEKVLCMNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYAAD........................PKTL....WS.WFE.....PY..IKDEE.---------...................EFSPG...sSGRMTTMGVYVR.DLL.......LGQYY...FD..T..LFPRIPVPVL-----rqvt.................................................................
A0A0R3PB76_ANGCS/1-106                 ...............................................---------MNLNGLVLENVKE..S.YY.YKNHLVEIDS................................AQQLLDEVFYK..VKHLEP..............WEKG.TRKvqgmtgmcggv......................slilvrgvgaggVV.SSAFCLLYRF.FKVRLTRK..........QLI.SMIN......................................................SRD--..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------dee..................................................................
A0A0H2S7A6_9HOMO/10-173                ..............................................l-AIHGQNPQFLIETVIRNRIYE..A.QF.WKEQCFALTA................................-ESLIDKAIE-..VKYIGG..............-VYG.NQR.............................................-P.TEFMCLLLKL.LQIQPEKE..........ILI.EYLR......................................................AEEFK..YLRALAAI....Y...I.....RLTFS........................AVEV....YE.ILE.....PL..LKDYR.KLRMRSMAG...................-----....-YTLTYMDEFVD.ELL.......HEERV...CD..T..IMPRIPKREVLEE--tg...................................................................
A0A0W7VHJ3_9HYPO/26-193                ............................................lap---NGLNPATIMEKAVKDRIVD..S.YF.YKEQCFALNE................................-ADIIDRVVEH..VNFIGG..............-THG.ASQ.............................................KP.SPFLCLAFKL.LELAPSDA..........IIQ.EYLSy....................................................gGEHFK..YLRALACF....Y...V.....RMTRQ........................AKDV....YT.TLE.....PF..LQDRR.KLRRKARAG...................-----....-TSLTFVDDFVD.DLL.......NKDRV...CA..T..SLWKMPKREVLEDL-e....................................................................
A0A044QM65_ONCVO/10-175                .............................................vt--VKGTNPQYLVEKIIRTRIYD..S.KY.WKEECFALTA................................-ELLVDKGME-..LRYIGG..............-IYA.GNV.............................................KP.TPFLCLCLKM.LQIQPEKD..........IAV.EFIR......................................................QEEYK..YIRALGAM....Y...I.....RLTFT........................SIEV....YK.YLE.....PL..YNDYR.KLRMMNNEG...................-----....RFEIVHMDEFID.NLL.......REERY...CD..I..HLPRIQKRITLEE--vg...................................................................
E9EAI6_METAQ/24-191                    ............................................lap---NGLNPATIMEKAVKDRIVE..S.YF.YKEQCFALNE................................-ADIVDRVVEH..VSFVGG..............-THG.DAQ.............................................KP.SPFLCLAFKL.LELGPSED..........VVR.EYLSy....................................................gGEHFK..YLRALACF....Y...Y.....RLTRK........................AADV....YR.TLE.....PF..LDDRR.KLRRKGRRG...................-----....-TSLTYVDDFVD.DLL.......TRERV...CA..T..SLWKMPPREILEDL-d....................................................................
W9QWY7_9ROSA/10-174                    ...............................................KSIRGTNPQNLVEKIVRSKIYQ..N.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHVGG..............-TFG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKE..........IVI.EFIK......................................................NDDYK..YVRVLGAF....Y...L.....RLTGS........................DTDV....YQ.YLE.....PL..YNDYR.KIRRKLADG...................-----....NFSLTHVDEVID.ELL.......TKDYS...CD..I..ALPRIKKRWTLE---si...................................................................
K3VWG0_FUSPC/26-192                    .............................................ap---NGLNPATIMEKAVRDRIVD..S.IY.YKMQCFACNE................................-ADIVDRVVED..VKFIGG..............-TYG.TTQ.............................................VP.SPFLCLAFKL.LELSPSDA..........VLL.EYLKf....................................................gGEAFK..YLRALACF....Y...F.....RLTRQ........................AKNV....YE.MLE.....PF..LEDRR.KLRRRGREG...................-----....-VKLSYMDEFVD.DLL.......TKERV...CG..T..SLWKMPKREVLEDL-e....................................................................
S9VFC1_9TRYP/46-244                    .............................................wn--LQGRSAFAVLDPTTRHRIAH..A.HN.MT-RCRDQPL................................-LWVLEELIT-..IESVGG..............-LSG.PLF.............................................RV.EYFLCLVARV.LQAAPDPA..........VVL.ALLR......................................................QDVHK..YLRVAALF....M...I.....RLIGN........................VAMQ....KE.AVR.....VG..WDDYR.KIRVYGDEG...................EVD--....------------.---.......-----...--..-..---------------yvfdatlrgrkxpreaaegeqppvnieeakpahyfilcmdeltdrlfrvdsdgekrsqffgvplpplmf
A0A0L0SI27_ALLMA/324-483               ............................................ggl--------QLKVEKIVRSRIYE..T.LF.WKEECFGLTA................................-ETIVDKAVE-..LDHIGG..............-QYG.TQ-.............................................TP.TKFLCLVLKL.LQIDPSYD..........IVL.EYIR......................................................DPEFK..YLRALGAF....Y...L.....RLTAN........................SLQC....YE.ELE.....PL..LVDYR.KLRFRQPTG...................-----....AYALTTMDQFVD.GLL.......REERL...CD..I..ILPRIQKRHVLEDK-g....................................................................
G1LCH7_AILME/47-231                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
A0A093CLS2_TAUER/5-189                 ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLC.SFL.......TKLEW...FS..T..LFPRIPVPVQKTI--dq...................................................................
A0A0G4F474_VITBC/149-314               ............................................vem----TNPTTFNLNTLLRENILS..S.EY.YK-SLFALKQ................................FHEVVDEIYQY..ADHADP..............YCAG.NSR.............................................AP.STLFCCLYKF.FTMRLTEK..........QVK.SLLD......................................................HQDSP..YIRACGFL....Y...L.....RYILD........................PQKL....WK.WYE.....PY..FLDDE.---------...................EFAPGt..dKNKKMEMGQFVE.SLI.......TEDKYgshSS..T..VLPRLPVKIKT----qy...................................................................
K7IUN1_NASVI/10-175                    ...............................................KSIRGTNPQYLVEKIIRSRIYD..S.KY.WKEECFALTA................................-ELLVDKAME-..LRFIGG..............-VFG.GNI.............................................KP.TPFLCLILKM.LQIQPEKD..........IIV.EFIK......................................................NEEFK..YVRALGAF....Y...M.....RLTGT........................SLDC....YR.YLE.....PL..LNDYR.KLRKQNRQG...................-----....QFEIIHVDEFID.DLL.......RAERC...CD..I..ILPRIQKRHVLEEN-n....................................................................
V2XVC5_MONRO/10-173                    ..............................................k-AIHGQNPQFLVETVIRNRIYE..S.SY.WKEHCFALTA................................-ESLIDKAIE-..LKCIGG..............-VYG.NQR.............................................-P.TEFLCLLLKL.LQIQPEKE..........ILI.EYLQ......................................................ADEFK..YLRALAAM....Y...I.....RMTFG........................AAEV....YQ.ILE.....PL..LKDYR.KLRLRNMTG...................-----....-YILTFMDEFVD.SLL.......TEERV...CD..I..ILPRLIKRQVLEEN-g....................................................................
C3ZRP3_BRAFL/7-191                     ..............................................l-PLWGNDKTMNLNSLILTNIQS..S.PY.FKNDLFQLKT................................YHEVIDEIYYK..VQHLEP..............WEKG.SRNtggqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.FTLKLTRK..........QVN.GLLQ......................................................HGDSP..YIRGLGFM....Y...I.....RYTQP........................PADL....WE.WYE.....PY..IDDDE.---------...................ELDVKa..gTGCMMTVGEMLR.SFL.......GKIEW...FS..T..LFPRIPVPIQKD---leg..................................................................
A0A0K9PSL8_ZOSMR/10-175                ...............................................KSIHGTNPQNLVEKIVRSKVYQ..H.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHLGG..............-TYG.GTR.............................................KP.TPFICLVLKM.LQIQPEKE..........IVV.EFIK......................................................NEDHK..YVRVLGAF....Y...L.....RLTGT........................VMDV....YQ.YLE.....PL..YNDYR.KIRRKQADG...................-----....KFSLTRVDEFMD.ELL.......TTDYS...CD..I..ALPRVQKRWVLEQ--ag...................................................................
A0A096MX21_PAPAN/48-232                ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
D0NHN2_PHYIT/9-173                     ..............................................q-SVHGVNPQTLVEKIMRNRIYA..S.IY.WKEQCFGLTA................................-ETLVDKAVE-..LQEFGG..............-TFG.GNQ.............................................QP.THLLCLLLKM.LQLQPELE..........VVK.QFIE......................................................NEDYK..YVTVLGAV....Y...L.....RLVGK........................PLEV....YT.LLE.....PL..LSDYR.KIRKRNVIG...................-----....-WEITHVDEIAD.ALL.......NEEYY...ID..L..ALPRLVERELLEKS-d....................................................................
A8PRE0_MALGO/10-174                    ..............................................q-AIHGTNPQFLVERVIRSRIYD..S.TY.WKQDCFALNA................................-ATLIDKAVD-..LTYVGG..............-TYG.AQR.............................................-P.SPFLCLILKL.LQIQPERA..........IVL.EYLA......................................................AEDFK..YLRAVAAL....Y...V.....RLTFP........................AIEV....YE.LLE.....PM..LNDYR.KLRWRDMAG...................-----....NYSLTHMDEFID.QLL.......TEERV...CE..L..ILPRLTKRSVLESN-d....................................................................
A0A194PYC3_PAPXU/10-175                ...............................................KSIRGTNPQYLVEKIIRSRIYD..C.KY.WKEECFALTA................................-ELLVDKAMA-..LRYIGG..............-VHG.GFI.............................................YP.TPFLCLVLKM.LQIQPEKD..........IVV.EFIK......................................................NEEFK..YVRALGAF....Y...M.....RLTGT........................SVDC....YK.YLE.....PL..YNDNR.KLRRQNRQG...................-----....QFEIVHMDEFID.ELL.......REERL...CD..V..ILPRIQKRHILEEN-n....................................................................
PRP38_SCHPO/14-177                     ............................................eaa---HEMLPTFLIGKILRERIVD..S.IY.WKEQCFGLNA................................-CSLVDRAVR-..LEYIGG..............-QYG.NQR.............................................-P.TEFICLLYKL.LQIAPEKE..........IIQ.QYLS......................................................IPEFK..YLRALAAF....Y...V.....RLTWD........................DVEV....HQ.TLE.....PL..LRDYR.KLRIRTNSE...................-----....-IRLTYLDEVVD.DLL.......NAEVV...CD..I..SLPPLRSRLQLEDL-d....................................................................
W7AJL3_PLAVN/162-324                   ............................................iem----TNTSTYNVNNLLRNNILS..S.EY.FR-SLISLKT................................FKEVLDEILSY..ADHVEP..............YCIG.STR.............................................AP.STLFCCLYKF.FTMQLTKK..........QLK.SLID......................................................NKESC..YVRACGFL....Y...L.....RYVHC........................PSNL....WM.WFE.....PY..MLDDD.---------...................EFTVSa..dKRKLMTIGEYVQ.SLL.......YDDKY...FN..T..VLPRLPIKIK-----niy..................................................................
A0A093QAV3_PHACA/1-115                 ...............................................----------------------..-.--.----------................................-----------..------..............--YG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HEERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
G4V8E6_SCHMA/26-210                    ..............................................l-KLWGNPQTMNLNTMIYTNIVQ..S.PY.FKANLVELKT................................YHEVIDEIYYK..VEHLEP..............WERG.SRRigvqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.FTLKLTRK..........QLK.GLLD......................................................HPDSP..YIRALGFM....Y...I.....RYCIP........................PEDF....WW.WYS.....PY..WSDSE.---------...................ELDVKa..gGGCIMTIGNMLE.HWL.......TKLDW...FS..T..LFPRIPVPVQKK---lee..................................................................
A0A0E0QMP1_ORYRU/10-175                ...............................................KSIHGTNPQNLVEKIVRSKIYQ..S.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHTGG..............-TYG.GNR.............................................KP.TPFLCLALKM.LQIQPDKD..........IVV.EFIK......................................................NEDYK..YVRVLGAF....Y...L.....RLTAT........................VADV....YQ.YLE.....PL..YNDYR.KIRHKLSDG...................-----....KFTLTHVDEFID.DLL.......TKDYS...CD..T..ALPRIQKRWVLET--sg...................................................................
Q5CUQ1_CRYPI/3-168                     ..........................................neqns-----HHKLFSVSSILRDRVFS..S.IY.WKGECFALDS................................-ETILDKAVL-..LDYIGT..............-TYG.GDR.............................................KA.TPFLCLLVKL.LQIRPSTE..........IVL.EYIN......................................................NPRFK..YLTALGIV....Y...L.....RLTES........................SIVI....HK.SIE.....HL..YQDYR.RIRIRNLDG...................-----....SFDIIHLDELVE.ICL.......CEKKF...LD..L..DFPYIHKRAVLVK--qg...................................................................
A0A167L4L6_9HYPO/24-191                ............................................lap---NGLNPANIMEKAVKDRITD..S.YF.YKEQCFALNE................................-ADIVDRVVEH..VRFIGG..............-TSG.TTQ.............................................KP.SPFLCLAFKL.LELSPSDA..........VLA.EYLAy....................................................gGEHFK..YLRALACF....Y...L.....RLTRQ........................AKDV....YE.TLE.....PF..LADRR.KLRRKGRER...................-----....-TTLTYMDEFVD.ELL.......TKDRV...CA..T..SLWKMPKREILEDL-e....................................................................
C1MPU3_MICPC/21-182                    ............................................qal----DNGKSYNMEKVLRTNILA..S.DY.FS-QLVKMND................................FYELVDEIYNE..VDHVEP..............WMSG.NAR.............................................GP.STAFCLLYRL.FTMEIEDN..........EVK.HLIN......................................................HGDSP..YIRALGFL....Y...V.....RYARD........................PKEF....GR.WFD.....EF..LRDEE.---------...................EFSPS...pHGKSVTMGAFVR.DLI.......LDQYY...FE..T..IFPRIPEV-------srral................................................................
A6QTF5_AJECN/41-234                    ..............................................l--IRGVNPATLFEKAVRDRITE..S.YY.WKEQCFGLNA................................-ATLCDRAAE-..LSYIGG..............-TYG.LAQ.............................................KP.TPFLCLAFKL.LQLAPEKD..........IVL.EYLNfhdpenghvegsemn........................gsegeqggasgvvkaVGDFK..YLRALAAF....Y...I.....RLTFD........................AADI....YK.SLE.....PL..LTDYR.KLKRRMKDG...................-----....-FVLTYIDQFVD.DLL.......TKDRV...CG..T..SLWKLPSRHQLEDL-d....................................................................
A0A0K0JRM4_BRUMA/47-231                ..............................................l-PLWGNTQTMNLNALVLENIIQ..C.TY.YKNYLAETTG................................FQQLTEEIYYS..VKHLEP..............WERG.TRKtqgmtgmcg...........................gvrgvgaggVV.STAFCLLYKL.FTIRLSRK..........QLV.SMIN......................................................NSDSP..YIRGIGFM....Y...I.....RFCQP........................PQDL....WA.WME.....PY..LDDEE.---------...................QIDPRs..gGGDVMVMAQVVK.MML.......TKLDW...YG..T..LFPRIPVPIQKEI--el...................................................................
C7YSE8_NECH7/25-192                    ............................................map---NGLNPATIMEKAVKDRIVD..S.YF.YKEQCFALNE................................-ADIVDRVVEH..VSFIGG..............-TYG.VTQ.............................................KP.SPFLCLAFKL.LELAPSDA..........VMH.EYLHy....................................................gGDEFK..YLRALACF....Y...F.....RLTRQ........................AKDV....YE.MLE.....PF..LEDRR.KLRRRGRDG...................-----....-VALTYMDEFVD.DLL.......VKDRV...CG..T..SLWKMPKRETLEDL-e....................................................................
F9F8Y6_FUSOF/26-192                    .............................................ap---NGLNPATIMEKAVKDRIVD..S.YF.YKEQCFALNE................................-ADIVDRVVEH..VNFIGG..............-TYG.VTQ.............................................KP.SPFLCLAFKL.LELSPSDA..........VLM.EYLKy....................................................gGEAFK..YLRALACF....Y...F.....RLTRQ........................AKDV....YE.MLE.....PF..LEDRR.KLRRRGRAG...................-----....-VVLTFMDEFVD.ELL.......TKERV...CG..T..SLWKMPKREVLEDL-e....................................................................
W9YRJ2_9EURO/20-185                    ..............................................l--VRGQNPALLFETPMRDRITD..S.LY.WKEQCFGLNA................................-ATLCDRAIE-..LNYLGG..............-TYG.VAM.............................................KP.TPFICLAFKL.LTLVPDKE..........IIL.EYLNn....................................................gGEEWK..YLRALAAF....Y...V.....RLTFD........................PADV....YK.TLE.....PL..LEDLR.KLRLRRKET...................-----....-YELIHMDEFVD.NLL.......TKERV...CG..T..SLWKLPARQLLEDL-d....................................................................
W4ZDU0_STRPU/160-344                   ..............................................l-PLWGNQVSMNLNPLILTNIQS..S.PY.FKNDLFKLKT................................YHEVIDEIYYK..VAHLEP..............WERG.SRQtsgqigmcg...........................gvrgvgaggIV.SSAYCLLYKL.YTLKLTRK..........QLN.GLLT......................................................HSDSS..YIRALGFL....Y...I.....RYSQP........................PQDL....WD.WYE.....EY..LNDEE.---------...................EVDTKa..gGGNCIPIGQMLM.HFL.......VKLEW...HS..S..LFPRIPVPVMKDI--er...................................................................
S7MIS8_MYOBR/56-199                    ...........................................gsqv----------------------..-.--.----------................................---------E-..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
A0A093CGG2_9AVES/10-194                ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKAI--dq...................................................................
S3DD72_GLAL2/21-188                    ............................................lap---NGLNPATIMEKPVRERIID..S.YF.WKDQCFAVNE................................-ADIVDRVVTH..VKFIGG..............-TYG.DAQ.............................................RP.SPFLCLAFKL.LQLGPGDD..........ILR.EYLEy....................................................gGEKFK..YLRALACF....Y...I.....RLTRQ........................AKDV....YL.FLE.....PY..LEDRR.KLKQKKRMG...................-----....-TALTYMDQFVD.DLL.......EKDRI...CA..T..TLWKMPKREVLEDL-e....................................................................
A9P852_POPTR/3-167                     .............................................vq--TNGKPIDSLFEKVLCMNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDNVEP..............WMTG.NCR.............................................GP.STSFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HKDSP..YIRAVGFL....Y...L.....RYAGD........................PKTL....WN.WFE.....PY..IKDDE.---------...................EFSPG...sSGRKTTIGIYVR.DLL.......LGQYY...FD..T..LFPRIPVPVLR----qita.................................................................
A0A0B1T4B6_OESDE/60-111                ..............................................l-PIWGNQQTMNLNGLVLENVKE..S.YY.YKNHLIEIES................................AQQLLDEVFYK..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------snrksn...............................................................
A0A0D3H3F8_9ORYZ/10-175                ...............................................KSIHGTNPQNLVEKIVRSKIYQ..S.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHTGG..............-TYG.GNR.............................................KP.TPFLCLALKM.LQIQPDKD..........IVV.EFIK......................................................NEDYK..YVRVLGAF....Y...L.....RLTAT........................VADV....YQ.YLE.....PL..YNDYR.KIRHKLSDG...................-----....KFTLIHVDEFID.DLL.......TKDYS...CD..T..ALPRIQKRWVLET--sg...................................................................
A0C3P9_PARTE/86-247                    ..............................................i-PIRGENAISNMNSLVRQNILT..C.PY.YK-ELLQIRD................................INDIVTETDKI..VTSVGT..............WAG-.-PG.............................................VP.SSFFCILHKL.MSMNLNVK..........QLQ.ILCD......................................................WKLNP..YVRCLGLL....Y...L.....RYSLD........................PNFL....WG.WMK.....RY..ILDEQ.---------...................EFKPS....KDEDITIGDFCE.RLL.......TDLNY...YN..T..RLPRIPQQIDT----iiqa.................................................................
A0A024TF87_9STRA/1-98                  ...............................................----------------------..-.--.----------................................-----------..------..............----.---.............................................--.-------MKF.CTMRLTIN..........QMQ.GLLK......................................................HVDSP..YIRCVGFL....Y...L.....RYTCD........................PELL....WE.WYE.....PY..LGDDE.---------...................EFNASs..nDAIRTTMGAWIR.SLL.......EDINY...FN..T..ILPRIPKKIQ-----dgik.................................................................
G0S1D3_CHATD/24-191                    ............................................lap---NGLNPATIMEKAVRERIVE..S.YF.WKEQCFGVNE................................-ADIVDRVVEH..VRFVGG..............-VTG.VTQ.............................................KP.SPFLCLAFKL.LQLAPGDD..........ILK.EYLYf....................................................gGEKFK..YLRALAAF....Y...I.....RLTRP........................DKEV....YT.LLE.....PF..LEDRR.KLRRKGKNG...................-----....-TSLTYMDEFID.DLL.......TKDRV...CS..T..SLWKMRRRDILEDL-d....................................................................
#=GR G0S1D3_CHATD/24-191         SS    ............................................--T---TSS-HHHHS-HHHHHHHHH..S.HH.HHHHSTT--H................................-HHHHHHHHHH..-SSBSS..............-EET.TTT.............................................EE.-HHHHHHHHH.HHH---HH..........HHH.HHHHH....................................................HHHH-H..HHHHHHHH....H...H.....HHHS-........................HHHH....HH.HHG.....GG..GG---.EEEEEESSS...................-----....-EEEEEHHHHHH.HHH.......H-SEE...TT..E..E------HHHHHHT-T....................................................................
H9JEJ8_BOMMO/23-207                    ..............................................l-PIWGNEQTMNLNPLILANIQG..S.SY.FKVHLFKLKT................................YHEVVDEIYYQ..VKHLEP..............WERG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAFCLLYKL.YTLRLTRK..........QVN.GLLQ......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PADL....FD.WYV.....DY..FEDEE.---------...................EVDPRa..gGGASTTIGALVR.QML.......VKLDW...FS..T..LFPRIPVPIQKQIE-q....................................................................
E3QPI7_COLGM/24-191                    ............................................lap---NGENPATIMEKAVRERIID..S.YF.YKEQCFAVNE................................-ADIVDRVVEH..VSFIGG..............-TYG.VTQ.............................................KP.TPFLCLAFKL.LQLAPSDA..........VLE.TYLGf....................................................gGDKFK..YLRALACF....Y...I.....RMTRK........................PRDV....YL.LLE.....PF..LEDRR.KLRRKGRQG...................-----....-ASLTYMDDFVD.DLL.......TKTRV...CA..T..SFRELPKRSDLVD--ld...................................................................
K7GHE6_PELSI/10-175                    ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LRYVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
Q0DKA8_ORYSJ/3-101                     ............................................iqt---SGKPIDLLMEKVLCMNIMS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAVS--....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------slp..................................................................
W6UMV2_ECHGR/10-175                    ..............................................h-TLHGTNPQYLVEKIIRSRIYE..C.QF.WKEHCFALTS................................-ELLVDKAVE-..LKYIGG..............-TYG.GLT.............................................KP.TPFICLVLKM.LQIQPDKD..........IVI.EFIK......................................................QEDYK..YARALGAF....Y...L.....RLVGE........................SVEI....YK.YLE.....AL..YNDFR.KLKQQDTTG...................-----....KFSIVRMDEFID.QLL.......NEERV...CD..V..ILPRLQKRSVLEDN-n....................................................................
J9EVG5_WUCBA/10-175                    .............................................vt--VKGTNPQYLVEKIIRTRIYD..S.KY.WKEECFALTA................................-ELLVDKGME-..LRYIGG..............-IYA.GNV.............................................KP.TPFLCLCLKM.LQIQPEKD..........IAV.EFIR......................................................QEEYK..YIRALGAM....Y...I.....RLTFT........................SIEV....YK.YLE.....PL..YNDYR.KLRIMNNEG...................-----....RFEIVHMDEFID.NLL.......RDERY...CD..I..HLPRIQKRITLEE--vg...................................................................
A0A096LYD0_POEFO/28-178                ..............................................l-PLWGNEKTMNLNPMILTNVLS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHIEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....LD.WYN.....DF..LDDEE.---------...................-----....------------.---.......-----...--..-..---------------mplvqqvnwil..........................................................
A0A044STF6_ONCVO/47-231                ..............................................l-PLWGNTQTMNLNALVLENIIQ..C.TY.YKNYLSETTG................................FQQLTEEIYYS..VKHLEP..............WERG.TRKtqgmtgmcg...........................gvrgvgaggVV.STAFCLLYKL.FTIRLSRK..........QLV.SMIN......................................................NSNSP..YIRGIGFM....Y...I.....RFCQP........................PQDL....WA.WME.....PY..LDDEE.---------...................QIDPRs..gGGDVMAMAQVVK.MML.......TKLDW...YG..T..LFPRIPVPIQKEI--el...................................................................
A0A0L0CFU8_LUCCU/10-175                ...............................................KNIHGTNPQYLIEKIIRSRIYD..S.KY.WKEQCFALTA................................-ELLVDKAME-..LRYIGG..............-VYG.GNI.............................................KP.TQFLCLTLKM.LQIQPEKD..........IVV.EFIK......................................................NEEFK..YVRALGAF....Y...L.....RLTGS........................ALDC....YK.YLE.....PL..YIDNR.KLRRQNRVG...................-----....QYEIVYMDEFID.ELL.......RSDRV...CD..I..ILPRIQKRSVLEEN-n....................................................................
M0W6M8_HORVD/1-69                      ...............................................----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...L.....RLTGT........................VADV....YQ.YLE.....PL..YNDYR.KIRQKLSDG...................-----....KFTLTHVDEFID.ELL.......TKDYS...CD..T..ALPRIQKRWVLEA--sg...................................................................
G0NBD0_CAEBE/55-239                    ..............................................l-PIWGNQVTMNLNTLVLENIRE..S.YY.YKNNLVEIDS................................FQTLVEQIFYQ..VKHLEP..............WEKG.TRRlqgmtgmcg...........................gvrgvgaggVV.SSAYCLLFRL.FNLRISRK..........QLI.SMLN......................................................SRQSV..YIRGIGFM....Y...I.....RYTQP........................PADL....WY.WLE.....PY..LDDDS.---------...................EIDPRs..gGGDLMSFGQMVR.TMI.......NKLDW...YG..T..LFPRIPVPIQKEID-e....................................................................
PR38A_PONAB/10-175                     ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A183RI45_9TREM/33-164                .........................................fifyfv----------------------..-.--.-------LSK................................AELLVDKAVE-..LRYVGG..............-VYS.GSV.............................................KP.TPFLCLTLKM.LQIQPDKD..........IVI.EFIK......................................................QE--P..YKLVCGS-....-...-.....-LVGD........................SVEI....YK.YLE.....TL..YNDFR.RLKFQDKMG...................-----....NFSLIYMDDFID.QLL.......TEERV...CD..V..ILPRXX---------xxxxxx...............................................................
Q6C616_YARLI/15-178                    ..............................................l-SIHGINPALLIEKIIRERIFE..T.LY.WKELCFNLNA................................-ATLCDRAAT-..LTAIGG..............-QY-.ANQ.............................................KP.TPFLCLVFKL.LQIQPSHD..........IIM.EYLN......................................................QKEFK..YLRAVAAF....Y...I.....RLAYP........................PVKI....YT.LLE.....PL..LGDYR.KLRFRNMGG...................-----....-VTLTYMDQFID.DLL.......HEERV...CD..I..ALPRLPKRLTLEDA-e....................................................................
A0A0B1P5C4_UNCNE/21-188                ............................................lap---NGLNPATIMEKPVRERIVD..C.YF.WKDQCFAVNE................................-ADVVNRVVQS..VNFIGG..............-TYG.DSQ.............................................RP.SPFLCLAFKL.LQLSPSDE..........ILQ.EYLQy....................................................gGEKFK..YLRALALF....Y...I.....RLTRQ........................PKNI....YE.ILE.....PY..LSDYR.KLRKRSRIG...................-----....-TSLTYMDVFVD.DLL.......TKDRV...CG..T..TLWKIPKRTVLEDL-e....................................................................
A0A0V0R8K3_PSEPJ/2167-2332             ..............................................f-KVQGNNPTGNMNNRLSNAILS..N.EY.FK-SLYSLKT................................FHEVIDEMQKS..ATHAQP..............WTLG.GVG.............................................VP.SSFFCCLYKF.MTQKLTIK..........QVK.ALID......................................................YKLNS..MVRLAGFL....Y...I.....RYCSD........................SELL....WA.WLK.....KY..LLDDD.-IARPEYNQ...................-----....-SVEYNMGEYVE.RLL.......MDYDY...YG..T..RLPRIPVKIENK---ika..................................................................
Q5KIE6_CRYNJ/9-172                     ..............................................t-AVHGSNPQYLIEKVIRARIYD..S.LY.WKEHCFALTA................................-ESIIDKAID-..LRAIGG..............--VT.DRQ.............................................TP.TPFICLVLKL.LQLQPEKE..........ILI.EYLL......................................................AEEFK..YLRALAAF....Y...V.....RLTFR........................SLEV....YE.ILE.....PL..MKDYR.KLRVVHAGG...................-----....-YSLTHFDEFID.ELL.......TQERV...CD..I..ILPRLTQRSVLEET-e....................................................................
M4C7M0_BRARP/10-175                    ...............................................KNIRGTNPQNLVEKIVRTKIYN..H.TF.WKEQCFGLTA................................-ETLVDKAME-..LDHVGG..............-TFG.GNR.............................................KP.TPFLCLILKM.LQIQPEKE..........IVV.EFIK......................................................NDDYK..YVRILGAF....Y...L.....RLTGS........................DVDV....YR.YLE.....PL..YNDYR.KVRQKLSDG...................-----....RFSLTHVDEVIE.ELL.......TKDYS...CD..I..AMPRLKKRWTLEQN-g....................................................................
A0A0N4VL93_ENTVE/10-174                ..............................................a-TVKGTNPQYLVEKIIRTRIYD..S.KY.WKEECFALTA................................-ELLVDKGME-..LRYVGG..............-IYA.GNV.............................................KP.TPFLCLCLKM.LQIQPEKD..........IIV.EFLR......................................................QEEYK..YIRALAAM....Y...L.....RLTFS........................SIEV....YK.YLE.....PL..YNDYR.KLRYMDKNG...................-----....HFQLIHMDEFID.HLL.......RDERY...CD..I..QLPRLQRREALE---si...................................................................
A0A091STT2_9AVES/1-108                 ...............................................----------------------..-.--.----------................................-----------..------..............----.---.............................................--.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HEERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A094HRU1_9PEZI/22-189                ............................................lap---NGLNPATIFEKPVRERIID..C.YF.WKDQCFALNE................................-ADIVSRVVEH..VHFVAG..............-TYG.DSQ.............................................RP.SPFLCLAFKL.LQLGPGDD..........ILK.EYLGy....................................................gGERFK..YLRALACF....Y...V.....RLTRP........................AKQV....YE.TLE.....PY..LEDGR.KLRRRGRQG...................-----....-TSLTFVDQFVD.ELL.......TKERI...CA..T..SLWKMPKREQLEDM-e....................................................................
R1EST0_EMIHU/1-175                     ...............................................---------MNLNSMLIENIRS..H.DY.FK-GLGELST................................FEEVVDQIYYD..CTYITP..............WRPG.THKaqraagmcs...........................glrgvsnagVP.STAYMLLFKL.YTLQLTRN..........QIL.RLVT......................................................HKDSP..YIRAIGLL....Y...L.....RYVCE........................PKEL....WG.WYE.....PY..VSDPE.-MWSQLG--...................----E....GGERSTLGSFVR.RLC.......TELEW...YD..T..MLPRLPVPVARDI--ek...................................................................
E1GES1_LOALO/47-231                    ..............................................l-PLWGNTQTMNLNALVLENIIQ..C.TY.YKNYLSETTG................................FQQLTEEIYYS..VKHLEP..............WERG.TRKtqgmtgmcg...........................gvrgvgaggVV.STAFCLLYKL.FTIRLSRK..........QLV.SMIN......................................................NSDSP..YIRGIGFM....Y...I.....RFCQP........................PQDL....WA.WME.....PY..LDDEE.---------...................QIDPRs..gGGDVMAMAQVVK.MML.......TKLDW...YG..T..LFPRIPVPIQKEI--el...................................................................
A0A0C2MT08_THEKT/43-227                ..............................................m-KTWGNEKTMNINSLLLSNIQS..S.LY.FKGELAQLAC................................IEELIDQIYYK..VTHLEP..............WEKG.TRKtsgqfgmcg...........................gvrgvgaggVV.SSAYCILYKI.FLIKPTKS..........QIK.LMLN......................................................HRDSP..YIRGVGFM....F...I.....RYCAP........................PETL....WK.WFQ.....RY..LDDQE.---------...................EIDPRa..nGGRPMTIGTMIR.NML.......TELDW...YG..T..LFPRIPLQIQKQI--ds...................................................................
A0A0V1NN92_9BILA/46-229                ..............................................l-NFWGNKETMNLNHLVLENIVS..S.PY.YKNTLLPLKT................................HFEVIDEIYYN..VEHLEP..............WEKG.TRKttgqtgmcg...........................gvrgvgaggVV.SSAFCLLYKL.FTLKLTRK..........QLT.AILN......................................................HPDSC..YIRGLGFM....Y...I.....RFCLH........................PATF....WS.WYE.....PY..FDDSE.---------...................EIDPKa..gGGDLMTIGEMVK.SLL.......TKLDW...YS..T..LFPRIPVPIQKEI--d....................................................................
A0A060SR90_PYCCI/10-173                ..............................................v-AIHGQNPQYLVESVIRNRIYE..S.SY.WKEHCFALTA................................-ETLIDKAIE-..LKAIGG..............-VYG.N-Q.............................................KP.TEFLCLLLKL.LQIQPEKE..........ILL.EYLQ......................................................ADEFK..YLRALAAM....Y...I.....RMTFR........................PAEV....YE.ILE.....PL..LKDYR.KLRHRGMNG...................-----....-YSIIHMDEFVD.SLL.......VEERV...CD..L..ILPRITKRDVLED--lg...................................................................
A0A0L9UWE1_PHAAN/3-166                 .......................................iqtcgkpi--------DSLLEKVLCMNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAVGFL....Y...L.....RYCGD........................PKTL....WS.WFE.....PY..IKDEE.---------...................EFSPG...sNGRMTTMGVYIR.DLL.......LGQYY...FD..T..LFPRIPVPV------lrqvv................................................................
A0A087STH6_AUXPR/10-175                ...............................................KSVHGTNPQNMVEYIIRQKIYD..S.VY.WKAECFGLTA................................-ELLVDKGTV-..LRYAGG..............-MYG.EPQ.............................................RP.SEFLCLILKM.LQIQPDKD..........IIV.EFIK......................................................DDAFK..YLRLLGAF....Y...M.....RLVGR........................PVDV....YQ.YLE.....PL..YNDFR.KVRVRESKG...................-----....AFALSYVDQVVD.DML.......TRDYC...FD..I..ALPRLPARKVLEE--ag...................................................................
A0A0N5DGF6_TRIMR/10-175                ..............................................s-TVKGTNPQYLIEKVVRSRIYD..S.RY.WKEECFALSA................................-ELLVDKGME-..LRFVGG..............-VFG.GNV.............................................KP.SPFLCLQLKM.LQIQPDKD..........IVI.EFIR......................................................QEDSK..YIRALGAM....Y...L.....RLTFT........................SVEI....YQ.YLE.....PL..LNDYR.KLRWMNKQG...................-----....KFELMHMDEFVD.RLL.......REERF...CD..I..QLPRLQKRDVLEE--tg...................................................................
H2S676_TAKRU/10-175                    ..............................................n-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LKFVGG..............-VYG.GNI.............................................KP.TPFICLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRLLGAM....Y...M.....RLTGT........................AVDC....YK.YLE.....PL..YNDYR.KVKTQNRNG...................-----....EFELMHVDEFID.ELL.......HSERM...CD..I..ILPRLQKRHVLEET-e....................................................................
A0A059B3E7_EUCGR/58-223                ...............................................KSIRGTNPQNLIEKIVRSKIYQ..N.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHIGG..............-TFG.GNR.............................................KP.TPFLCLVLKM.LQIQPEKD..........IVV.EFIK......................................................NEDYK..YVRVLGAF....Y...L.....RLTGI........................DMDV....YR.YLE.....PL..YNDYR.KVRQKLTGG...................-----....NFALTHVDEIID.ELL.......TKDYS...CD..I..AMPRIKKRWTLES--ag...................................................................
A0A0R3PB76_ANGCS/101-151               ............................................srd----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.------DEE...................EIDPRs..gGGDVMTFGQVVR.IML.......TKLDW...YG..T..LFPRIPVPIQKEID-e....................................................................
G1NFA1_MELGA/10-175                    ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LKYVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HEERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A167TG90_9PEZI/25-192                ............................................lap---NGLNPATIMEKAVRERIVD..S.YF.WKEQCFGVNE................................-ADIVDRVVDH..VHYVGG..............-TTG.TAQ.............................................RP.SPFLCLAFKL.LQLAPGDD..........VLQ.AYLAp....................................................gGERFK..YLRALALF....Y...V.....RLTRP........................AADV....YA.TLE.....PY..LADRR.KLRRRGRAG...................-----....-TTLTFVDEFVD.DLL.......VKPRV...CA..T..SLWKLPQREDLED--lg...................................................................
F4WXJ8_ACREC/37-220                    ..............................................l-PLWGNERTMNLNPLILTNIQS..S.HY.FKVNLYELKT................................YHEVIDEIYYK..VSHLEP..............WEKG.SRKtagqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.FTLRLTRK..........QLN.GLIN......................................................HPDSP..YIRALGFM....Y...I.....RYTQP........................PADL....FS.WYN.....DY..LEDEE.---------...................ELDVKa..gGGQVMKMGDILK.QFL.......TKLEW...FS..T..LFPRIPVPIQKD---le...................................................................
M2T688_COCH5/23-228                    .............................................al--IRGQNPALLFEKGVRERITE..S.YY.WKEQCFGLNA................................-ATLCDRAAE-..LKFIGG..............-TTG.ITG.............................................KP.TPFLCLAFKM.LQLVPDKE..........IVL.EYLNfrdddddeedkaevkkengd.............aaaddadqsankeldlnaagkLGCFK..YLRCLAAF....Y...I.....RLAWE........................PVEI....YK.TLE.....PL..LTDYR.KIKRRLKDT...................-----....-FTLTHVDQFID.DLL.......TKERI...CA..T..SLWKLPSRAILEDL-d....................................................................
G3R6P3_GORGO/47-231                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
A0A093H533_PICPB/10-175                ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LKYVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFMK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HEERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A0M8ZVI6_9HYME/10-175                ...............................................KSIRGTNPQYLIEKIIRSRVYD..S.KY.WKEECFALTA................................-ELLVDKAME-..LRFIGG..............-VYG.GNV.............................................KP.TPFLCLILKM.LQIQPEKD..........IIV.EFIK......................................................NEEFK..YVRALGAL....Y...M.....RLTGS........................SLDC....YK.YLE.....PL..FNDNR.KLRRQNKQG...................-----....KFELIHMDEFID.DLL.......REERC...CD..I..ILPRIQKRHVLEEN-n....................................................................
A0A0E0LY62_ORYPU/10-175                ...............................................KSIHGTNPQNLVEKIVRSKIYQ..S.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHTGG..............-TYG.GNR.............................................KP.TPFLCLALKM.LQIQPDKD..........IVV.EFIK......................................................NEDYK..YVRVLGAF....Y...L.....RLTAA........................VADV....YQ.YLE.....PL..YNDYR.KIRHKLSDG...................-----....KFTLTHVDEFID.DLL.......TKDYS...CD..T..ALPRIQKRWVLEA--sg...................................................................
A0A0D9QS50_PLAFR/183-345               ............................................lem----TNTTTYNVNMLLRNNILS..S.EY.FR-SLIPLKT................................LKEVIEEIHLY..ADHVEP..............YCAG.STR.............................................AP.STLFCCLYKM.FTLHLSEK..........QMK.MLIE......................................................NRDSC..YIRACGFL....Y...L.....RYVHA........................PSNL....WM.WFE.....PY..LLDED.---------...................EFITSa..dKRKKQTIGEYIQ.SLL.......ADDKY...FN..T..VLPRMPIKIK-----nty..................................................................
A0A093J7E8_EURHL/1-141                 ..............................................f----------------------..-.--.----------................................----------Q..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKTI--dq...................................................................
A0A0K9PM83_ZOSMR/3-167                 ............................................vqt---TGRSIDSVLERVLSMNILS..S.DY.FK-EIHQLKT................................YHEVVDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKL.FTLKLTVK..........QMH.GLLK......................................................HRDSP..YIRAVGFL....Y...L.....RCVAE........................PKTL....WG.WCE.....HY..VKDDE.---------...................EFSPG...sNGRVSTMGVYVR.DLL.......LGQYY...FD..T..LFPRIPLPIVR----qivn.................................................................
T1I5E1_RHOPR/4-188                     ..............................................l-PLWGNERTMNLNPLILTNIQS..S.HY.FKVNLYELKT................................YHEVIDEIYYK..VAHLEP..............WEKG.SRKtagqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.FTLKLTRK..........QLN.GLIT......................................................HPDSP..YIRALGFM....Y...I.....RYTQP........................PPDL....WD.WYD.....EY..LDDNE.---------...................ELDVKa..gGGQIMTIGNILK.NFL.......CKLEW...FS..T..LFPRIPVPIQQKIE-k....................................................................
A0A0B2X748_9HYPO/24-191                ............................................lap---NGLNPATIMEKAVKDRIVE..S.YF.YMEQCFALNE................................-ADIIDRVVEH..VRFVGG..............-THG.DAQ.............................................KP.SPFLCLAFKL.LELAPSEA..........ILR.EYLSy....................................................gGEHFK..YLRALACF....Y...Y.....RLTRR........................AADV....HR.TLE.....PF..LADRR.KLRRKGRRG...................-----....-TTLTYVDEFVD.ELL.......TGERV...CA..T..SLWKMPGRDVLEDL-d....................................................................
A0A0P7BAJ7_9HYPO/26-193                ............................................lap---NGLNPATIMEKAVKDRIVD..S.YF.YKEQCFALNE................................-ADIVDRVVEH..VSFIGG..............-THG.ATQ.............................................KP.SPFLCLAFKL.LELSPSDA..........ILQ.EYLQy....................................................gGEAFK..YLRALACF....Y...V.....RLTRQ........................AKDV....YE.ALE.....PF..LADRR.KLRRRGRAG...................-----....-TSLTFMDDFVD.DLL.......TKERI...CA..T..SLWKMPKREVLEDL-e....................................................................
A0A084W1A0_ANOSI/53-237                ..............................................l-PLWGNESSMNLNPLILANIQG..S.SY.FKVSLFKLKT................................YHEVVDEIYYQ..VKHLEP..............WERG.SRKtagqtgmcg...........................gvrgvgaggIV.STAFCLLYKL.YTLRLTRK..........QVN.GLLT......................................................HGDSP..YIRALGFM....Y...L.....RYTQP........................PGDL....FD.WYE.....PY..LLDEE.---------...................VIDVKa..gGGQVLTIGHMIR.QWL.......TKLDW...FS..T..LFPRIPVPIQKQI--da...................................................................
G3UEL4_LOXAF/10-175                    ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
W9RQ05_9ROSA/3-101                     .......................................iqtcgkpi--------DSLLEKVLCMNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HTDSP..YIRASLF-....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------lg...................................................................
F4K753_ARATH/1-113                     .............................................mg----------------------..-.--.----------................................-----------..------..............---G.NCR.............................................GP.STAYCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HTDSP..YIRAVGFL....Y...L.....RYVAD........................AKTL....WT.WYE.....PY..IKDDE.---------...................EFSPG...sNGRMTTMGVYVR.DLL.......LGLYY...FD..T..LFPRIPVPVMRQ---ivs..................................................................
A5K4Y5_PLAVS/10-175                    .............................................ik--IFGSNPQYLISNIIRSKIYE..S.PY.WKEKCFALTS................................-ESIIDQAVN-..LKYVGG..............-TYG.GNR.............................................KP.TRFLCLVLKL.LQIQPDKD..........IIY.EYIK......................................................NEEFI..YLRALGIF....Y...L.....RLIGK........................SLEI....YQ.HLE.....PI..LFDYR.KMRIRLQNG...................-----....TFEKMYMDVFVD.NCL.......VMNNF...LD..V..DFPSLTKRQVLEDND.....................................................................
A0A0V0S371_9BILA/10-175                ..............................................a-SLKGTNPQYLIEKVTRSRIYD..S.RY.WKEECFALSA................................-ELLVDRGME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLLLKM.LQIQPEKD..........IVI.EFIR......................................................QEDSK..YIRALGAL....Y...L.....RMTFS........................YVEV....YK.YLE.....PL..LNDYR.KLRWINKQG...................-----....KFELIHMDEFVD.KLL.......REERF...CD..V..QLPRLQKRAFLEE--tn...................................................................
W2ZJH7_PHYPR/37-201                    ..............................................l-PIYGNDTTYNLNTLLHQNILQ..S.AY.FH-ELYKFRT................................YHEVVDEIYYR..VDHAEP..............WSPG.TAR.............................................IP.SSCFCLLHKF.FLMRLTRK..........QMQ.GLLR......................................................HTDSP..YIRAVGFL....Y...L.....RFTCD........................PEEL....WT.WFE.....PF..LEDPE.---------...................EFNASa..nPSVKTTIGEWLI.SLL.......EENNY...FG..T..ILPRIPKKIE-----dgik.................................................................
A0A0V1NNY3_9BILA/546-729               ..............................................l-NFWGNKETMNLNHLVLENIVS..S.PY.YKNTLLPLKT................................HFEVIDEIYYN..VEHLEP..............WEKG.TRKttgqtgmcg...........................gvrgvgaggVV.SSAFCLLYKL.FTLKLTRK..........QLT.AILN......................................................HPDSC..YIRGLGFM....Y...I.....RFCLH........................PATF....WS.WYE.....PY..FDDSE.---------...................EIDPKa..gGGDLMTIGEMVK.SLL.......TKLDW...YS..T..LFPRIPVPIQKEI--d....................................................................
V5EEC2_KALBG/10-174                    ..............................................h-SIHGTNPQFLIEKPVRARIYE..S.PY.WKEHCFALSA................................-STILPLAVN-..LHHIGG..............-LVG.L-Q.............................................RP.SHFLCLLQKL.LQIQPEAE..........IIQ.AYLE......................................................AKEFK..YLRALTAF....Y...V.....RLTYK........................STDV....YT.LLE.....PI..LEDGR.KLRWRGSGG...................-----....EFEIVHMDEWVD.MLL.......REERV...CD..I..ILPRLTKRDVCET--rd...................................................................
A0A093QTN5_PHACA/23-207                ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKTI--dq...................................................................
A0A0L0VSX0_9BASI/10-176                ..............................................v-SIHGTNPQFLIDKVLRSRIYD..S.EY.WKESCFGLTA................................-ETIIDKTVFD..LNYLGS..............-TFT.ANL.............................................RP.TPFICLLLKL.LQLQPEKE..........IIL.EYLR......................................................AEEFK..YLRALAAF....Y...V.....RLTFT........................SINV....YQ.TLE.....PL..LQDYR.KLRVRGLDG...................-----....TYDLTTFDELID.NLL.......TESIV...FE..I..VLPRLTSRKVLEDL-e....................................................................
A0A0P4UI92_ROSNE/1-80                  ..............................................r----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................---FK..YLRALACF....Y...V.....RLTRR........................PEAV....HD.LLE.....PF..LADRR.RLRRRGRAG...................-----....-ATLTFVDQFVD.DLL.......TKDRV...CA..T..SLWAMPKRETLEDL-d....................................................................
N1JK20_BLUG1/21-188                    ............................................lap---NGLNPATIMEKPVRERIVD..C.YF.WKDQCFALNE................................-ADIINRVVDH..VHFICG..............-TYG.DAQ.............................................RP.SPFLCLAFKL.LQLAPSDE..........IIQ.EYLGy....................................................gGEKFK..YLRALAVF....Y...V.....RLTRQ........................AKDI....YT.ILE.....PY..LADYR.KLKKRGRTA...................-----....-TSLTYMDVFVD.DLL.......VKDRI...CG..T..TLWKIPKRTILEDL-d....................................................................
A0A0L0GCU8_9EUKA/12-136                ..........................................fgnav----------------------..-.--.----------................................-----------..--ELEP..............FMPG.IGN.............................................KA.TSAFCLLYKL.FTLKMTEQ..........QVV.ALLD......................................................NEDSV..YVRGIGFL....W...L.....RYCCP........................PKEL....WS.WMG.....HY..INDTE.PIKPGWSQN...................-----....-SPETTIGSFIR.RLL.......TEQKY...YN..T..IMPRIPVPVARE---lqk..................................................................
E7KNP5_YEASL/15-219                    ...............................................KQLNNQSVSLVIPRLTRDKIHN..S.MY.YKVNLSNESLrg............................ntMVELLKVMIGA..FGTIKGqng.......hlhmMVLG.GIE.............................................--.--FKCILMKL.IEIRPNFQ..........QLN.FLLNvk.................................................nenGFDSK..YIIALLLV....Y...A.....RLQYYylngn.............nkndddENDL....IK.LFKvq.lyKY..SQHYF.KLKSFPLQVdc...............faHSYNE....ELCIIHIDELVD.WLA.......TQDHI...WG..I..PLGKCQWNK------iynsde...............................................................
A0A0L1I7A1_PLAFA/11-175                ............................................knf----GSNPQYLISNIIRSKIYD..S.PY.WKEKCFALTS................................-ESIIDQAIN-..LKYVGG..............-TYG.GNR.............................................KP.TRFLCLILKL.LQIQPDKD..........IIY.EYIK......................................................NEDFV..YLRALGIF....Y...L.....RLIGK........................SLEV....YN.HLE.....PI..LFDYR.KIRMRLQNG...................-----....TFEKIYMDVFVD.NCL.......ILNNF...LD..V..DFPTLTKRQVLEEN-n....................................................................
W7A7D1_9APIC/10-175                    .............................................ik--IFGSNPQYLISNIIRSKIYE..S.PY.WKEKCFALTS................................-ESIIDQAVN-..LKYVGG..............-TYG.GNR.............................................KP.TRFLCLVLKL.LQIQPDKD..........IIF.EYIK......................................................NEEFI..YLRALGIF....Y...L.....RLIGK........................SLEI....YR.HLE.....PI..LYDYR.KMRIRLQNG...................-----....TFEKIYMDQFVD.NCL.......IMNNF...LD..V..DFPSLTKRQVLEDN-n....................................................................
G0N8A9_CAEBE/10-175                    ..............................................k-TVKGTNPQFLVEKIIRQRIYD..S.MY.WKEHCFALTA................................-ELVVDKGMD-..LRYIGG..............-IYA.GNI.............................................KP.TPFLCLALKM.LQIQPDKD..........IVL.EFIQ......................................................QEEFK..YIRALGAM....Y...L.....RLTFD........................STEI....YK.YLE.....PL..YNDFR.KLRYMNKMG...................-----....RFEAIYMDEFID.NLL.......REDRY...CD..I..QLPRLQKRWALEE--vd...................................................................
A0A0B1T4B6_OESDE/113-297               ..............................................l-PIWGNQQTMNLNGLVLENVKE..S.YY.YKNHLIEIES................................AQQLLDEVFYK..VKHLEP..............WEKG.TRKvqgmtgmcg...........................gvrgvgaggVV.SSAFCLLYRF.FKVRLTRK..........QLI.SMIN......................................................SRVSP..YIRGLGFM....Y...I.....RYTQP........................PADL....WE.WFE.....PY..LDDEE.---------...................EIDPRs..gGGDIMTFGQVVR.IML.......TKLDW...YG..T..LFPRIPVPIQKEID-e....................................................................
A0A0K0FA69_9BILA/6-171                 ..............................................k-TIRGTRSTFLIEKIIRTRINE..S.LY.WKEECFGLSA................................-ETVIDKGAE-..LRYVGG..............-IYA.GNT.............................................RP.TPFLCLTLKL.LELAPEKD..........III.EYIQ......................................................QEEFK..YIRALGAM....Y...I.....RLTFP........................SVDV....YR.YLE.....PI..YNDYR.KLRYMNRMG...................-----....RFELMYMDQFID.RLL.......NEELF...CD..V..HLPKLQGRQLLEQN-d....................................................................
F7CZ30_MACMU/10-176                    ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTV................................FINVIDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A0R3X512_HYDTA/10-175                ..............................................h-TLHGTNPQYLIEKIIRSRIYE..C.QF.WKEHCFALTS................................-ELLVDKAVE-..LKYIGG..............-TYG.GLT.............................................KP.TPFICLVLKM.LQIQPDKD..........IVI.EFIK......................................................QEDYK..YARALGAF....Y...L.....RLVGE........................SVEI....YK.YLE.....AL..YNDFR.KLKQQDTTG...................-----....KFSIIRMDEFID.QLL.......NEERV...CD..V..ILPRLQKRSVLEDN-n....................................................................
A0A0L1IBQ2_PLAFA/173-335               ............................................lem----TNTTTYNVNTLLRNNILS..S.EY.FK-SLIPIKT................................FKEVVDEIHSY..ADHVEP..............YCIG.SNR.............................................AP.STLFCCLYKF.FTMQLSEK..........QLK.SLIE......................................................NKDSC..YIRACGFL....Y...L.....RYVHS........................PANL....WM.WFE.....PY..LLEED.---------...................EFSISc..dKRRKVTIGEYVQ.SLL.......SDDKY...FN..T..VLPRLPIKIK-----nvy..................................................................
B0D223_LACBS/10-173                    ..............................................q-AIHGQNPQFLVETVIRNRIYE..S.TY.WKEHCFALTA................................-ESLIDKALQ-..VRFIGG..............-VYG.NQR.............................................-P.TEFLCLLLKL.LQIQPEKE..........ILV.EYLR......................................................ADEFK..YLRALAAL....Y...I.....RMTFR........................AVEV....YD.LLE.....PQ..LKDYR.KLRQRNMGG...................-----....-YALTFMDEFVY.ALL.......VEERV...CD..I..ILPRLIKRQVLEEN-g....................................................................
W1QC60_OGAPD/14-179                    ..............................................k-RVHGVHPVFLIEKILRERILD..S.QY.WKRECQHADL................................-LVLLDRGVE-..LKQIGT..............YANA.GHT.............................................LP.SPFICLLLRL.LQLQPAAD..........IID.YLLV......................................................QTDFV..YLTALAAL....Y...V.....RITCD........................SVIV....YQ.KLE.....PL..LADHR.RINMIENQT...................-----....-VKSINLDEYID.KLL.......QGNKF...LD..M..VLPRLIDRLVLEDQ-e....................................................................
A0A158NUY7_ATTCE/37-220                ..............................................l-PLWGNERTMNLNPLILTNIQS..S.HY.FKVNLYELKT................................YHEVIDEIYYK..VSHLEP..............WEKG.SRKtagqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.FTLRLTRK..........QLN.GLIN......................................................HPDSP..YIRALGFM....Y...I.....RYTQP........................PADL....FS.WYN.....DY..LEDEE.---------...................ELDVKa..gGGQVMKMGDILK.QFL.......TKLEW...FS..T..LFPRIPVPIQKD---le...................................................................
A0A0A0MRN0_HUMAN/2-120                 .........................................cggvrg----------------------..-.--.----------................................-----------..------..............--VG.TGG.............................................IV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
M9LTE5_PSEA3/10-174                    ..............................................v-SIHGTNPQFLIEKPVRARIYE..S.PF.WKEHCFALSA................................-ATLLPLAVD-..LHHVGG..............-LTG.-LQ.............................................RP.SHFLCLLQKL.LQIQPEPA..........IVD.AYLA......................................................AKEFK..YLRVLAAF....Y...V.....RLTFA........................SSEI....YA.RLE.....PM..LEDYS.KLRWRDAGG...................-----....AYSVVHVDEVVD.MLL.......REERV...CD..I..ILPRLTRRDVCET--rd...................................................................
A0A0K8L2H4_9EURO/21-209                ..............................................l--VRGVNPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LTSIGG..............-TYG.VAE.............................................KP.TPFLCLAFKL.LQLNPERD..........IIL.EYLNytdpgsdeetea.............................aaedqarngvvgqRGDFK..YLRALAAF....Y...V.....RLTFD........................PVDV....YK.TLE.....PL..LLDYR.KLKRRVRDT...................-----....-FVLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKLPARQQLEDL-d....................................................................
D4AX30_ARTBC/21-222                    ..............................................l--IRGVNPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LTYIGG..............-TYG.VGQ.............................................KP.TPFLCLAFKL.LQLAPEKE..........VIL.EYLNfhdpeadeedsnirrdstd................adggaedaqdradaailkaTGDFK..YLRALAAF....Y...I.....RLTFE........................PVEI....YK.TLE.....PL..LTDYR.KLKRRTKEG...................-----....-FLLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKIPTRTMLEDL-d....................................................................
A0A091VKU0_NIPNI/25-209                ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKTI--dq...................................................................
A0A0N4UD64_DRAME/10-175                .............................................vt--VKGTNPQYLIEKIIRTRIYD..S.KY.WKEECFALTG................................-ELLVDKGME-..IRFVGG..............-IYA.GNV.............................................KP.TPFLCLVLKM.LQIQPEKD..........IIV.EFIR......................................................QEEYK..YIRALGAI....Y...L.....RITFS........................SIEV....YK.YLE.....PL..YNDYR.KLRVMNKDG...................-----....RFEIIHMDEFID.SLL.......REERY...CD..V..HLPRLQKRMTLEE--ig...................................................................
U6JTB6_EIMAC/135-297                   ............................................vqm----TDSTTYNVNQLLRANILS..S.EY.FK-SLHQLKS................................FHEVVAEVAAY..ADHAEP..............YCSG.STR.............................................AP.STLFCCLYKL.FTLKLTDK..........QMH.MLLN......................................................HRESP..YVRCTGFL....Y...L.....RYVHP........................ADQL....WK.WFE.....PF..FLDDE.---------...................QFTPGa..dPNRVVSIGEYAQ.SLL.......TEDKY...FS..T..VLPRLPVLVK-----nvy..................................................................
C3ZFR3_BRAFL/10-175                    ..............................................h-SVKGTNPQYLVEKIIRSRIYE..S.KY.WKEECFGLTA................................-ELLVDKAME-..LKYIGG..............-VYG.GNI.............................................KP.TPFLCLVLKM.LQIQPEKD..........IIV.EFIK......................................................NDEFK..YVRCLGAM....Y...M.....RLTGS........................SLDV....FK.YLE.....PL..LNDYR.KVKWMDSMG...................-----....KLNLSHVDEFVD.NLL.......REERS...CD..T..ILPRIQGRHVLEES-n....................................................................
K3YT29_SETIT/10-175                    ...............................................KSIHGTNPQNLVEKIVRSKIYQ..S.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHTGG..............-TYG.GNR.............................................KP.TPFLCLALKM.LQIQPDKD..........IVV.EFIK......................................................NEDYK..YVRVLGAF....Y...L.....RLTGT........................VADV....YQ.YLE.....PL..YNDYR.KLRHKLSDG...................-----....QFALTHVDEFID.ELL.......TKDYS...CD..T..ALPRIQKRWVLEA--sg...................................................................
D8QUJ9_SELML/10-175                    ...............................................KSVHGTNPQNLVEKILREKIHQ..S.SF.WKEQCFALTA................................-ETLVDKAME-..LDHIGG..............-TYG.GNR.............................................KA.TPFMCLTLKM.LQIQPEKE..........IVV.EFIK......................................................NQDYK..YVRVLGAF....Y...L.....RLVGK........................ATDV....YQ.YLE.....PL..YNDYR.KIRQRSADG...................-----....SFFLSHVDEFID.QLL.......TTDYC...CD..I..TLPRVPKRSVLEQN-n....................................................................
M4BZA9_HYAAE/9-147                     ..............................................q-SVHGVNPQTLIEKIMRNRIYA..S.IY.WKEQCFGLTA................................-ETLVDKAVE-..LSEFGG..............-TFG.GNQ.............................................QP.THFLCLLLKM.LQLQPEIE..........VVQ.QFIE......................................................NEDYK..YVTILGAV....Y...L.....RLVGK........................PMEV....YQ.LLE.....PL..LSDYR.KIRKRNTAN...................-----....------------.---.......-----...--..-..---------------ldvglralvqp..........................................................
A0A139AS28_GONPR/11-222                ...........................................lpvv----SEREDMNMNAVVYTNIRT..S.LY.FK-QLYEYKT................................YHEVLTEITRK..EQETENfslfdc..pskkknWESG.SSLepqeydflvvfriqigel.........tpswfllveslepflkgtMA.STAFCLLYKL.WTLRLTVK..........QIR.GMID......................................................NG-NP..HVRAIGFL....Y...L.....RYVLE........................PKKL....WE.WLE.....PY..LDDNE.---------...................EVLVE...rLGKPTTIGRVVR.SLL.......TDQKW...QG..T..MLPRIPVPVVKDI--qa...................................................................
W6KZR3_9TRYP/4-141                     .............................................hl---KGRQAVASLDPATRYRITR..S.QV.MA-QCANKPL................................-LWVLEELTR-..VFVVGG..............-LSG.PLH.............................................KV.EHFLCLITRL.LQICPSPD..........IVL.VMLR......................................................QELHK..YVKVAALF....V...I.....RLIGN........................DIIV....QE.AVK.....LG..LNDYR.KIRVYGSDE...................-----....------------.---.......-----...--..-..---------------tpamsfvttgtk.........................................................
H3ATS7_LATCH/10-175                    ..............................................h-SIHGTNPQYLVEKIIRTRVYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LKYVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRLLGAL....Y...M.....RLTGT........................SIDC....FK.YLE.....PL..YNDYR.KIKTQNRNG...................-----....EFELMHVDEFID.QLL.......HDERV...CD..I..ILPRLQKRHVLEEA-e....................................................................
Q4Y906_PLACH/157-319                   ............................................iem----TNTSTYNVNNLLRNNILS..S.EY.FR-SLINLKT................................FKEVLDEILSY..ADHVEP..............YCIG.STR.............................................AP.STLFCCLYKF.FTMQLTKK..........QLK.SLID......................................................NKESC..YVRACGFL....Y...L.....RYVHC........................PSNL....WM.WFE.....PY..MLDDD.---------...................EFTISa..dKRKLVTIGEYVQ.SLL.......YDDKY...FN..T..VLPRLPIKIK-----niy..................................................................
A0A183LYE7_9TREM/4-75                  ..................................syrytefifyfvl----------------------..-.--.----C---KA................................-ELLVDKAVE-..LRYVGG..............-VYS.GSV.............................................KP.TPFLCLTLKM.LQIQPDKD..........IVI.EFIK......................................................QEPYK..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------lvc..................................................................
A0A0L0HMA2_SPIPN/10-174                ..............................................q-NIHGTNPQFLIEKIIRTRIYD..S.LY.WKESCFALTA................................-ETLIDKAVN-..LTSIGG..............-QYG.N-Q.............................................KP.TEFLCLALKM.LQLQPEKE..........IVR.LYIQ......................................................NEDYK..YLRALGAF....Y...L.....RLTGT........................AVEI....YQ.YLE.....PL..LLDYR.KLRRRNISG...................-----....EFELTHVDEFVD.DLL.......RSERV...CD..T..ILPRITKRHILEEN-g....................................................................
A0A061H922_9BASI/10-174                ..............................................l-NVHGTNPQFLVEKTIRSRIYD..S.RF.WKEHCFALTA................................-ESIIDRAVD-..LEYVGG..............-TYG.LQR.............................................-P.SPFLCLLQKL.LQLQPERE..........IIL.EYLN......................................................AAEFK..YLRALAAM....Y...V.....RLTFR........................AVEV....YE.LLE.....PL..LDDYR.KLRWRDMTG...................-----....TYSLTYMDVFVD.QLL.......TQERV...CD..I..ILPRLTRRDVLEE--ie...................................................................
M5XCM3_PRUPE/1-41                      ............................................mgv----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....NYALTHVDEVID.ELL.......TKDYS...CD..I..AMPRIKKRWTLEA--tg...................................................................
R4GD49_ANOCA/32-216                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
W5JA90_ANODA/10-175                    ...............................................KNVHGTNPQYLIEKIIRSRIYD..S.KY.WKEQCFALTA................................-ELLVDKAME-..LRFVGG..............-VFG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IVV.EFIK......................................................NEEFK..YVRALGAF....Y...L.....RLTGS........................SLDC....YK.YLE.....PL..YNDNR.KLRKQNRMG...................-----....AYELIHVDEFID.ELL.......REERV...CD..I..ILPRIQKRHVLEEN-n....................................................................
B4GH52_DROPE/10-175                    ...............................................KNVHGTNPQYLIEKIIRSRIYD..S.KY.WKEQCFALTA................................-ELLVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TQFLCLTLKM.LQIQPEKD..........IVV.EFIK......................................................NEEFK..YVRALGAF....Y...L.....RLTGV........................ALDC....YK.YLE.....PL..YIDNR.KLRRQNRAG...................-----....QFEIVYMDEYID.ELL.......RNDRV...CD..I..ILPRIQKRTILEEN-n....................................................................
A4RVT9_OSTLU/18-191                    ............................................naa---KTTGRTHGVEAVLRQNVVN..S.EY.YRKLCRSATGtvdg........................egmdFMSLVDEIYEL..VDHVEP..............WMSG.NAR.............................................GA.STGFCILFRF.CEKELSDK..........EIW.HLLR......................................................HGDSP..YIRAIGFL....Y...V.....RYVKN........................GREL....LR.WCE.....EF..FDDAE.---------...................KFSPS...pGGKEVTMGTYVR.DLL.......LEQHY...FE..T..IFPRIPEVARRE---mvq..................................................................
D3ZGL5_RAT/10-175                      ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LKFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
E3LKU1_CAERE/55-239                    ..............................................l-PIWGNQVTMNLNTLVLENIRE..S.YY.YKNNLVEIDS................................FQTLVEQIFYQ..VKHLEP..............WEKG.TRRlqgmtgmcg...........................gvrgvgaggVV.SSAYCLLYRL.FNLRISRK..........QLI.SMLN......................................................SRQSV..YIRGIGFM....Y...I.....RYTQP........................PADL....WY.WLE.....PY..LDDDS.---------...................EIDPRs..gGGDLMTFGQMVR.TMI.......NKLDW...YG..T..LFPRIPVPIQKEID-e....................................................................
M4BIY1_HYAAE/37-168                    ..............................................l-PINGNDTTYNLNTLLHQNILQ..S.AY.FH-ELYKLKT................................YHEVVDEIYYR..VDHAEP..............WSPG.TAR.............................................IP.SSCFCLLHKF.FLMRLTVK..........QMQ.GLLR......................................................HTDSS..YIRVIGFL....Y...L.....RYTCD........................PEKL....WT.WFE.....PY..LEDVE.E--------...................-----....------------.---.......-----...--..-..---------------fnasanpslk...........................................................
G3PQV1_GASAC/24-208                    ..............................................l-PLWGNEKTMNLNPMILTNVLS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHAEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QLM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PADL....ID.WYD.....GF..LDDEE.---------...................ELDVKa..gGGCVMTVGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKL---idq..................................................................
A0A183T2T2_SCHSO/10-175                ..............................................h-SVHGTNPQYLIEKIIRSRIYE..S.KY.WKEHCFALTA................................-ELLVDKAIE-..LRYVGG..............-VYS.GLT.............................................KP.TPFLCLVLKM.LQIQPDKD..........IVI.EFIK......................................................QEDYK..YARAIGAF....Y...L.....RLVGE........................SAEI....YK.YLE.....TL..YNDFR.KIKKQDNNG...................-----....KFSLIHMDEFID.SLL.......TEERV...CD..V..ILPRLQKRSVLEE--an...................................................................
A0A0F8A580_9HYPO/24-192                .............................................la--ANGLNPATIMEKAVRDRIVD..S.YF.YQEQCFGVNE................................-ADVVDRVVEH..VSFVGG..............-THG.AAQ.............................................KP.SPFLCLAFKL.LELAPADA..........VVD.AYLAr....................................................gGDHFK..YLRALACF....Y...V.....RLTRP........................APGV....YT.ALE.....PF..LADRR.KLRRKGRTG...................-----....AVSLTYMDEFVD.DLL.......HKDRV...CA..T..SLWKMPSRDVLEDL-e....................................................................
H2TYE1_TAKRU/22-206                    ..............................................l-PLWGNEKTMNLNPMILTNVLS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QLM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PPDL....LE.WYD.....GF..LDDDE.---------...................ELDVKa..gGGCVMTVGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKSI--dq...................................................................
A0A0D9QTL7_PLAFR/10-175                .............................................ik--IFGSNPQYLISNIIRSKIYE..S.PY.WKEKCFALTS................................-ESIIDQAVN-..LKYVGG..............-TYG.GNR.............................................KP.TRFLCLVLKL.LQIQPDKD..........IIY.EYIT......................................................NEEFI..YLRALGIF....Y...L.....RLIGK........................SLEI....YR.HLE.....PI..LFDYR.KMRIRLQNG...................-----....TFEKIYMDVFVD.NCL.......VMNNF...LD..V..DFPSLTKRQVLEDN-n....................................................................
A0A183DZ28_9BILA/2-96                  ......................................tgmcggvrg----------------------..-.--.----------................................-----------..------..............--VG.AGG.............................................VV.STAFCLLYKL.FTIRLTRK..........QLV.SMIN......................................................NRDSP..YIRGVGFM....Y...I.....RFCQP........................PNDL....WS.WME.....PY..LDDEE.QIDPR----...................-----....------------.---.......-----...--..-..---------------sgggdvxxxxfas........................................................
A0A087XDU8_POEFO/25-209                ..............................................l-PLWGNEKTMNLNPMILTNVLS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHIEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....LD.WYN.....DF..LDDEE.---------...................ELDVKa..gGGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKAI--dq...................................................................
A0A0E0A4V5_9ORYZ/4-150                 ........................................qssgrpi--------DVLMEKVLSVNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.SSAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAVGFL....Y...L.....RYVAE........................PKTL....WS.WYE.....PY..IKDDE.---------...................EFSPG...sNGKMTTMGVYVR.DLL.......L----...--..-..---------------gqcpl................................................................
F6UKW2_XENTR/35-219                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PADL....WD.WYE.....DF..LDDEE.---------...................ELDVKa..gGGCIMTIGEMLR.SYL.......TKLEW...FS..T..LFPRIPVPVQKHI--dq...................................................................
K0SGM5_THAOC/41-200                    ..........................................iplsc-----SDDTFNMHPMLLQNIAK..S.PY.FHKCVDTLTD................................WNGLVDEIYYE..VKHLEP..............FTAV.SLD.............................................RVlSAATSLHF--.-EVYREAD..........ALD.---A......................................................GAYSP..YIRCIGFL....Y...L.....RYAAE........................PSTL....WT.WFE.....PY..LHDDE.PVQVRQ---...................-----....GRADTTVGEFVR.SLL.......EDMDY...HG..T..RLPRLPLTIER----qvk..................................................................
L8H6U6_ACACA/87-250                    ..............................................l-ELHGDLEKMNLSALIYNNILG..S.TY.FK-GLYKLKT................................YHEIVDEIYYS..VEHLEP..............FMP-.NSK.............................................MA.SQAWCLMYKC.FTIKLTKK..........QVT.GMLD......................................................HADSP..YIRGIGFL....Y...L.....RMCTN........................PKLL....WD.WFE.....PY..LADEE.---------...................EITIR...yKGKPTTIGSLVE.DLL.......TTIKF...VD..A..IMPRFPALVGKEI--nd...................................................................
Q4N084_THEPA/10-175                    .............................................hl--IHGTNPQFLFSKILRDKVYN..S.FY.WKESCFGLTA................................-ESLIDKAVQ-..IKYVGG..............-TFG.GNR.............................................QP.SPFICLVLKM.LQIQPEME..........IVH.EYIK......................................................NEDYK..YLRALGIY....Y...M.....RLVGT........................AVEV....YR.TLE.....PI..LGDYR.KLRFRNIDG...................-----....SYVIKYMDEFVD.DCL.......TNTTY...LD..V..DLPPLSKRMNLEA--tk...................................................................
J3P436_GAGT3/24-191                    ............................................lap---NGLNPARIMEKAVVDRIVD..S.YF.WKEQCFGLNE................................-ADIVDRVVDH..VHFVGG..............-ITG.ASQ.............................................KP.TPFLCLALKL.LQLAPGDD..........VLA.EYLHf....................................................gGDKFK..YLRALALF....Y...V.....RLTRT........................PKDV....YA.TIE.....PF..LEDYR.KLRRKGRAG...................-----....-TSLTYVDDFAD.DLL.......VKDRV...CA..T..SLYKLTKRDVLEDL-d....................................................................
W5FVI4_WHEAT/10-175                    ..............................................r-SIHGTNPQNLVEKIVRAKIYQ..S.NY.WKEQCFGLTA................................-ETLVDKAME-..LDHTGG..............-THG.GNR.............................................RP.TPFLCLALKM.LQIQPDKE..........IVV.EFIK......................................................NEDYK..YVRVLGAF....Y...L.....RLTGT........................VADV....YQ.YLE.....PL..YNDYR.KIRQKLSDG...................-----....KFTLTHVDEFID.ELL.......TKDYS...CD..T..ALPRIQKRWILEA--sg...................................................................
H0V3G0_CAVPO/48-232                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
A0A0L9UT28_PHAAN/1-70                  ..............................................m----------------------..-.--.----------................................----------E..LDHLGG..............-TYG.ENR.............................................KP.TPFMCLVMKM.LQIQPEKE..........IVI.KFIK......................................................NEDYK..YVRILDTF....Y...L.....RLTDS........................DIAV....YR.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------yhl..................................................................
S9WYR5_9TRYP/4-144                     .............................................nl---KGRSAVAALDPSTKGRILK..S.HT.MN-SCLNKPL................................-LWVLEELID-..LEAVGG..............-VSG.PLK.............................................RV.EYFLCLLTRL.LQITPAPG..........IVL.TMLR......................................................QDVHK..YLRVGALF....L...I.....RLIGN........................PAMQ....RE.AMK.....IG..FDDYR.KIRVYGNEE...................ERE--....------------.---.......-----...--..-..---------------tsstkrpreeee.........................................................
E0VHT3_PEDHC/1-176                     ...............................................---------MNLNPLILTNIQS..S.YY.FKVNLYELKT................................YREVIDEIFYK..VNHLEP..............WEKG.SRKtagqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.FTLHLTRK..........QLN.GLIN......................................................HRDSP..YIRALGFM....Y...I.....RYTQP........................PADL....YD.WFE.....NY..LEDAE.---------...................EMDVKa..gGGQIMTIGDMLR.HFL.......TKLEW...FS..T..LFPRIPVPIQQKIE-r....................................................................
T0KFN0_COLGC/1-66                      ..............................................m----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....--TRK........................AKDV....YL.LLE.....PF..LEDRR.KLRRKGRAG...................-----....-TSLTYMDEFVD.DLL.......TKTRV...CA..T..SFRELPKRVDLVD--lg...................................................................
F6I4Q5_VITVI/10-175                    ...............................................KSIRGTNPQNLVEKILRSKIYQ..N.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHLGG..............-TFG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKD..........IVV.EFIK......................................................NEEYK..YVRILGAF....Y...L.....RLTGI........................DTDV....YQ.YLE.....PL..YNDYR.KLRRKLSDG...................-----....NYSLTHVDEVID.ELL.......TKDYS...CD..V..ALPRIKKRWTLES--lg...................................................................
A0A093J1G4_EURHL/1-135                 ...........................................alla----------------------..-.--.----------................................-ELVVDKAME-..LKYVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HEERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A0V0VGV7_9BILA/62-227                ..............................................a-SLKGTNPQYLIEKVTRSRIYD..S.RY.WKEECFALSA................................-ELLVDRGME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLLLKM.LQIQPEKD..........IVI.EFIR......................................................QEDSK..YIRALGAL....Y...L.....RMTFS........................YVEV....YK.YLE.....PL..LNDYR.KLRWINKQG...................-----....KFELIHMDEFVD.KLL.......REERF...CD..V..QLPRLQKRAFLEE--tn...................................................................
B0WP85_CULQU/10-175                    ..............................................r-NVHGTNPQYLIEKIIRSRIYD..S.KY.WKEQCFALTA................................-ELLVDKAMD-..IRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IVV.EFIK......................................................NEEFK..YVRALGAF....Y...L.....RLTGS........................SQDC....YK.YLE.....PL..YNDNR.KLRRQNRMG...................-----....HYELVHMDEFID.ELL.......REERG...CD..I..ILPRIQKRHVLEEN-n....................................................................
C0PCD4_MAIZE/3-167                     ...........................................iqts----GKPIDVLMEKVLSMNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNT..VKHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..HIRAIGFL....Y...L.....RYVAD........................PKVL....WM.WYE.....PY..LRDDE.---------...................EFSPG...sNGRKTTMGVYVR.DLI.......LGQYY...FD..S..LLPRIPLPVTRQ---ita..................................................................
A0A068XDW1_HYMMI/27-211                ..............................................l-KLWGNQVTMNINPMIHTNIIQ..S.PY.FKTNLIELKT................................YHEVIDEIYYK..VTHLEP..............WERN.SRRvggqtgmcg...........................gvrgvgaggIV.STAYCLLFKL.FTLKLTRK..........QLK.GLLE......................................................HPDSP..YIRSLGFM....Y...I.....RYCLP........................PEDL....WM.WFS.....PY..LDDEE.---------...................EVDVRa..gGGCTMTIGAMLE.QFL.......TKLDW...FT..T..LFPRIPVPVQKKIE-e....................................................................
W9C3G0_9HELO/21-188                    ............................................lap---NGLNPATILEKPVRERIVD..C.YF.WKDQCFALNE................................-ADIVSRVVSH..VTFIAG..............-TYG.DSQ.............................................RP.SPFLCLAFKL.LQLGPSDE..........ILQ.EYMGy....................................................gGEKFK..YLRALALF....Y...W.....RMTRQ........................AKDV....FM.VLE.....GY..LEDRR.KLRRKTRTG...................-----....-TTLTFIDQFVD.ELL.......TKDRV...CG..T..TLWKMPKREILEDL-e....................................................................
Q4U8Q2_THEAN/128-301                   ............................................ipm----TNSVTYNMNDLLRSNILS..S.EY.YK-SL-SVKN................................FYQVFDELVQF..ASHCEP..............YCST.ATR.............................................AP.STIFCCLYRF.LVLKLTEKqvifslievvQMN.FLLE......................................................NNKSP..YARCCGFL....Y...L.....RYVLP........................PDKVtkikFI.CFS.....SG..IDDEF.--------F...................TVSAD....GNKQITMGEYAE.SLL.......MDDKY...YH..T..ILPRLPVRVK-----nl...................................................................
R7Z359_CONA1/20-205                    .............................................al--IRGQNPALLFEKAVRDRITE..S.YY.WKEQCFGLNA................................-ATLCNRAVE-..LTFIGG..............-TYG.GMG.............................................KP.TPFLCLAFKL.LQLVPERD..........IIL.EYLNwsdeegeqge.................................eeenegitlgrPGEFK..YLRALAAF....Y...I.....RLAWE........................PVEI....YR.TLE.....PL..LADYR.KLKRRTREG...................-----....-FTLTFMDQFID.DLL.......TKDRV...CA..T..SLWKLPPRTHLEDL-e....................................................................
A0A137PCB3_CONC2/7-170                 ..............................................l-ETWGNETTMNLNNLVYSNILT..S.PY.FK-ALMEKTT................................YQELVDEIYYH..VKYLDP..............FLKG.S--.............................................AP.SSAFCILYRC.WLVKFSVN..........QLS.EMVE......................................................HPDSP..YIRAIGFL....Y...L.....RYVCK........................PANL....ME.WFE.....PF..FEDDE.EIQLSKA--...................-----....SSQKTTIGELCR.QLL.......VDQKF...LG..T..ILPRIPVLVQKDI--ea...................................................................
A0A0D2Q6L2_9AGAR/10-173                ..............................................q-AIHGQNPQFLVETVIRNRIYE..S.TF.WKEHCFALTA................................-ESLIDKAIE-..VRFIGG..............-VYG.NQR.............................................-P.TEFLCLLLKL.LQIQPEKE..........ILV.EYLR......................................................AEEFK..YLRALAAL....Y...I.....RMTFR........................AVDV....YE.LLE.....PL..LKDYR.KLRLRNMTG...................-----....-YSLVFMDEFVY.SLL.......TEERV...CD..I..IMPRLAKRSVLEEN-g....................................................................
A0A061EDX2_THECC/3-165                 ........................................iqtcgkp-------INSLLEKVLCMNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYAAD........................PKTL....WT.WFE.....PY..IKDEE.---------...................EFPPG...sNGRMTTMGVYVR.DLL.......LGQYY...FD..T..LFPRIPVPV------lrqv.................................................................
A0A091P601_APAVI/1-108                 ...............................................----------------------..-.--.----------................................-----------..------..............----.---.............................................--.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HEERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A091IIP3_CALAN/10-194                ..............................................l-PHWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKTI--dq...................................................................
A0A0D2XW34_FUSO4/26-192                .............................................ap---NGLNPATIMEKAVKDRIVD..S.YF.YKEQCFALNE................................-ADIVDRVVEH..VNFIGG..............-TYG.VTQ.............................................KP.SPFLCLAFKL.LELSPSDA..........VLM.EYLKy....................................................gGEAFK..YLRALACF....Y...F.....RLTRQ........................AKDV....YE.MLE.....PF..LEDRR.KLRRRGRAG...................-----....-VVLTFMDEFVD.ELL.......TKERV...CG..T..SLWKMPKREVLEDL-e....................................................................
A0A091RVT0_NESNO/1-181                 ...............................................----GNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKAI--dq...................................................................
W9S3F4_9ROSA/21-93                     .............................................id----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..----IGFL....Y...L.....RYAAD........................PKTL....WT.WFE.....PY..VRDEE.---------...................EFSPG...sSGRMSTMGAYVR.DLL.......LGQYY...FD..T..LFPRIPVPVMRQ---iva..................................................................
A0A0N4UBE8_DRAME/12-155                ............................................lif----------------------..-.--.----------................................---------FQ..VKHLEP..............WERG.TRKtqgmtgmcg...........................gvrgvgaggVV.STAFCLLYKL.FTIRLSRK..........QLV.SMIN......................................................NRDSP..YIRGLGFM....Y...I.....RFCQP........................PCDL....WA.WME.....PY..LDDEE.---------...................QIDPRs..gGGDVTTIAQIVK.MML.......TKLDW...YG..T..LFPRIPVPIQKEI--ei...................................................................
A0A090MUW1_STRRB/13-194                ...........................ndsaipniqkitrgnntlpe--------------------YE..S.VY.WKEYLHSLTT................................FHQVQDEIIKK..VKYLEP..............WEHG.SRNpnsscig..............................vrgvsaggRV.TTAFCLLYKL.FTLKLTRK..........QIV.SMIN......................................................NDQNT..YLRAIGFL....Y...I.....RYCQP........................PKDL....YD.WFE.....PY..LHDKD.VILIRSRNK...................-----....--GEITIGEMLK.NLL.......TNLDF...YG..T..LLPRIPIPIQTSI--dk...................................................................
V4TZ97_9ROSI/4-144                     .......................................iqtcgkpi--------DSLLEKVLCMNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYAAD........................PKTL....WN.WFE.....QY..LKDEE.---------...................-----....------------.---.......-----...--..-..---------------lnpyrfgnsnvgsyfqllli.................................................
A0A022RAJ0_ERYGU/10-174                ...............................................KSIRGTNPQNLVEKILRTKIYQ..N.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHLGG..............-TNG.GNR.............................................RP.TPFMCLVMKM.LQIQPDKE..........IVV.EFIK......................................................NPDYK..YVRVLGAF....Y...L.....RLTGT........................DVDV....YR.YLE.....PL..YNDYR.KLRLQLNDG...................-----....KFTLTHVDEYID.ELL.......TKDYS...CD..I..ALPRIKKRWTLE---ai...................................................................
G0RPR5_HYPJQ/26-193                    ............................................lap---NGLNPATIMEKAVKDRIVD..S.YF.YKEQCFALNE................................-ADIVDRVVEH..VTFIGG..............-THG.ASQ.............................................KP.SPFLCLAFKL.LELAPSDA..........ILQ.EYLSy....................................................gGEHFK..YLRALACF....Y...V.....RLTRQ........................AKDV....YL.TLE.....PF..LEDRR.KLRRKARTG...................-----....-TTLTFVDEFVD.DLL.......TKDRV...CA..T..SLWKMPKRETLEDL-e....................................................................
T0RRR2_9STRA/9-173                     ..............................................t-HVHGVNPQHLVEKILRNRIYD..C.MY.WKEHCFGLTE................................-ETLVEKAID-..LSYIAG..............-HFG.GNQ.............................................QP.SPFLCLLLKM.LQMQPDMD..........VVM.TFIE......................................................NGDYK..YVTALGAM....Y...L.....RLTGK........................PVEI....YP.VLE.....NL..LSDYR.KVRFRKTMG...................-----....-WDVLHMDEVAD.LLL.......REEYF...CN..I..ALPRLVDRFQLES--mn...................................................................
M2Z5Y8_PSEFD/16-183                    .............................................vl--IRGDNPLKLFEKPVRDRIVD..S.YY.WKEQCFGLNA................................-ATLLDRAVE-..LTFIGG..............-TYG.VAQ.............................................KP.TPFLCLAFKL.LQLTPERE..........IIM.FYLEk....................................................gGEEYK..YLRALAAF....Y...I.....RIAWE.......................kDEEV....YT.TLE.....PY..LADSR.KLKRRTREG...................-----....-WALTHVDEFID.DLL.......TKSRV...CA..T..TLPKINPRLWLEDE-d....................................................................
A0A0N4Z164_PARTI/30-211                ............................................lpe---YGNRQTMNLNNLVYTNIIE..S.VY.WKEYLHSLTT................................FHQVQDEIIKK..VKYLEP..............WEYG.SRNhnsscig..............................vrgvsaggRI.TSAFCLLYKL.FTLKLTRK..........QIV.AIIN......................................................NEQNT..YLRVMGFL....Y...I.....RYCQP........................PKDL....YD.WYE.....PY..LNDKA.FVT------...................-IKSK....NGHDVTIGEILK.HLL.......TNLDW...YG..T..LLPRIPVPIQN----iidk.................................................................
B3L5D4_PLAKH/10-175                    .............................................ik--IFGSNPQYLISNIIRSKIYE..S.PY.WKEKCFALTS................................-ESIIDQAVN-..LKYVGG..............-TYG.GNR.............................................KP.TRFLCLVLKL.LQIQPDKD..........IIY.EYIK......................................................NEEFI..YLRALGIF....Y...L.....RLIGK........................SLEI....YR.YLE.....PI..LFDYR.KMRIRLQNG...................-----....TFEKIYMDVFVD.NCL.......VMNNF...LD..V..DFPSLTKRQVLEDN-n....................................................................
F0YB92_AURAN/58-222                    .............................................fd--LHGNPDTFNLHPMLHEKIDE..S.EY.YK-CLFVFKT................................FDKVVDVIYEK..VTYVEP..............WAAG.STR.............................................SP.SSAYCLLLKL.FHLRLTEI..........QVK.ALLD......................................................HGDSP..YIRALGAL....Y...V.....RYGCA........................PERT....WH.WLG.....HY..ADDLE.---------...................EFAPGl..nPNQTTTFGAYCV.KLM.......TDLQY...FS..T..MLPRIPVAIE-----rrlk.................................................................
I4Y8C3_WALMC/10-173                    ..............................................s-SVHGRNPQHLIENVIRQRIYE..S.AY.WKEQCFALTA................................-ETIIDKAVE-..MQSIGG..............-VYG.NLR.............................................-P.LPFICLLLKL.LQLQPEPE..........IIL.EYLQ......................................................AVEFK..YLRALAAM....Y...T.....RLCFN........................SYQV....FD.ILE.....PL..LQDYR.KLRLRNNSG...................-----....-YHITHMDEFVD.ELL.......TEERV...CD..I..ILPRLTKRDVLEQ--vh...................................................................
D3BAL0_POLPA/67-160                    ...............................................KTVHGKNPTSLVEKIVRIKIQS..H.PY.WKEKCMGLNE................................-STLVDRAMS-..LNSFGG..............-TFG.GNK.............................................QP.THFLCLMLKM.LQIQPSMD..........IVV.EFIT......................................................NEDFK..YLE-----....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------ply..................................................................
M3D6M0_SPHMS/19-186                    .............................................tl--IRGDNPLKLFEKAVRDRIID..S.YY.WKEQCFGLNA................................-ATLLDRAVE-..LSFIGG..............-TYG.AAQ.............................................KP.TPFLCLAFKL.LQLTPERE..........IIT.FYLEk....................................................aGDEFK..YLRALAAF....Y...I.....RLAWE.......................kDEEV....YT.TLE.....PF..LADGR.KLKRRVREG...................-----....-WALTHMDEFID.DLL.......TKTRV...CA..T..TLPKINTRLHLEDA-d....................................................................
X6N3G1_RETFI/102-235                   ..........................................lpveh------DTHYNMQQLLAENILS..S.DY.FK-SLYRYKT................................YHEVIEEVKNH..CKNLEP..............RMSG.FSR.............................................KP.STAFCILYKF.FTMNLTVR..........QVK.GLLD......................................................DYENP..FVRGIGFL....Y...L.....RYLLN........................AKDL....WK.WFE.....PY..FDDNQ.---------...................-----....------------.---.......-----...--..-..---------------lfqpfdngdsivph.......................................................
A0A0B2QJB0_GLYSO/10-175                ...............................................KSIRGTNPQNLVEKILRSKIYQ..N.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHLGG..............-TYG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKE..........IVI.EFIK......................................................NEDYK..YVRILGAF....Y...L.....RITGS........................DIDV....YR.YLE.....PL..YNDYR.KLRRKLADG...................-----....QFTLTHVDEVID.ELL.......TKDYS...CD..I..ALPRVKKRWTLES--lg...................................................................
G3IJU9_CRIGR/2-120                     .........................................cggvrg----------------------..-.--.----------................................-----------..------..............--VG.TGG.............................................IV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDST..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....PF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
A0A0J0XCS7_9TREE/8-171                 ..............................................q-TVHGGDPQNLVEKVIRARIYD..S.TY.WKEHCYTLNA................................-ETLIDKAIA-..LHAIGG..............-VYE.-RQ.............................................TP.TPFMCLLLRL.LQLQPENE..........ILF.EYLL......................................................AEEFK..YLRALAVM....Y...I.....RLTFR........................SMEV....YE.ILE.....PL..MKDYR.KLRYRQVGG...................-----....-YTLTTFDEFID.ELL.......TQDRV...CD..I..ILPRLTQRAVLEET-e....................................................................
U6J7B2_ECHGR/27-211                    ..............................................l-KLWGNQVTMNINPMIHTNIIQ..S.PY.FKTNLIELKT................................YHEVIDEIYYK..VTHLEP..............WERN.SRRmggqtgmcg...........................gvrgvgaggIV.STAYCLLFKL.FTLKLTRK..........QLK.GLLE......................................................HPDSP..YIRALGFM....Y...I.....RYCLP........................PEDL....WM.WFA.....PY..LDDEE.---------...................EIDVRa..gGGCSMTIGAMLG.QWL.......TKLDW...FS..T..LFPRIPVPVQKKID-e....................................................................
H3ERC6_PRIPA/1-44                      ...............................................----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..-------M....Y...V.....RLTMT........................SVEQ....YK.LLE.....PL..YNDYR.KLRWMNKMG...................-----....------------.---.......-----...--..-..---------------nrrdrrdergg..........................................................
M7BW90_CHEMY/1-176                     ...............................................---------MNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
C0NU08_AJECG/21-213                    ..............................................l--IRGVNPATLFEKAVRDRITE..S.YY.WKEQCFGLNA................................-ATLCDRAAE-..LSYIGG..............-TYG.LAQ.............................................KP.TPFLCLAFKL.LQLAPEKE..........IVL.EYLNfhdpenghvegsem.........................ngleeeqggasvvkaVGDFK..YLRALAAF....Y...I.....RLTFD........................AADI....YK.SLE.....PL..LTDYR.KLKRRMKDG...................-----....-FVLTYIDQFVD.DLL.......TKDRV...CG..T..SLWKLPSRHQLEDL-d....................................................................
A0A0P7UMF5_9TELE/30-214                ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VSHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PADL....WD.WFE.....SF..LDDEE.---------...................ELDVKa..gGGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKAI--dq...................................................................
A0A139GXK9_9PEZI/19-186                .............................................vl--IRGDNPLKLFEKPVRDRIVD..S.YY.WKEQCFGLNA................................-ATLLDRAVE-..LTFIGG..............-TYG.VAQ.............................................KP.TPFLCLAFKL.LQLTPERE..........IIT.FYLEk....................................................gGEEYK..YLRALAAF....Y...I.....RVAWE.......................kDEEV....YT.TLE.....PY..LADSR.KLKRRTREG...................-----....-WALTHVDEFID.DLL.......TKSRV...CA..T..TLPKINPRLWLEDE-d....................................................................
L8GYB7_ACACA/10-175                    ...............................................KTVHGTNPQFLLEKILRNRIYN..N.PY.WKGDCFGLTA................................-EGLAEKAME-..LKNFGG..............-TYG.GNR.............................................KP.THFMCLVLKM.LQIQPERE..........IVH.EFIK......................................................NEEHR..YVRMLGAF....Y...L.....RLVGK........................PQEI....YN.LLE.....PL..YVDWR.KVRKKVESG...................-----....GSQITHVDEFID.ELL.......HANYS...CD..V..VLPFLPKRYTLEQQ-e....................................................................
F4X868_ACREC/10-175                    ...............................................KSIRGTNPQYLIEKIIRSRIYD..S.KY.WKEECFALTA................................-ELLVDKAME-..LRFLGG..............-VYG.GNV.............................................KP.TPFLCLILKM.LQIQPEKD..........IIV.EFIK......................................................NEEFK..YVRALGAL....Y...M.....RLTGS........................SLDC....YK.YLE.....PL..FNDNR.KLRIQNKQG...................-----....VFELVHMDEFID.NLL.......RDERC...CD..V..ILPRIQKRHVLEEN-n....................................................................
A0A0A1NVB9_9FUNG/9-173                 ..............................................l-ETWGNETTMNMNAIIYQNILS..S.PY.FR-SLYEKKT................................FHEIVDEIYNE..VTVLTP..............FIKG.-N-.............................................QP.STAFCLLFKL.WTIRLTIR..........QIE.NLVE......................................................HGDSP..YIRAIGFL....Y...L.....RYVCA........................PAKL....WD.WFQ.....YY..LEDDE.EIAI-----...................----Ss.glHPTKVTVGNLIR.MLI.......TELKF...QG..T..MLPRIPIPIAR----dlek.................................................................
A9RTY4_PHYPA/10-175                    ..............................................r-SVHGTNPQNLVEKILRSKIYQ..N.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHFGG..............-TYG.GNR.............................................KA.TPFMCLTLKM.LQIQPEKE..........IVV.EFIK......................................................NEDYK..YVRILGAF....Y...L.....RLVGK........................PTDV....YQ.YLE.....PL..YNDYR.KLRRRTSEG...................-----....GYILARVDEFID.ELL.......TTEYS...CD..I..ALPRVPKRWTLET--tg...................................................................
A0A0A8L5Y3_9SACH/14-213                ..............................................k-RLNHQSASLVVPQIFRNKVSS..C.MY.YKVNLTAASLrg............................dtIVQLIPVIVRD..LGTLNDrkr........phlTVLG.GVE.............................................--.--FKCLLMKL.INLRPPWE..........QLK.VLLEp...................................................hePFNNK..YVAALILT....Y...L.....RVSYYfltetn...........pseqdisFSLL....HG.LMK.....TY..IRDHR.KLKGYPLNIdc...............wsSSV-K...kEIKLIHFDELID.WLC.......EKNEI...WG..I..PLGKCNWCKIWE---dee..................................................................
A0A077ZK60_TRITR/10-192                ..............................................s-TVKGTNPQYLIEKVVRSRIYD..S.RY.WKEECFALSA................................-ELLVDKGME-..LRFVGG..............-VFG.GNV.............................................KP.SPFLCLQLKM.LQIQPDKE..........IVI.EFIR......................................................QEDSK..YIRALGAM....Y...L.....RLTFS........................SIEV....YQ.YLE.....PL..LNDYR.KLRWMSKQGsqlrff.......tatkhaQL--El..iEFELMHMDEFVD.RLL.......REERF...CD..I..QLPRLQKRDVLEE--tg...................................................................
A0A0D2VQS3_CAPO3/6-173                 ..............................................l-ELWGNQQTMNLNLLLHQNILS..A.RY.YKEDLSELNT................................YQELIDEIFNS..VSDLEP..............FMPG.GGT.............................................KA.SSAFCLLYKL.FVLRLTEN..........QLT.AMLN......................................................HADSP..FIRAIGFL....Y...L.....RYCTP........................PKDL....WD.WFE.....PY..LEDQE.PIKLQWAAS...................-----....-AQPTTIGEFVR.GLL.......VDSKF...LG..T..LLPRIPVPITKEIQ-a....................................................................
A0A165Z6Q5_9HOMO/10-173                ..............................................i-QIHGQNPQYLIETVIRNRIYD..S.NY.WKEHCFALTA................................-ETLIDKAIE-..VKCIGG..............-VYG.N-Q.............................................KP.TEFICLLQKL.LQIQPEKE..........ILV.EYLQ......................................................ADEFK..YLRALAAM....Y...I.....RMTFN........................AVEV....YD.LLE.....PL..LKDFR.KLRQRSVAG...................-----....-YSLTYMDEFAD.ALL.......REERV...CD..I..ILPRIAKRSVLEE--lg...................................................................
A0A183L565_9TREM/10-101                ..............................................h-TVHGTNPQYLLEKIVRSRIYE..S.KF.WKEHCFALTA................................-ELLVDKAVE-..LRYVGG..............-VYS.GSV.............................................KP.TPFLCLTLKM.LQIQPDKD..........IVI.EFIK......................................................QEPYK..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------lvcg.................................................................
A0A0M3K6D9_ANISI/10-174                .............................................vt--VKGTNPQYLVEKIIRTRIYD..S.KY.WKEECFALTA................................-ELIVDKGME-..LRYVGG..............-IYA.GNV.............................................KP.TPFLCLSLKL.LQIQPEKD..........IIV.EFIR......................................................QEDYK..YIRALGAM....Y...L.....RLTFS........................SIEV....YK.YLE.....PL..YNDYR.KLRYMNKEG...................-----....RFELIYMDEFVD.NLL.......REERY...CD..I..QLPRLQGRQALE---qi...................................................................
E7Q418_YEASB/15-219                    ...............................................KQLNNQSVSLVIPRLTRDKIHN..S.MY.YKVNLSNESLrg............................ntMVELLKVMIGA..FGTIKGqng.......hlhmMVLG.GIE.............................................--.--FKCILMKL.IEIRPNFQ..........QLN.FLLNvk.................................................nenGFDSK..YIIALLLV....Y...A.....RLQYYylngn.............nkndddENDL....IK.LFKvq.lyKY..SQHYF.KLKSFPLQVdc...............faHSYNE....ELCIIHIDELVD.WLA.......TQDHI...WG..I..PLGKCQWNK------iynsde...............................................................
N1PRZ9_DOTSN/19-186                    ..............................................k-LIRGDNPLKLFEKPVRDRIVD..S.YY.WKEQCFGLNA................................-ATLLDRAME-..LSFIGG..............-TYG.IAQ.............................................RP.TAFLCLAFKL.LQLTPEKD..........IIL.FYLQq....................................................aGEEFK..YLRALAAF....Y...I.....RLAWE.......................kDEEV....YT.TLE.....LY..MSDGR.KLKRRTRES...................-----....-FGLIHIDEFID.DLL.......LKTRV...CA..T..TLPKINPRTFLEDE-d....................................................................
A0A0U1LW96_9EURO/21-204                ..............................................l--VRGVNPITLFEKAVRDRITD..S.YY.WKEQCFGLNS................................-ATLCDRAIE-..LTSIGG..............-TYG.LSQ.............................................KP.TPFLCLAFKM.LQLAPERD..........IVL.EYLNftdpgsgdea..................................aendeevvkgKGDFK..YLRALAAF....Y...I.....RLTFE........................PVDI....YK.YLE.....PL..LLDYR.KLKQRRREN...................-----....-YILTNMDQFID.TLL.......TKDRV...CA..T..SLWKLPPRQQLEDL-d....................................................................
D8LWJ8_BLAHO/10-174                    ..............................................d-KVRGQNPQNVIEKITRMKIYD..C.DY.WKERCFGLSA................................-VTILDRMIE-..LDHIGG..............-AYS.GVF.............................................RP.TPFICLVLKL.LQIGPDKE..........IVY.SFID......................................................NDDYK..YITAVGLF....Y...L.....RLVGT........................SLEI....YK.HLE.....PY..YNDYR.KLRLLTPTG...................-----....-WSIIHMDEFVE.MLL.......EDEIA...LD..I..SLPHLDKRHVLEA--rg...................................................................
C5MCZ6_CANTT/17-194                    ............................................dkr---YTQNKGNLIEPIIRHRIQD..S.IF.YKQHLYLTNE................................-STILPVIIDH..VKYISG..............--TD.SSN.............................................RP.SNFICCLFRL.LELEPTKE..........IIN.VYLTq...................................................lnFNEFK..YLTALTLI....Y...I.....RLVFK........................NEDI....YT.IFD.....SY..FKDFR.KIRMKLKNPif...............dsNQIPK....NYKISYIDEWVD.DLL.......TKDRV...ID..L..ILPRLVPRLTLV---qrg..................................................................
M5W7Z5_PRUPE/24-176                    ..............................................i----------------------..-.--.--EQCFGLTA................................-ETLVDKAME-..LDHIGG..............-TFG.GNR.............................................KP.TPFMCHVMKM.LQIQPAKE..........IVI.EFIKnddyni.........................................fpkvniyYVHFK..YVWILGAF....Y...L.....RLTGT........................ETDV....YQ.YLE.....PL..YNDYR.KLRRNLADG...................-----....NYALTHVDEVID.ELL.......TKDYS...CD..I..AMPRIKKRWTLEA--tg...................................................................
W7TQL1_9STRA/10-174                    ..............................................t-TVHGTNPQFLIEKILRQKIYN..S.LY.WKEHCFGLTA................................-ETLVDKAVG-..LKAYGG..............-QYG.GMQ.............................................KP.TKFMCLVLKM.LQLQPEKE..........IVV.EFIK......................................................NEDYK..YLRVLGAF....Y...L.....RLVGK........................PLDI....YQ.YLE.....PL..YNDYR.KLRFRGVAG...................-----....-WALKHMDEFIE.ELL.......TSDYC...CD..V..ALPHLPKRHLLEDQ-k....................................................................
A4I1H4_LEIIN/271-441                   .fdaelwgvleskltdelveqvrrsgaapnggrlftafeqheqnvka----------------------..-.--.----------................................---VLRYCEQN..VRYAGV..............--FD.DNE.............................................EA.SPFLLAMGLC.WRLGLTMD..........DVC.RHFA......................................................RHPRR..VVRALALY....L...A.....RYTLA........................PEDY....VY.FFI.....PS..LCDEV.IIACTEDAQ...................-----....--VTFSMKDLSR.QLL.......TKNDV...VD..A..WLPILSKHWQ-----edv..................................................................
A0A024G6E6_9STRA/44-209                ..............................................l-PIYGNTTTYNLNTLLYQNILH..S.DY.FR-QLFNLKT................................YHEIVDEIYYR..VDNAEP..............LCPG.TAR.............................................IP.STCFCLLLKC.FTMRLTMR..........QMQ.GLLK......................................................HTDSP..YIRVVGFL....Y...I.....RYACD........................PEKL....WS.WFE.....PF..LDDQE.---------...................AFNASa..nVNVQTTIGAWLK.SIL.......EENNY...FG..T..ILPRIPKKIQD----sikv.................................................................
I6ND91_ERECY/14-229                    ...............................................KQLNHQSTSLVIPKITRLRIHN..S.MY.YKVNLHPASLrg............................etMKHVSKVMIRE..LGTCKNr............sTVSG.TAC.............................................GT.VEFQCLLMKM.VEIRPTWS..........QLH.LMLQlddc.............................................sekagPFNNK..YIVVLILV....Y...L.....RIQYYylvnkgteeik.plsnldttgdidAGKI....KT.LFA.....HF..LRDCR.KIKSINLHDdp...............wsTSIQK....RVDIYHIDEIVD.WLC.......TNDSI...WG..V..PLGKCPWLIEI----leae.................................................................
W4XFI6_STRPU/10-175                    ..............................................r-SIKGKNPQYLVEKITRSRIYE..S.RY.WKEECFALSA................................-ELLVDKAME-..LRFIGG..............-TYG.GNI.............................................KP.SPFLCLLLKM.LQIQPEKD..........IVI.EFIK......................................................NEDFK..YVRCLGAL....Y...I.....RLVGE........................GLDV....YK.YLE.....PL..YNDYR.KIRRQDKIG...................-----....GYFLSHVDEFID.ELL.......NEERV...CD..I..ILPRVQKRHILEET-e....................................................................
R1CRP3_EMIHU/49-231                    ..........................................dpvhg------APAFNINPMLLEGIRM..GdRF.WE--LAKLTT................................FGEVVDAIFYE..VKYVTP..............WVPG.THGkrssgmqs............................avrgvsnagTP.GIAYTMLLKL.FLLRLTRD..........QVR.SLLR......................................................HPDSP..YIRAIGFL....Y...L.....RLGLY.......................dFKEL....WA.WFQ.....PY..LGDDD.-------QF...................FIDGT....PATATTIGEFVR.RLM.......TDQDF...FG..D..RLPRLPVLVSRQI--ed...................................................................
A0A0D2A1B5_9EURO/20-185                ..............................................l--VRGQNPALLLETAMRDRITD..S.LY.WKEQCFGLNA................................-ATLCDRAVE-..LTYIGG..............-TYG.VAM.............................................KP.TPFICLAFKL.LTLVPDRE..........IVL.EYLQn....................................................gGEEWK..YLRALAAF....Y...V.....RLTFE........................PADV....YK.TLE.....PF..LEDSR.KLRQRRKES...................-----....-YVLIHMDEFVD.NLL.......MKDRV...CG..T..SLWKMPARQLLEDL-e....................................................................
B8MD54_TALSN/21-183                    ..............................................l--VRGVNPVTLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAIE-..LTSIGG..............TIVL.EYL.............................................NF.TDPGSG----.DEENPEDT..........EIN.GEVVk....................................................gRGDFK..YLRSLAAF....Y...I.....RLTFE........................AAEI....YK.YLE.....PL..LLDYR.KLKRRMREN...................-----....-YVLTTMDQFID.DLL.......TKDRV...CA..T..SLWKLPSRQMLEDL-d....................................................................
A0A0N4T6E4_BRUPA/10-175                .............................................vt--VKGTNPQYLVEKIIRTRIYD..S.KY.WKEECFALTA................................-ELLVDKGME-..LRYIGG..............-IYA.GNV.............................................KP.TPFLCLCLKM.LQIQPEKD..........IAV.EFIR......................................................QEEYK..YIRALGAM....Y...I.....RLTFT........................SIEV....YK.YLE.....PL..YNDYR.KLRMMNNEG...................-----....RFEIVHMDEFID.NLL.......RDERY...CD..I..HLPRIQKRITLEE--vg...................................................................
J9J8A1_9SPIT/306-471                   ..............................................h-QVHGTNPQFLIDKIIRLKIHN..D.PY.YKEKCFALTA................................-ETLVDRAIE-..LKYVGG..............-TYG.GVR.............................................RP.SKFLCLILKM.LQIQPDTD..........IIL.EFIK......................................................NEDYK..YIRALGAF....Y...W.....RLTAQ........................GKDV....YK.VLE.....PL..YKDYR.RIAFRKEEG...................-----....RFEVMHIDEYID.HLI.......RDEIF...CE..V..QLPRINKRYVFEE--dg...................................................................
R0F627_9BRAS/1-113                     .............................................mg----------------------..-.--.----------................................-----------..------..............---G.NCR.............................................GP.SSAYCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HTDSP..YIRAVGFL....Y...L.....RYVAD........................SKTL....WT.WYE.....PY..INDDE.---------...................EFSPG...sNGRMTTMGVYIR.DLL.......LGLYY...FD..T..LFPRIPVPVMRQ---ivs..................................................................
A0A087H484_ARAAL/10-175                ...............................................KNIRGTNPQNLVEKIVRTKIYQ..H.TF.WKEQCFGLTA................................-ETLVDKAME-..LDHVGG..............-TFG.GNR.............................................KP.TPFLCLILKM.LQIQPEKD..........IVV.EFIK......................................................NDDYK..YVRILGAF....Y...L.....RLTGS........................DIDV....YR.YLE.....PL..YNDYR.KVRQKLSDG...................-----....RFSLTHVDEVIE.ELL.......TKDYS...CD..I..AMPRLKKRWTLEQN-a....................................................................
A8NG64_COPC7/10-173                    ..............................................k-AIHGQNPQFLVETVIRNRIYD..S.SY.WKEHCFALTA................................-ESIIDKAIE-..VKYIGG..............-VYG.NQR.............................................-P.TEFVCLLLKL.LQIQPEKE..........ILI.EYLR......................................................ADEFK..YLRALAAL....Y...I.....RMTFR........................PVEV....YE.LLE.....PL..LKDYR.KLRQRTMTG...................-----....-YTLTFIDEFVY.ALL.......TEERV...ID..L..ILPRLPKREILEEN-g....................................................................
G6CYI7_DANPL/22-206                    ..............................................l-PIWGNEQTMNLNPLILANIQG..S.SY.FKVHLFKLKT................................YHEVVDEIYYQ..VKHLEP..............WERG.SRKtagqtgmcg...........................gvrgvgaggIV.STAFCLLYKL.YTLRLTRK..........QVN.GLLQ......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PADL....FD.WYV.....DY..LDDEE.---------...................EVDPRa..gGGGSTTIGALVR.QML.......IKLDW...FS..T..LFPRIPVPIQKQIE-q....................................................................
A0A067LVA7_9HOMO/10-173                ..............................................l-SIHGTNPQFLIEKVIRSRIYE..S.PF.WKEHCFALTA................................-ESLIDKAIE-..LNSIGG..............-VYG.N-Q.............................................KP.TQFMCLLLKL.LQIQPEKE..........ILV.EYLQ......................................................AEEFK..YLRALAAM....Y...I.....RMTFR........................AVEV....FQ.LLE.....PL..LTDFR.KLRERSMAG...................-----....-YTLTYMDEFVY.ALL.......TEERV...CD..T..ILPRITKREVLEET-e....................................................................
A0A0G2H3B7_9PEZI/20-207                .............................................al--IRGQNPALLFEKAVRDRITE..S.YY.WKEQCFGLNA................................-ATLCDRAAE-..LTFVGG..............-TYG.GLG.............................................KP.TPFLCLAFKL.LQLVPEKE..........IIL.AYLNwpgdeeegmeg...............................dededesrapgvKGEFK..YLRALAAF....Y...I.....RLAWE........................PPEI....YK.TLE.....PL..LADYR.KLKRRMRDG...................-----....-FTLTYVDQFVD.DLL.......TKDRV...CA..T..SLWKMPSRTLLEDL-d....................................................................
A0A0E0PI94_ORYRU/3-166                 ............................................iqt---SGKPIDLLMEKVLCMNIMS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKIL....WT.WYE.....PY..LKDDE.---------...................EFSPG...sNGRMTTMGVYVR.DLI.......LGQYY...FD..S..LLPRVPLP-------vfrqvt...............................................................
W4FS00_9STRA/9-173                     .............................................fs--VHGVNPQHLVEKILRNRIYD..S.MY.WKEQCFGLTA................................-ETLVDKAIE-..LTHIGG..............-HFG.GNQ.............................................QP.TPFLCLLLKM.LQIQPDME..........IVV.EFIK......................................................NGDYK..YVTMLGAF....Y...L.....RLVGK........................PTDV....YP.ILE.....EL..LADYR.KIRKRNTLG...................-----....-WEMLHVDEVAD.ILL.......KEEYF...CD..I..ALPHLVDRYQLEA--sn...................................................................
A0A0D1ZHM0_9EURO/19-185                .............................................pl--IRGQNPALLLETAMRDRITD..S.LY.WKEQCFGLNA................................-ATLCDRAVE-..LTHIGG..............-TYG.VAM.............................................KP.TPFICLAFKL.LTLVPDRE..........IIL.EYLNv....................................................gGEEWK..YLRALAAF....Y...V.....RLTFD........................PPMV....YK.TLE.....PF..LEDSR.KLRQRRKEA...................-----....-YVLVHMDEFVD.NLL.......TKERV...CG..T..SLWKLPARQLLEDL-d....................................................................
S2JJG8_MUCC1/10-170                    ..............................................l-ETWGNETTMNLNAIIYQNILS..S.PY.FR-SLYNKKT................................FHEIVDEIYNE..APFVKG..............----.-T-.............................................QP.STAYCCLFKM.WTLRLTIK..........QIE.NMID......................................................HVDSP..YIRAIGFL....Y...L.....RYVCA........................PAQL....WD.WFQ.....YY..LEDEE.EITI-----...................----Ss.gvNPTKITIGKLCR.MLI.......TEQKF...QN..T..MLPRIPVPIAR----dlek.................................................................
A0A0T6B203_9SCAR/10-175                ...............................................KSVHGTNPQYLIEKIIRSRIYD..S.KY.WKEECFALTA................................-ELLVDKAME-..LRYIGG..............-VHS.GNI.............................................KP.APFLCLTLKM.LQIQPEKD..........IVV.EFIK......................................................NEEFK..YVRALGAY....Y...M.....RLTGS........................SLDC....YK.YLE.....PL..YNDNR.KLRRQNRQA...................-----....EFELVHMDEFID.ELL.......RGDRV...CD..V..ILPRIQKRIVLEEN-n....................................................................
G9NT24_HYPAI/26-193                    ............................................lap---NGLNPATIMEKAVKDRIVD..S.YF.YKEQCFALNE................................-ADIIDRVVEH..VSFIGG..............-THG.ASQ.............................................KP.SPFLCLAFKL.LQLAPSDA..........IIQ.EYLSy....................................................gGEHFK..YLRALACF....Y...V.....RMTRQ........................AKDV....YT.TLE.....PF..LEDRR.KLRRKARAG...................-----....-TSLTFVDEFVD.DLL.......NKDRV...CA..T..SLWKMPKREVLEDL-e....................................................................
M2S990_COCSN/23-231                    .............................................al--IRGQNPALLFEKGVRERITE..S.YY.WKEQCFGLNA................................-ATLCDRAAE-..LKFIGG..............-TTG.ITG.............................................KP.TPFLCLAFKM.LQLVPDKE..........IVL.EYLNfrddeddeddkddkaevkreng..........dtaadddddsakkeldlnaagkLGCFK..YLRCLAAF....Y...I.....RLAWE........................PVEI....YK.TLE.....PL..LTDYR.KIKRRLKDT...................-----....-FTLTHVDQFID.DLL.......TKDRI...CA..T..SLWKLPSRAILEDL-d....................................................................
M5XBU6_PRUPE/4-166                     ........................................qtcgkpi--------DSLLEKVLCMNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HEDSP..YIRAVGFL....Y...L.....RYAAD........................PKTL....WN.WVE.....PY..IKDEE.---------...................EFSPG...sNGRTTTMGVYVR.DLL.......LGQYY...FD..T..LFPRIPVPVL-----rqiv.................................................................
W7MMC8_GIBM7/26-192                    .............................................ap---NGLNPATIMEKAVKDRIVD..S.YF.YKEQCFALNE................................-ADIVDRVVEH..VNFIGG..............-TYG.VTQ.............................................KP.SPFLCLAFKL.LELSPSDA..........VLM.EYLKy....................................................gGEAFK..YLRALACF....Y...F.....RLTRQ........................AKDV....YQ.MLE.....PF..LEDRR.KLRRRGRAG...................-----....-VVLTFMDEFVD.ELL.......TKERV...CG..T..SLWKMPKREVLEDL-e....................................................................
G2WYK7_VERDV/26-193                    ............................................lap---NGENPAKIMEKAVIGRIVD..A.QY.FQYQCFALNE................................-AGIVDRVVND..VKFIGG..............-TYG.SAQ.............................................KP.TPFLCLAFKL.LQLAPSDD..........VLE.TYLSf....................................................gGDKFK..YLRALACF....Y...I.....RMTRR........................ARDV....YA.ILE.....RY..LVDRR.KLRRKGRQG...................-----....-TSLTFVDEFVD.DLL.......TKTRV...CA..T..SFRELPRRTDLVD--lg...................................................................
J9HJD8_AEDAE/67-225                    ..............................................n----------------------..-.--.--VSLFKLKT................................YHEVVDEIYYQ..VKHLEP..............WERG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAFCLLYKL.YTLRLTRK..........QVN.GLLT......................................................HGDSP..YIRALGFM....Y...L.....RFTQP........................PADL....YD.WYE.....PY..LLDEE.---------...................EIDVKa..gGGQTMTIGQMIR.QWL.......TKLDW...FS..T..LFPRIPVPIQKQNE-s....................................................................
F8Q691_SERL3/10-173                    ..............................................q-AIHGQNPQFLVETVIRNRIYE..A.TY.WKEHCFALTA................................-ETLIDKAIE-..VRFIGG..............-VYG.NQR.............................................-P.TEFLCLLLKL.LQIQPEKE..........ILV.EYLQ......................................................ADEFK..YMRALAAM....Y...I.....RMTFA........................AVDV....YE.MLE.....PL..LKDYR.KLRYRDMAG...................-----....-YSLTFMDEFIY.SLL.......TEERV...CD..I..ILPRIARRQTLEEN-g....................................................................
A0A067R513_ZOONE/39-223                ..............................................l-PLWGNERTMNLNPMILTNIQS..S.HY.FKVNLYELKT................................YHEVIDEIYYK..VTHLEP..............WEKG.SRKtagqtgmcg...........................gvrgvgaggIV.STAFCLLYKL.FTLKLTRK..........QVN.GLLT......................................................HPDSP..YIRGLGFM....Y...I.....RYTQP........................PADL....WD.WYD.....AY..LEDPE.---------...................EMDVKa..gGGQVMTIGEMLR.AFL.......TKLEW...FS..S..LFPRIPVPIQQK---lek..................................................................
C5Z170_SORBI/3-167                     ...........................................iqts----GKPIDVLMEKVLRMNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNT..VEHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HLDSP..YIRAIGFL....Y...L.....RYVAD........................PKIL....WT.WYE.....PY..LRDDE.---------...................EFSPG...sNGRKTTMGVYVR.DLI.......LGQYY...FD..S..LLPRIPLPVTRQ---ita..................................................................
S3BY96_OPHP1/26-192                    .............................................ap---NGLNPATIMEKAVRERIIE..S.YF.WKEQCFGVNE................................-ADIVDRVVDH..VSCIGG..............-TTG.TSQ.............................................KP.TPFLCLAFKL.LQLAPSDE..........ILA.AYLSq....................................................gGEKFK..YLRALALF....Y...V.....RLTRP........................AADV....FK.TLE.....PF..LADKR.KLRRKGRAG...................-----....-TQLTFVDDFVD.DLL.......TKSRV...CA..T..SLWKLPQREDLED--vg...................................................................
G3GW00_CRIGR/10-175                    ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
I1IIQ1_BRADI/10-175                    ..............................................r-SIHGTNPQNLVEKIVRSKIYQ..S.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHTGG..............-THG.GNR.............................................RP.TPFLCLTLKM.LQIQPDKD..........IVV.EFIK......................................................NEDYK..YVRVLGAF....Y...L.....RLTGT........................IADV....YQ.YLE.....PL..YNDYR.KIRQKLNDG...................-----....KFMLTHVDEFID.ELL.......TKDYC...CD..T..ALPRIQKRWVLEA--sg...................................................................
F0VM92_NEOCL/10-175                    ..............................................q-QVHGCNPQTLVSRIIRRKIYE..S.VY.WKEQCFALTA................................-ETVLEPCVA-..LTYVGG..............-TYG.GKR.............................................QP.APFLCLVLKL.LQIQPETE..........VVL.EFIK......................................................QEQFK..YLRAVGAF....Y...L.....RLVGR........................ASEV....YT.HLE.....PL..LADYR.KLRFRLPDG...................-----....KFAIVCMDEFVD.DCL.......RKTNF...LD..V..DLPVLPKREVLENE-g....................................................................
A0A0G2EGI9_9EURO/21-186                ..............................................l--IRGANPATLLETAVRDRITD..S.LY.WKEQCFGLNA................................-ATLLDRAVD-..MTYIGG..............-TYG.IGM.............................................KP.TPFLCLIFKL.LQLTPSKE..........III.EYLRm....................................................gGEEFK..YLRALAVF....Y...I.....RLTFD........................AVEI....YT.VLE.....PY..LTDYR.KLKRRRKEG...................-----....-YELTYMDQFVD.DLL.......TKDRV...CA..T..SLWKLPARQALED--lg...................................................................
A0A0G4GZA6_VITBC/10-175                ..............................................q-TVHGTNPQFLVSRIVRMKIYQ..N.QY.WKEHCFGLTA................................-ETIVDKAVE-..LQYVGG..............-TYG.GSR.............................................KP.SPFICLVLKL.LQIQPDKD..........IVL.EYVR......................................................NEEFK..YLRALGAF....Y...L.....RLTGT........................AMDV....YS.NLE.....PM..LSDYR.KLRLRGFDG...................-----....KFTVRHMDEFVD.DLL.......RQEHL...LD..V..DFPQLQNRQILEE--gg...................................................................
A0A0K0ER33_STRER/30-211                ............................................lpe---YGNRQTMNLNNLLYTNIVE..S.VY.WKEYLHSLTT................................FHQVQDEIIKK..VKYLEP..............WEHG.SRAqnsscig..............................vrgvsaggRV.TTAFCLLYKL.FTLKLTRK..........QIV.SMIN......................................................NDQNT..YLRAIGFL....Y...I.....RYCQP........................PKDL....YD.WFE.....PY..LYDKD.VLLIKSRN-...................-----....-RNEVTIGEMLK.HLL.......TNLDF...YG..T..LLPRIPIPIQISI--dk...................................................................
F0XXJ0_AURAN/10-174                    ..............................................q-EVHGTNPQRIVEKILRMKVYA..T.QY.WKEYCFGLTA................................-ETLVDRAIE-..IDHVGG..............-TYG.GIR.............................................KP.TKFMCLLLKM.LQIQPDLE..........IIV.EFIK......................................................NEEYK..YVRALGAL....Y...L.....RCVGR........................PPEV....YK.YLE.....PL..YVDYS.KLRVRTFEG...................-----....-WTITHVDEFVD.ELL.......TEDYS...CD..I..ALPHLPKRWHLEQQ-n....................................................................
A0A158P6F2_ANGCA/490-653               ..............................................h-TVRGTNPQFLVEKIIRQRIYD..S.KY.WKENCFALSA................................-DLIVDRALD-..LRYIGG..............-IYA.GNV.............................................KP.TPFLCLSLKI.LQIQPEKD..........III.EFIQ......................................................QEQSK..YARALGAM....Y...L.....RLTFT........................SVEI....YK.YLE.....PL..FNDYR.KLRYMNKQG...................-----....RFELVYMDEFID.NLL.......REERY...CD..I..QLPRLQI--------crtlfq...............................................................
A0A0G2HNQ7_9EURO/21-214                ..............................................l--IRGVNPATLFEKAVRDRITE..S.YY.WKEQCFGLNA................................-ATLCDRAAE-..LTYIGG..............-TYG.LAQ.............................................KP.TPFLCLAFKL.LQLAPEKE..........IVL.EYLNfhdpendgdedgdrn........................gleeehdgdsgvvkaVGDFK..YLRALAAF....Y...I.....RVTFD........................AAEI....YR.TLE.....PL..LADYR.KLKRRTKDG...................-----....-FTLTYIDQFVD.DLL.......TKDRV...CG..T..SLWKLPSRTQLEDL-d....................................................................
K7H0X5_CAEJA/52-236                    ..............................................l-PIWGNQVTMNLNTLVLENIRE..S.YY.YKNNLIEIDS................................FQALVEQIFYQ..VKHLEP..............WEKG.TRRlqgmtgmcg...........................gvrgvgaggVV.SSAFCILYRL.FNLRMTRK..........QLI.SMLN......................................................SRQSV..YIRGIGFM....Y...I.....RYTQP........................PSDL....WY.WLE.....PY..LDDES.---------...................EIDPRs..gGGDCMTFGMMVR.TMI.......NKLDW...YG..T..LFPRIPVPIQKEID-e....................................................................
A0A0L0SKP2_ALLMA/464-623               ............................................ggl--------QLKVEKIVRSRIYE..T.LF.WKEECFGLTA................................-ETIVDKAVE-..LNHIGG..............-QYG.TQ-.............................................TP.TKFLCLVLKL.LQIEPSYD..........IVL.EYIR......................................................DPEFK..YLRALGAF....Y...L.....RLTAN........................SLQC....YE.ELE.....PL..LVDYR.KLRFRQPTG...................-----....AYTLTTMDQFVD.DLL.......LEERL...CD..I..ILPRIQKRHVLEDK-g....................................................................
U6MKH2_9EIME/136-300                   ..............................................l-AVHGKNPQLLFSRIVRRKVYE..S.FF.WKEECFAATA................................-ATVVELAAA-..LQYVGG..............-TFG.GIR.............................................AA.SPFLCLVLKL.LQLQPEKQ..........IIL.EFIK......................................................QEDFK..YLRAVGAF....Y...F.....RLVGP........................SAEV....YV.HLE.....PL..LADYR.KLRLRLPDG...................-----....SFRVSFMDEFVD.DCL.......RKRSL...FD..V..DLPPLVQRQ------vfvlq................................................................
A0A178EG83_9PLEO/23-209                .............................................al--IRGQNPALLFEKGVRERITE..S.YY.WKEQCFGLNA................................-ATLCDRADN-..LQFIGG..............-TTG.IMG.............................................KP.TPFLCLAFKL.LQLVPEKA..........IIL.EYLNfrgdehddepe................................epeqdlnakgkLGSFK..YLRCLAAF....Y...I.....RLAWE........................PVEI....YT.TLE.....PL..LTDYR.KIKRRLKDS...................-----....-YTLTHVDQFID.DLL.......TKDRI...CA..T..SLWKLPSRANLEDL-e....................................................................
A0A024VIV8_PLAFA/160-331               .........lhfvkrkytkrklmasniqnicnfitdknknensrtkk----------------------..-.--.-------VE-................................TESIIDQAIN-..LKYVGG..............-TYG.GNR.............................................KP.TRFLCLILKL.LQIQPDKD..........IIY.EYIK......................................................NEDFV..YLRALGIF....Y...L.....RLIGK........................SLEV....YN.HLE.....PI..LFDYR.KIRMRLQNG...................-----....TFEKIYMDVFVD.NCL.......ILNNF...LD..V..DFPTLTKRQVLEEN-n....................................................................
A0A084QD51_9HYPO/25-192                ............................................lap---NGLNPANIMEKAVKDRITE..S.YF.YKEQCFALNE................................-ADIVDRVIEH..VNYIGG..............-THG.AAQ.............................................KP.SPFLCLAFKL.LELAPSDA..........ILH.EYLQy....................................................gGEHFK..YLRALACF....Y...I.....RLTRQ........................SKDV....YQ.TLE.....PF..LEDRR.KLRRKGRAG...................-----....-TSLTFLDEFVD.DLL.......TKERV...CA..T..SLWKLPSREILEDQD.....................................................................
W9WA46_9EURO/19-185                    .............................................pl--IRGQNPALLLETAMRDRITD..S.LY.WKEQCFGLNA................................-ATLCDRAVE-..LTYIGG..............-TYG.VAM.............................................KP.TPFICLAFKL.LTLVPDRE..........IVL.EYLKn....................................................gGEEWK..YLRALAAF....Y...V.....RLTFN........................AADV....YK.TLE.....PL..LEDSR.KLRQRRKEE...................-----....-YVLIHMDEFVD.NLL.......TKDRV...CG..T..TLWKLPARQVLEDL-d....................................................................
A0A0E0A4V4_9ORYZ/4-150                 ........................................qssgrpi--------DVLMEKVLSVNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.SSAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAVGFL....Y...L.....RYVAE........................PKTL....WS.WYE.....PY..IKDDE.---------...................EFSPG...sNGKMTTMGVYVR.DLL.......L----...--..-..---------------gqcpl................................................................
A0A0A1TWQ7_ENTIV/2-162                 .........................................tgverr-----------VETILRNKIYN..S.VY.WKERCFGLTS................................-DTILDEMVG-..LKEVGG..............-TYG.VMK.............................................KP.TKYITLVLKL.LTIRPDRK..........IVY.EMLR......................................................NANFK..YVRAVAAL....Y...L.....RLVSS........................SEEC....YL.FLE.....PL..YYDYR.PLKVRTGAR...................-----....SFEIITMDQFAW.NLL.......HLDYY...CD..I..SMPVLAPRSLL----saqk.................................................................
A0A0R3T8F5_HYMNN/10-175                ..............................................h-TLHGTNPQYLIEKIIRSRIYE..C.QF.WKEHCFALTS................................-ELLVDKAVE-..LKYIGG..............-TYS.GLT.............................................KP.TPFICLVLKM.LQIQPDKD..........IVI.EFIK......................................................QEDYK..YARALGAF....Y...L.....RLVGD........................SVEI....YK.YLE.....AL..YNDFR.KLKQQDTTG...................-----....KFSIIRMDEFID.QLL.......NEERA...CD..V..ILPRLQKRSVLEDS-n....................................................................
C5DR46_ZYGRC/14-208                    ...............................................KQLNHQSVSFVIPRILRDRIHN..A.MY.YRVNLNTASLrg............................dtMNCLSRILVRD..LGALKDgsv........nqvNVLG.GVE.............................................--.--FQCLLMKL.VEIKPTFD..........QLT.TMLQd...................................................deNFNNK..YIVGLILT....Y...L.....RIQYYylpv................ddpwARRC....QS.FFR.....QY..YNDYR.KLKSVQLDQdc...............wsKSQTI....NVDILHTDELVD.WLL.......VKDDI...WG..I..PLGKCQWTEIND---ddd..................................................................
A0A0L1JFH0_ASPNO/21-209                ..............................................l--VRGVNPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LTSIGG..............-TYG.VSE.............................................KP.TPFLCLAFKM.LQLNPDRD..........IVL.EYLNftdpvndeegeq.............................tateqaengvvkqQGDFK..YLRALAAF....Y...V.....RLTFD........................AVDV....YK.TLE.....PL..LLDYR.KLKRRVRDS...................-----....-VVLTYVDQFVD.DLL.......TKDRV...CG..T..SLWKLPSRQQLEDL-d....................................................................
PR38A_MOUSE/10-175                     ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LKFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFVLMHVDEFIY.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A0N5BNF5_STREA/30-211                ............................................lpe---YGNRQTMNLNNLLYTNIIE..S.VY.WKEYLHSLTT................................FHQVQDEIIKK..VKYLEP..............WEHG.SRNqssscig..............................vrgvsaggRV.TTAFCLLYKL.FTLKLTRK..........QIV.SMIN......................................................NEQNT..YLRAIGFL....Y...I.....RYCQP........................PKDL....YD.WFE.....PY..LDDKN.TIVIKSR--...................-----....NGSEVTIGEMVT.QLL.......TNLDF...YG..T..LLPRIPVPIQN----iidk.................................................................
M7TF93_EUTLA/22-189                    ............................................lap---NGLNPATIMEKAVRERIVD..S.YF.YKEQCFGLNE................................-ADVVDRVVEH..VSFIGG..............-TYG.STQ.............................................KP.SPFLCLAFKL.LQLAPDDA..........VLQ.EYLAf....................................................gGERFK..YLRVLAAF....Y...V.....RLTRR........................AEHV....YA.ILE.....PF..LEDRR.KLRRKARAG...................-----....-TSLTFVDQFVD.ELL.......TKERV...CA..T..SLWQMPKREILEDL-d....................................................................
M1VHD9_CYAM1/26-187                    .............................................ar---------------LREQTRH..C.TF.YRTYCFKASL................................-KQLEEVTEEH..VTYVGD..............--CA.ALP.............................................-P.SPFLCVLLAY.DCCSPSRE..........EVA.AHLD......................................................CSKNV..YWRAIVAT....W...I.....RWKES.......................rAEQV....YQ.LLD.....PL..YRDYR.PIKVRQKDN...................-----....SYHNSYLDVFID.QLL.......R----...--..-..---------------yrcalvsleepfvldvipfphlppryelear......................................
A0A0K0FMJ1_9BILA/30-211                ............................................lpe---YGNRQTMNLNNLLYTNIIE..S.VY.WKEYLHSLTT................................FHQVQDEIIKK..VKYLEP..............WEHG.SRNqssscig..............................vrgvsaggRV.TTAFCLLYKL.FTIKLTRK..........QIV.SMIN......................................................NEQNT..YLRAIGFL....Y...I.....RYCQP........................PKDL....YD.WFE.....PY..LDDKN.TIVIKSR--...................-----....NGSEVTIGEMVT.QLL.......KNLDF...YG..T..LLPRIPVPIQN----iidk.................................................................
Q2U457_ASPOR/21-209                    ..............................................l--VRGVNPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LTSIGG..............-TYG.VSE.............................................KP.TPFLCLAFKM.LQLNPDRD..........IVL.EYLNftdpvndeegeq.............................taaeqaengvvkqRGDFK..YLRALAAF....Y...V.....RLTFD........................AVDV....YK.TLE.....PL..LLDYR.KLKRRVRDS...................-----....-VVLTYVDQFVD.DLL.......TKDRV...CG..T..SLWKLPSRQQLEDL-d....................................................................
B7P4Y8_IXOSC/14-198                    ..............................................l-PLWGNEKTMNLNNLILTNILS..S.PY.FKVNLYKLKT................................YHEVVDEIYYN..VQHLEP..............WEKG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAFCILYKL.FTLKLTRK..........QLN.GLMN......................................................HCDSP..YIRALGFM....Y...I.....RFTQP........................PADL....VD.WYE.....PY..LDDEE.---------...................ELDVKa..gGGQTLRMGDMLR.HFL.......TKLEW...FA..T..LFPRIPVPIQKEIE-r....................................................................
A0A086TDT6_ACRC1/24-191                ............................................lap---NGLNPATIMEKAVRDRIVD..S.YF.YKEQCFALNE................................-ADIVDRVVEH..VRFIGG..............-THG.ASQ.............................................RP.SPFLCLAFKL.LELAPSDA..........ILD.AYLRh....................................................gGEHFK..YLRALACF....Y...L.....RLTRP........................GKDV....YE.MLE.....PY..LEDRR.KLRRKGRQG...................-----....-TSLTYVDEFVD.DLL.......TKDRV...CA..T..SLWKMPKREVLEDL-e....................................................................
A0A0C9ZG06_9HOMO/97-159                .............................................wa----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................-HQV....YE.ILE.....PL..MKDYR.KLRYRDMAG...................-----....-YSLVFFDEFIY.QLL.......NDERV...CD..I..ILPRLPKRQILEE--sg...................................................................
C5L5B5_PERM5/95-139                    .............................................ag--AHGGNPQFLISQIVRDRVYS..L.RY.WKEECFGLNA................................-ETILDKAAE-..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------l....................................................................
A0A0A0LFY3_CUCSA/10-175                ...............................................KSIRGTNPQNLVEKILRSKIYQ..N.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHLGG..............-TYG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKE..........IVI.EFIK......................................................NEDYK..YVRVLGAF....Y...L.....RLTGT........................DVDV....YR.YLE.....PL..YNDYR.KLRRKLADG...................-----....CFSLSHVDEVID.ELL.......TKDYS...CD..V..ALPRVKKRWTLES--ag...................................................................
B6TYH0_MAIZE/10-175                    ...............................................KSIHGTNPQNLVEKIVRSKIYQ..S.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHTGG..............-TYG.GNR.............................................KP.TPFLCLALKM.LQIQPDKD..........IVV.EFIK......................................................NEDYK..YVRVLGAF....Y...L.....RLTGT........................IADV....YQ.YLE.....PL..YNDYR.KIRHKLSDG...................-----....QFTLTHVDEFID.ELL.......TKDYS...CD..T..AMPRIQKRWVLEA--sg...................................................................
F0ZBH7_DICPU/5-166                     ..............................................l-EIHGNEKTMNLDNILLSNIQS..S.LY.FK-NLYSKKT................................YHEVLDEIKKN..VDCLSP..............YISN.-TK.............................................NP.STAFCLLYKF.FLMKLTVK..........QME.GLLG......................................................-QDSP..YARGIGIL....Y...L.....RYSYP........................PSKI....WE.WYI.....DY..LDDHD.---------...................TVLIS....KNSEVTIQKLML.DLL.......KENKF...SG..T..ILPRIPTKIQQD---ldk..................................................................
A0A109FHW1_9BASI/10-174                ..............................................l-SIHGTNPQYLVPTVIRKRVYD..T.LY.WKEKCFALNA................................-ATIIDRAVE-..LEAVGG..............-TYA.NTR.............................................-P.TEFICLVLKL.LQLQPERE..........IVL.EYLR......................................................AEEFK..YLRALAAF....Y...V.....RLTFD........................SLNA....YE.TLE.....PL..LDDYR.KLRYRAMDG...................-----....SYSILTMDEFVD.QLL.......VGESV...CE..I..QLPRLTQRKVLEET-e....................................................................
A0A091K1J7_COLST/1-141                 ..............................................l----------------------..-.--.----------................................----------Q..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKTI--dq...................................................................
A0A087TQR2_9ARAC/10-175                ..............................................q-SVRGTNPQYLIEKIIRSRIYD..A.RY.WKEECFALSA................................-ELLVDKAME-..LKYVGG..............-VYG.GNI.............................................KP.TPFLCLVLKM.LQIQPEKD..........IVI.EFIR......................................................QEDFK..YVRALGAF....Y...M.....RLVGT........................SLDC....YK.YLE.....PL..YNDYR.KLRKQNRQG...................-----....HFEVVHMDEFID.ELL.......HEERL...CD..V..ILPRIQKRHVLEAN-n....................................................................
G5AX24_HETGA/10-161                    ..............................................h-SIRGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLILKM.FQIQPEKD..........IIV.EFIK......................................................NEDFK..YARMLGSL....Y...M.....RLTGT........................AIDC....FK.YLE.....PL..YNDYW.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HKRYL...--..-..---------------leea.................................................................
A0A077Z5Z3_TRITR/438-620               .............................................la--FWGNKQTMNLNHLVYENIMI..S.PY.YKNTLSQVVT................................YHEVLDEIYYN..VDHLEP..............WERG.TRKttgqtgmcg...........................gvrgvgaggVV.SSAFCILYKL.FTLKLTRK..........QLI.SMLN......................................................HSDSC..YIRGLGFM....Y...V.....RYCLH........................PNSF....WY.WFE.....PY..LDDEE.---------...................EIDPKa..gGGEVMTIGDMIR.QML.......NKLEW...YT..T..LFPRIPVPIQ-----svl..................................................................
A0A183AT90_9TREM/32-216                ..............................................l-KLWGNQQTMNLNAMIYTNVTQ..S.PY.FKANLIELKT................................YHEVIDEIYYK..VEHLEP..............WERG.SRKvggqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.FTLKLTRK..........QLK.GLLD......................................................HPDSP..YIRALGFM....Y...V.....RYCLP........................PDDF....WW.WYS.....PY..LDDSE.---------...................ELDVKa..gGGCMMTIGSMLE.HWL.......TKLDW...FT..T..LFPRIPVPVQKK---lee..................................................................
A0A068XCD3_HYMMI/10-175                ..............................................h-TLHGTNPQYLIEKIIRSRIYE..C.QF.WKEHCFALTS................................-ELLVDKAVE-..LKYIGG..............-TYS.GLT.............................................KP.TPFICLVLKM.LQIQPDKD..........IVI.EFIK......................................................QEDYK..YARALGAF....Y...L.....RLVGE........................SVEI....YK.YLE.....AL..YNDFR.KLKQQDTTG...................-----....KFSIIRMDEFID.QLL.......NEERA...CD..V..ILPRLQKRSVLEDS-n....................................................................
E1GF58_LOALO/10-175                    .............................................vt--VKGTNPQYLVEKIIRTRIYD..S.KY.WKEECFALTA................................-ELLVDRGME-..LRYIGG..............-IYA.GNV.............................................KP.TPFLCLCLKM.LQIQPEKD..........IAV.EFIR......................................................QEEYK..YIRALGAM....Y...I.....RLTFT........................SIEV....YK.YLE.....PL..YNDYR.KLRIMNNDG...................-----....RFEIVHMDEFID.SLL.......REERY...CD..I..HLPRIQKRITLEE--ig...................................................................
Q6BW00_DEBHA/13-188                    ..........................................ksnvi------RKAYLVEPIIRHRIQD..S.LF.YKQYLYLTNE................................-ATILPVITSQ..VKYIGS..............--TN.ANG.............................................KP.TPFVCCFLRL.LELEPSRD..........IIE.MCLHq...................................................lgTKEFK..YLTALIML....Y...I.....RVVWP........................YEDV....IT.TLE.....PF..YSDYR.KLRFQLKSPi................mvKGMPI....LYKLSHMDVWCD.ELL.......NNERV...VD..L..ILPRMVPRHVLFE--rg...................................................................
E9GW90_DAPPU/10-175                    ..............................................i-SVKGTNPQYLVEKIIRTRIYD..S.KY.WKEECFALTA................................-ELMVDKAME-..LRYIGG..............-IFG.GNV.............................................KP.TPFLSLTLKM.LQIQPEKD..........IVV.EFIK......................................................NEDFK..YVRALGAF....Y...M.....RLVGT........................SVEI....YK.YLE.....PL..YNDYR.KIRFQNKEG...................-----....NFELLYMDDFID.SLL.......REERF...CD..V..ILPRLQKRQILEE--an...................................................................
A0A183PCN6_9TREM/26-73                 ..............................................l-KLWGNPQTMNLNTMIYTNIAQ..S.PY.FKANLVELKT................................YHEVIDEIYYK..LT----..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------.....................................................................
A0A061GG73_THECC/10-175                ...............................................KSIRGTNPQNLVEKIVRSKIYQ..N.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHIGG..............-TYG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKD..........IVV.EFIK......................................................NDDYK..YVRILGAF....Y...L.....RLTGT........................DIDV....YR.YLE.....PL..YNDYR.KLRQKSPDG...................-----....NFSLTHVDEVID.ELL.......TRDYS...CD..I..ALPRIKKRWTLES--lg...................................................................
M2XT21_GALSU/10-174                    .............................................ih--AHGFDPQFLIDKITREKIYQ..C.AY.WKAECFGLTA................................-ETLVDKAAE-..LTYVGG..............-LYG.PLK.............................................KP.TPFICLILKL.LQLSPDKE..........IIH.QYLQ......................................................QKKFK..YLTALAAF....Y...W.....RLVGN........................GTDV....YR.WLE.....PL..YEDFR.KLRIRRENK...................-----....-YELIHVDECID.ELL.......QKEDV...CD..I..KLPRLPNRNVLME--dr...................................................................
A7TN57_VANPO/14-211                    ...............................................KQLNNQSVSLVIPRITRDKIHN..S.IY.YKANLDNSSLrg............................lnMLQLIEVIVRD..LGTLKDksv........nqvCFLG.GVE.............................................--.--FKCILMKL.IEICPTWE..........QLM.TIIQmqd...............................................nvidNFDNK..YLVALVLT....Y...I.....RIQYYydn.................devnSKKY....RE.LFS.....KC..ISDYR.KLKSVAMDTdc...............wsMSQSI....EIKIIHLDELVD.WLC.......SEDEI...WG..I..PLGHCQWS-------dlnasde..............................................................
A0A0M0KXG3_9EUKA/15-172                ..............................................v-SVHGTNPQNLVEKILRAKIYN..H.AY.WKEHCFGLTA................................-ESLVDKAME-..VEAIGG..............-TYG.GIR.............................................EP.TSFIQLTLKM.LQIQPEKE..........IVV.EFIK......................................................NEDYK..YVRALGAY....Y...M.....RLTGK........................AVEV....YQ.YLE.....PL..YNDYR.KLRRRQVDG...................-----....SYTLTRMDEFID.ELL.......RAD--...--..-..---------------ygatasvsvpvr.........................................................
A7SXQ7_NEMVE/10-175                    ...............................................KNIKGTNPQYLVEKIIRTRIYE..S.KY.WKEQCFALTA................................-ELLVDKAME-..LDHIGG..............-TFG.GNI.............................................KP.TPFLCLLLKM.LQIQPEKE..........IIV.EFIK......................................................NDDYK..YVRALGAM....Y...M.....RLVGT........................ALDC....YN.YLE.....PL..FNDYR.KLKRMSQTG...................-----....VYEVVHMDEFID.DLL.......REDRV...ND..I..ILPRIQARHILEA--tn...................................................................
B7S4A9_PHATC/10-166                    .............................................ss--VSGSDPQNLLEYITRQKIYD..S.RF.WKEECFGLTV................................-ADVLEKSTS-..LQCIGA..............----.---.............................................LP.AHFLALCLKL.LQLHPETE..........LVTeTFVD......................................................QEDFK..YTRVLGCL....Y...L.....RLTGR........................PTEI....YE.RLE.....PL..YRDRR.KLRVWTPPC...................-----....-WGLKHVDDFIH.ECL.......TEPRI...LN..L..SLPRLPSRRSL----q....................................................................
A0A0E0L7N7_ORYPU/101-262               ........................................qssgrpi--------DVLMEKVLSVNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.SSAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAVGFL....Y...L.....RYVAE........................PKTL....WS.WYE.....PY..IKDDE.---------...................EFSPG...sNGKMTTMGVYVR.DLL.......LGQYY...FD..S..LLPRVPL--------lilrqv...............................................................
E3N791_CAERE/10-175                    ..............................................k-TVKGTNPQFLVEKIIRQRIYD..S.MY.WKEHCFALTA................................-ELVVDKGMD-..LRYIGG..............-VYA.GNI.............................................KP.TPFLCLALKM.LQIQPEKD..........IVL.EFIQ......................................................QEEFK..YIRALGAM....Y...L.....RLTFD........................STEI....YK.YLE.....PL..YNDFR.KLRYMNKMG...................-----....RFEAIYMDDFID.NLL.......REDRY...CD..I..QLPRLQRRWALEE--ve...................................................................
E7KCV7_YEASA/15-219                    ...............................................KQLNNQSVSLVIPRLTRDKIHN..S.MY.YKVNLSNESLrg............................ntMVELLKVMIGA..FGTIKGqng.......hlhmMVLG.GIE.............................................--.--FKCILMKL.IEIRPNFQ..........QLN.FLLNvk.................................................nenGFDSK..YIIALLLV....Y...A.....RLQYYylngn.............nkndddENDL....IK.LFKvq.lyKY..SQHYF.KLKSFPLQVdc...............faHSYNE....ELCIIHIDELVD.WLA.......TQDHI...WG..I..PLGKCQWNK------iynsde...............................................................
D8R3L1_SELML/5-169                     ...........................................vqtc----GKPIQTLVEHVVNVNILS..S.EY.FK-ELYRLKT................................FHEVVDEIYNH..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMQ.GLLN......................................................HADSP..YIRAIGFL....Y...L.....RYCGE........................PRTL....WQ.WFE.....PY..IEDDE.---------...................EFSPG...tNGRVTKMGVYIR.DLL.......LHQHY...FD..T..IFPRIPVPVARQ---ias..................................................................
A0A0V0TZN6_9BILA/2-84                  ...........................................nlfd----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................----K..YIRALGAL....Y...L.....RMTFS........................YVEV....YK.YLE.....PL..LNDYR.KLRWINKQG...................-----....KFELIHMDEFVD.KLL.......REERF...CD..V..QLPRLQKRAFLEE--tn...................................................................
J3MB67_ORYBR/4-166                     ........................................qssgrpi--------DVLMEKVLSVNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.SSAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYVAE........................PKTL....WS.WYE.....PY..IKDDE.---------...................EFSPG...sNGKMTTMGVYVR.DLL.......LGQYY...FD..S..LLPRVPLPI------lrqvt................................................................
S9WUU7_9TRYP/1-95                      ...............................................----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.-MLR......................................................QDVHK..YLRVGALF....L...I.....RLIGN........................PAMQ....RE.AMK.....IG..FDDYR.KIRVYGNEE...................ERET-....------------.---.......-----...--..-..---------------sstkrpreeeekdakewdstyapiihphyfimrldeiterlfl..........................
A0A094KRX5_9AVES/1-80                  ...............................................----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................---FR..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HKERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A0M9EYH7_9HYPO/26-192                .............................................ap---NGLNPATIMEKAVRDRIVD..S.IY.YKMQCFACNE................................-ADIVDRVVED..VKFIGG..............-TYG.TTQ.............................................VP.SPFLCLAFKL.LELSPSDA..........VLL.EYLKf....................................................gGEAFK..YLRALACF....Y...F.....RLTRQ........................AKDV....YE.MLE.....PF..LEDRR.KLRRRGREG...................-----....-VKLSYMDEFVD.ELL.......TKERV...CG..T..SLWKMPKREVLEDL-e....................................................................
A0A0C2D4S6_9BILA/1-32                  ...............................................----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------MDEFID.NLL.......REERY...CD..I..QLPRLQKRQALEE--vg...................................................................
E7LUN2_YEASV/15-219                    ...............................................KQLNNQSVSLVIPRLTRDKIHN..S.MY.YKVNLSNESLrg............................ntMVELLKVMIGA..FGTIKGqng.......hlhmMVLG.GIE.............................................--.--FKCILMKL.IEIRPNFQ..........QLN.FLLNvk.................................................nenGFDSK..YIIALLLV....Y...A.....RLQYYylngn.............nkndddENDL....IK.LFKvq.lyKY..SQHYF.KLKSFPLQVdc...............faHSYNE....ELCIIHIDELVD.WLA.......TQDHI...WG..I..PLGKCQWNK------iynsde...............................................................
A0A067QAN7_9HOMO/10-173                ..............................................q-AIHGQNPQFLVETVIRNRIWE..S.AY.WKEHCFALTA................................-ESLIDKAIE-..VKAIGG..............-VYG.N-Q.............................................KP.TEFMCLLLKL.LQIQPEKE..........ILV.EYLQ......................................................ADEFK..YLRALAVM....Y...I.....RMTFA........................SAEV....YG.LLE.....PL..LKDYR.KLRYRNTAG...................-----....-YTLTYFDEFVD.QLL.......HDERV...CD..I..ILPRLAKRSVLEEN-g....................................................................
A0A0A0AG99_CHAVO/10-175                ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LRDVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HEERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
B0WBK3_CULQU/28-154                    ..............................................l-PLWGNESTMNLNPLILANIQG..S.SY.FKVSLFKLKT................................YHEVVDEIYYQ..VKHLEP..............WERG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAFCLLYKL.YTLRLTRK..........QVN.GLLT......................................................HTDSP..YIRALGFM....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------ncfiksrcvt...........................................................
A0A1B6P710_SORBI/1-113                 ...............................................----------------------..-.--.----------................................-----------..------..............-MTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HLDSP..YIRAIGFL....Y...L.....RYVAD........................PKIL....WT.WYE.....PY..LRDDE.---------...................EFSPG...sNGRKTTMGVYVR.DLI.......LGQYY...FD..S..LLPRIPLPVTRQ---ita..................................................................
A0A0N4XCA9_NIPBR/461-626               ..............................................h-TVKGTNPQFLVEKIIRQRIYD..S.KY.WKESCFALSA................................-DLIVDRALD-..LRYIGG..............-IYA.GNV.............................................KP.TPFLCLALKM.LQIQPEKD..........IIV.EFIQ......................................................QEQSK..YARALGAM....Y...L.....RLTFT........................SVEI....YK.YLE.....PL..FNDYR.KLRYMNKQG...................-----....RFELVYMDEFID.NLL.......REERY...CD..I..QLPRLQKRQALEE--ag...................................................................
A0A183VNI8_TRIRE/27-120                ..............................................l-KLWGNQQTMNLNTMIYTNIVQ..S.PY.FKANLVELKT................................YHEVIDEIYYK..VEHLEP..............WERG.SRRiggqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.FTLK----..........---.----......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------y....................................................................
T1KXQ5_TETUR/69-253                    ..............................................l-PFWGNERTMNLNPLLLTNIKN..S.PY.FKVNLYALKT................................YHEVIDEIWTQ..VKHMEP..............WEKG.SRRmggqtgmcg...........................svrgvgaggIV.STPFCILYKL.FTLRLTRK..........QVM.GLIK......................................................HKDSP..YIRAIGLM....Y...I.....RYTQP........................PESL....WE.WLS.....PY..LEDTE.---------...................EFDAKa..gGGQKMTIGQMCR.HLL.......VKLEW...FS..T..LFPRIPVPIQKDI--et...................................................................
E5S6X1_TRISP/427-610                   ..............................................l-NFWGNKETMNLNHLVLENIVS..S.PY.YKNTLLPLKT................................HFEVIDEIYYN..VEHLEP..............WEKG.TRKttgqtgmcg...........................gvrgvgaggVV.SSAFCLLYKL.FTLKLTRK..........QLT.AILN......................................................HPDSC..YIRGLGFM....Y...I.....RFCLH........................PATF....WS.WYE.....PY..FEDSE.---------...................EIDPKa..gGGDLMTIGEMVK.SLL.......TKLDW...YS..T..LFPRIPVPIQKEI--d....................................................................
U6LKK7_9EIME/85-141                    ................................kdrqqkgdrketter----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.-------RQ...................EGDIQ....GLRKETIGEYVQ.SLL.......TEDKY...FS..T..VLPRLPLL-------vknv.................................................................
A0A0D1ZK06_9EURO/19-185                .............................................pl--IRGQNPALLLETAMRDRITD..S.LY.WKEQCFGLNA................................-ATLCDRAVE-..LTYIGG..............-TYG.VAM.............................................KP.TPFICLAFKL.LTLVPDKE..........IIL.EYLNy....................................................gGEEWK..YLRALAAF....Y...V.....RLTFD........................PAEI....YT.TLE.....PL..LEDSR.KLRQRRKEA...................-----....-YVLVHMDEFVD.NLL.......TKDRV...CG..T..SLWKLPARQLLEDL-d....................................................................
A0A0G4L1S5_9PEZI/26-193                ............................................lap---NGENPAKIMEKAVIGRIVD..A.QY.FQYQCFALNE................................-AGIVDRVVND..VKFIGG..............-TYG.SAQ.............................................KP.TPFLCLAFKL.LQLAPSDD..........VLE.TYLSf....................................................gGDKFK..YLRALACF....Y...I.....RMTRR........................ARDV....YA.ILE.....RY..LVDRR.KLRRKGRQG...................-----....-TSLTFVDEFVD.DLL.......TKTRV...CA..T..SFRELPRRTDLVD--lg...................................................................
A9RSQ4_PHYPA/6-170                     ........................................vqtcgkp-------LDTLIERVLCTNILS..S.DY.FK-ELFGLQT................................YTEVVDEIYNH..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKL.FTLKFTVK..........QMQ.DILD......................................................HPDSP..YIRALGFL....Y...L.....RYVGD........................PKTI....WD.WFE.....PY..VKDPE.---------...................EFSPG...sNKKMTTMGVYVR.DII.......LNQYY...FD..T..LFPRIPVPILR----qita.................................................................
A0A0A1USL5_9HYPO/24-191                ............................................lap---NGLNPATIMEKAVKDRIVE..S.YF.YKEQCFALNE................................-ADIVDRVVEH..VRFVGG..............-THG.DAQ.............................................KP.SPFLCLAFKL.LELGPSEA..........VVR.EYLSy....................................................gGEHFK..YLRALACF....Y...Y.....RLTRR........................AADV....HR.ALE.....PF..LGDRR.KLRTRGRRG...................-----....-AALTYVDEFVD.GLL.......TRERV...CA..T..SLWKMPPREVLEDL-d....................................................................
U7PR73_SPOS1/26-192                    .............................................ap---NGLNPATIMEKAVRERIVD..S.YF.WKEQCFGVNE................................-ADIVDRVVEH..VSCIGG..............-TTG.TTQ.............................................KP.TPFLCLALKL.LQLAPDDA..........ILQ.AYLSq....................................................gGDKFK..YLRALALF....Y...I.....RLTRP........................AADV....YT.TLE.....PY..LADRR.KLRRKGRAG...................-----....-TQLTFVDEFVD.DLL.......VKTRV...CA..T..SLWKLPQREDLED--lg...................................................................
Q4WUN3_ASPFU/34-222                    ..............................................l--VRGVNPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LTSIGG..............-TYG.VAE.............................................KP.TPFLCLAFKL.LQLNPERE..........IIL.EYLNytdpgsdeetea.............................taeeqarngvlgqRGDFK..YLRALAAF....Y...V.....RLTFD........................PVDV....YK.TLE.....PL..LLDYR.KLKRRVRDT...................-----....-FVLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKLPARQQLEDL-d....................................................................
F1S580_PIG/50-234                      ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
A0A0R3WNB8_HYDTA/27-211                ..............................................l-KLWGNQVTMNINPMIHTNIIQ..S.PY.FKTNLIELKT................................YHEVIDEIYYK..VTHLEP..............WERN.SRRmggqtgmcg...........................gvrgvgaggIV.STAYCLLFKL.FTLKLTRK..........QLK.GLLE......................................................HPDSP..YIRALGFM....Y...I.....RYCLP........................PEDL....WM.WFA.....PY..LDDEE.---------...................EIDVRa..gGGCNMTIGAMLG.QWL.......TKLDW...FS..T..LFPRIPVPVQKKID-e....................................................................
A0A091G328_9AVES/1-80                  ...............................................----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................---FR..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HEERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
V7BIY7_PHAVU/10-175                    ...............................................KSIRGTNPQNLVEKILRSKIYQ..N.TY.WKEQCFGLTA................................-ETLVDKAME-..IDHLGG..............-TYG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKE..........IVI.EFIK......................................................NEDYK..YVRILGAF....Y...L.....RLTGS........................DIDV....YR.YLE.....PL..YNDYR.KLRQKSSDG...................-----....QFTLTHVDEVID.ELL.......TKDYS...CD..I..ALPRVKKRWTLES--ld...................................................................
F6ZP02_CIOIN/10-175                    ..............................................h-TVKGTNPQYLIEKIIRSRIYD..S.RY.WKEQCFALTA................................-ELLVDKAMD-..LKYIGG..............-VYS.GNI.............................................KP.CPFLCLILKM.LQIQPDKD..........IIV.EFIR......................................................NEDFK..YVRCLGAF....Y...M.....RITGT........................SLDC....YK.YLE.....PL..LNDFR.KIKFQKREG...................-----....NFVITHMDEFID.ELL.......REERS...CD..V..ILPRIQKRQILEE--le...................................................................
Q0CIC3_ASPTN/21-209                    ..............................................l--VRGVNPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAAE-..LTALGG..............-TYG.VAE.............................................KP.TPFLCLAFKL.LQLNPERE..........IIL.EYLNftdpgsddedeq.............................taeeqaqngvvkqRGDFK..YLRALAAF....Y...V.....RLTFD........................AVDV....YK.TLE.....PL..LLDYR.KLRRRVRDS...................-----....-VVLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKLPPRQQLEDL-d....................................................................
A0A0C2IZB7_THEKT/10-175                ..............................................i-NVRGTNPQFLLDKIVRSRIYE..A.RF.WLEECFALTA................................-ELLVDKIVD-..LKYIGG..............-CYG.GNS.............................................KA.SNFLCLLLKM.LQIQPEKE..........III.EFLR......................................................NEEYK..YMRALAAI....Y...V.....RLVFP........................AVDC....YN.YLE.....PL..YLDYR.KLRFMKSDG...................-----....KFKVITMDEYID.SLL.......RDERV...CD..I..IMPTLPLRRVLEEL-d....................................................................
A0A183LYE7_9TREM/70-113                .........................................pyklvc----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....DFSLIYMDDFID.QLL.......TEERV...CD..V..ILPRLQKREVLEE--ln...................................................................
K3ZVF4_SETIT/1-99                      ...............................................----------------------..-.--.----------................................-----------..------..............----.---.............................................--.---------M.LQIQPDKD..........IVV.EFIK......................................................NEDYK..YVRVLGAF....Y...M.....RLTGT........................VADV....YQ.YLE.....PL..YNDYR.KLRHKLSDG...................-----....QFALTHVDEFID.ELL.......TKDYS...CD..T..ALPRIQKRWVLEA--sg...................................................................
A0A0A2JPC8_PENEN/21-204                ..............................................l--VRGVNPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LTSIGG..............-TYG.VSE.............................................KP.TPFLCLAFKL.LQLGPDRD..........VIL.ELLNytdpgsgdea..................................enpddslvkdRGDFK..YLRALAAF....Y...V.....RLTFD........................SVDV....YK.TLE.....PL..LLDYR.KLKRRVRDS...................-----....-FTLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKLPPRSQLEDL-d....................................................................
G6DFN0_DANPL/10-175                    ...............................................KSIRGTNPQYLIEKIIRSRIYD..S.KY.WKEECFALTA................................-ELLVDKAME-..LRYIGG..............-VHG.GFI.............................................YP.TPFLCLVLKM.LQIQPEKD..........IVV.EFIK......................................................NEEFK..YVRALGAF....Y...M.....RITGS........................SLDC....YK.YLE.....PL..YNDNR.KLRRQNREG...................-----....QFEIVHVDEFID.ELL.......REERL...CD..V..ILPRIQKRHILEEN-n....................................................................
A0A0D2US18_GOSRA/10-175                ...............................................KSIRGTNPQNLVEKIVRSKIYQ..N.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHIGG..............-TYG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKD..........IVV.EFIK......................................................NDDYK..YVRVLGAF....Y...L.....RLTGI........................DSDI....YR.YLE.....PL..YNDYR.KVRRKSPDG...................-----....NFMLTHVDEVID.ELL.......TRDYS...CD..I..ALPRIKKRWTLES--lg...................................................................
B3LAT7_PLAKH/162-322                   ............................................lem----TNTTTYNVNTLLRNNILS..S.EY.FR-SLVPLKT................................FKEVVEEIHLY..ADHVEP..............YCIG.STR.............................................AP.STLFCCLYKL.FTMHLSEK..........QM-.-LIE......................................................SRESC..YIRACGFL....Y...L.....RYVHS........................PANL....WM.WFE.....PY..LLDED.---------...................EFITSa..dKRKKQTIGEYTQ.CLL.......ADDKY...FN..T..VLPRMPIKIK-----nty..................................................................
A0A0F4ZI01_9PEZI/24-191                ............................................lap---NGLNPATIMEKAVRERIID..S.YF.YKEQCFALNE................................-ADIVDRVVEY..VQFVGG..............-TYG.VTQ.............................................KP.TPFLCLAFKL.LQLAPSDA..........VLT.EYMQl....................................................gGEHFK..YLRALACF....Y...V.....RMTRP........................AKQC....YQ.LLE.....PF..LEDYR.KLKRKGRNG...................-----....-TVLTYMDEFVD.DLL.......VKERV...CG..T..SLWKMPKREVLEDM-d....................................................................
U3JJ31_FICAL/50-200                    ....................................tgasikplsqv----------------------..-.--.----------................................---------E-..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKAI--dq...................................................................
U3IDW8_ANAPL/1-111                     ..............................................x----------------------..-.--.----------................................-----------..------..............----.---.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HEERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
H9JWH7_BOMMO/10-175                    ...............................................KSIRGTNPQYLIEKIIRSRIYD..S.KY.WKEECFALTA................................-ELVVDKAME-..LRYVGG..............-VHG.GFI.............................................YP.TPFLCLVLKM.LQIQPEKD..........IVV.EFIK......................................................NEEFK..YVRALGAF....Y...M.....RLTGT........................SVDC....YK.YLE.....PL..YNDNR.KLRRQNRDG...................-----....QYEIVHMDEFID.ELL.......REERL...CD..I..IMPRIQNRHILEQN-n....................................................................
A0A0L1L023_9EUGL/103-269               ..........................................vpnta--------QYNMDDSLWNKVQDylQ.KL.RKGNLMSLSN................................QDAIVKYIAAN..VRHINA..............--FD.K-E.............................................EP.SLFFALLVMY.MDLGISED..........RVR.SLLV......................................................HE-CA..YVKAAGVV....I...A.....RYVFS........................PSQT....DD.ILV.....TT..QLLGR.SMNEIVESS...................HIVNV...vQGESLTIPALIG.NLI.......EHDEF...LE..A..WFPIY----------ssvhhvi..............................................................
M0Z3R6_HORVD/3-165                     ...........................................lqts----GRPIEVLMEKVLSMNIVS..S.DY.FK-ELYKIKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKL.FTMKLTVN..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYAAD........................PKTL....WT.WYE.....PY..IQDDE.---------...................EFSPG...sNGKMTTMGVYVR.DVI.......LGQYY...FD..S..LLPRVPL--------lilrqv...............................................................
A0A0N8DCH8_9CRUS/32-216                ..............................................l-PIWGNERTMNLNPLILTNIQT..S.HY.FKTNLSELKT................................YHEVVDEIYYK..VQHLEP..............WEKG.SRKtsgqtgmcg...........................gvrgvgaggIV.STPYCLLYKL.FTLKLTRK..........QLI.GLIT......................................................HCDSP..YIRGLGFM....H...I.....RYTQP........................PADL....FG.WFQ.....PY..LEDEE.---------...................EIDPKa..gGGHPMTIGTMVR.QLL.......TKLDW...YD..S..LFPRIPVPIQINI--dr...................................................................
Q4YX53_PLABA/179-341                   ............................................lem----TNTSTYNVNNLLRNNILS..S.EY.FR-SLITLKT................................FKEVLDEILSY..ADHAEP..............YCIG.STR.............................................AP.STLFCCLYKL.FTMHLSKK..........QLK.SLIE......................................................NKESC..YVRACGFL....Y...L.....RYVHS........................PSNL....WM.WFE.....PY..LLDDE.---------...................EFTVSa..dKRKLMTIGEYAQ.SLL.......YDDKY...FN..T..VLPRFPIKIK-----niy..................................................................
A0A0E0L7N6_ORYPU/101-262               ........................................qssgrpi--------DVLMEKVLSVNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.SSAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAVGFL....Y...L.....RYVAE........................PKTL....WS.WYE.....PY..IKDDE.---------...................EFSPG...sNGKMTTMGVYVR.DLL.......LGQYY...FD..S..LLPRVPL--------lilrqv...............................................................
A0A078JHH0_BRANA/4-168                 ..............................................i-QTNGRAYESLLEKVLSMNIVS..S.DY.FK-ELYGLKT................................YHEVIDEIYNQ..VSHVEP..............WMGG.NCR.............................................GP.STAYCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HTDSP..YIRAVGFL....Y...L.....RYVAD........................AKTL....WT.WYE.....PY..IKDDE.---------...................EFAPG...sNGRTTTMGVYVR.DLL.......LGLYY...FD..T..LFPRIPVPVMR----qivs.................................................................
A0A0R3SBV3_HYMDI/41-225                ..............................................l-KLWGNSVTMNINPMIHTNIIQ..S.PY.FKTNLIELKT................................YHEIIDEIYYK..VTHLEP..............WERN.SRRvggqtgmcg...........................gvrgvgaggIV.STAYCLLFKL.FTLKLTRK..........QLK.GLLE......................................................HPDSP..YIRALGFM....Y...I.....RYCLP........................PEDL....WM.WFS.....PY..LDDEE.---------...................EIDVRa..gGGCTMTIGAMLV.QFL.......TKLDW...FT..T..LFPRIPVPVQKKIE-e....................................................................
E6ZP67_SPORE/10-174                    ..............................................v-SIHGTNPQFLIEKPVRARIYE..S.PF.WKEHCFALSA................................-ATILPLATS-..LHHIGG..............-LVG.L-Q.............................................RP.SHFLCLLQKL.LQIQPEPA..........IVS.AYLG......................................................ARQFK..YLRALAAF....Y...V.....RLTYK........................STDI....YT.LLE.....PL..LEDGR.KLRWRGSGG...................-----....EFSIVHMDEWID.MLL.......AEERV...CD..I..ILPRLTRRDVCET--rd...................................................................
B8NUH3_ASPFN/21-209                    ..............................................l--VRGVNPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LTSIGG..............-TYG.VSE.............................................KP.TPFLCLAFKM.LQLNPDRD..........IVL.EYLNftdpvndeegeq.............................taaeqaengvvkqRGDFK..YLRALAAF....Y...V.....RLTFD........................AVDV....YK.TLE.....PL..LLDYR.KLKRRVRDS...................-----....-VVLTYVDQFVD.DLL.......TKDRV...CG..T..SLWKLPSRQQLEDL-d....................................................................
A0A078F0Q5_BRANA/10-175                ...............................................KNIRGTNPQNLVETIVRKKIHD..H.TF.WKEQCFGLTA................................-ETLVDKAME-..LDHVGG..............-TFG.GNR.............................................KP.TPFLCLVLKM.LQIQPEKE..........IVV.EFIK......................................................NDDYK..YVRVLGAF....Y...L.....RLTGS........................DADV....YR.YLE.....PL..YNDYR.KVRQKLADG...................-----....RFSLTHVDEVIE.ELL.......TKDYS...CD..I..AMPRLKKRCTLEQN-g....................................................................
A0A067K8T2_JATCU/1-123                 ..............................................m----------------------..-.--.----------................................----------E..LDHLGG..............-TYG.GNR.............................................KP.TPFMCLVMKM.LQIQPQKD..........IVV.EFIK......................................................NDDYK..YVRILGAF....Y...L.....RLTGT........................DVDV....YR.YLE.....PL..YNDYR.KLRQKLPDG...................-----....KFDLIHVDEVIH.ELL.......TKDYS...CD..V..ALPRIKKRWTLE---si...................................................................
D6WU66_TRICA/10-175                    ...............................................KSIHGTNPQYLVEKIIRSRIYD..S.KY.WKEECFALTA................................-ELLVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IVV.EFIK......................................................NEEFK..YVRALGAF....Y...M.....RLTGS........................SLDC....YK.YLE.....PL..YNDNR.KLRRQNRQA...................-----....QFEIVHMDEFID.ELL.......REERV...CD..V..ILPRIQKRIVLEES-n....................................................................
A0A059J1T7_9EURO/21-222                ..............................................l--IRGVNPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LTYIGG..............-TYG.VGQ.............................................KP.TPFLCLAFKL.LQLAPEKE..........VIL.EYLNfhdpeadeedsntrgdsad................adggaddaqdradaailkaTGDFK..YLRALAAF....Y...I.....RLTFE........................PVEI....YK.TLE.....PL..LTDYR.KLKRRTKEG...................-----....-FLLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKIPTRTMLEDL-d....................................................................
Q7RLR8_PLAYO/1-56                      ..............................................m----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................----....--.WFE.....PY..MLDDE.---------...................EFTVSa..dKRKLMTIGEYVQ.SLL.......YDDKY...FN..T..VLPRLPIKIK-----niyga................................................................
X2JF51_DROME/24-141                    ..............................................l-PFWGNESSMNLNALILANIQS..S.SY.FKVHLFKLKT................................YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.YTLRLTRK..........QIN.GLLN......................................................HTDSA..YIRALG--....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------rcw..................................................................
A0A096Q427_MAIZE/1-86                  ...............................................-----------MEKVLSVNILS..S.DY.FK-ELFKYKT................................YHKVVDEIYNQ..VDHVEP..............WMTD.NCR.............................................GP.SSAFCLLYKL.FTMKLTVK..........QMH.GLLK......................................................HQDSP..YIRA----....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------ewl..................................................................
A0A078GCR5_BRANA/10-175                ...............................................KNIRGTNPQNLVEKIVRTKIYN..H.TF.WKEQCFGLTA................................-ETLVDKAME-..LDHVGG..............-TFG.GNR.............................................KP.TPFLCLILKM.LQIQPEKE..........IVV.EFIK......................................................NDDYK..YVRILGAF....Y...L.....RLTGS........................DVDV....YR.YLE.....PL..YNDYR.KVRQKLSDG...................-----....RFSLTHVDEVIE.ELL.......TKDYS...CD..I..AMPRLKKRWTLEQN-g....................................................................
Q86IV3_DICDI/48-212                    ...............................................KSIHGVNPRNLIEKITRIKIQS..H.PY.WKEKCIGLNE................................-ESLVDRAMA-..LESYGG..............-CFG.GNK.............................................QP.THFLCLLLKM.LQIQPEMD..........IIK.EFIE......................................................NEDFK..YVRILGAI....Y...L.....RLVGK........................PVDI....YN.QLD.....PL..YKDFR.ALRRKTDMG...................-----....-STKVFVDQFIE.ELL.......TTNYS...CD..I..ALPHIPSRANLIQ--qs...................................................................
A0A0D2E8Z4_9EURO/19-185                .............................................pl--IRGQNPALLLETAMRDRITD..S.LY.WKEQCFGLNA................................-ATLCDRAVE-..LTYIGG..............-TYG.VAM.............................................KP.SPFICLAFKL.LTLVPDKE..........IIL.EYLNy....................................................gGEEWK..YLRALAAF....Y...V.....RLTFD........................PAEI....YT.TLE.....PL..LEDSR.KLRQRRKEV...................-----....-YVLVHMDEFVD.NLL.......TKDRV...CG..T..SLWKLPARQLLEDL-d....................................................................
J9JZ53_ACYPI/30-214                    ..............................................m-PVWGNERTMNLNTLILTNIQS..S.HY.FKVNLYELKT................................YHEVIDEIYYK..VQHLEP..............WEKG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAFCLLYKL.FTLKLTRK..........QVT.GLIT......................................................HCDSP..YIRALGFM....Y...I.....RYTQP........................PGDL....WD.WYE.....SF..LDDEE.---------...................EMDVRa..gGGQTMTIGNILK.SFL.......FKLEW...YS..T..LFPRIPVPIQQQM--ek...................................................................
U4L199_PYROM/27-190                    ..............................................e-TIHGGNPLLLVEKIIRDRILD..S.LY.WKELCFGLNA................................-ATLLDRATE-..LTYLGG..............-TY-.SNQ.............................................KP.TPFICLLLKL.LQLQPEKP..........ILL.AYLQ......................................................DPEFK..YLRCLAAL....Y...I.....RLTWK........................TVEI....FQ.TLE.....PL..MGDYR.KVRIRGMGG...................-----....-WRLGYVDEFID.SLL.......VEERV...CD..I..ALPRMMTRAQLED--lg...................................................................
A0A0N4X4R7_HAEPC/1-161                 ...............................................-----TNPQFLVEKIIRQRIYD..S.KY.WKESCFALSA................................-DLIVDRALD-..LRYIGG..............-IYA.GNV.............................................KP.TPFLCLALKM.LQIQPEKD..........III.EFIQ......................................................QEQSK..YARALGAM....Y...L.....RLTFS........................SVEI....YK.YLE.....PL..FNDYR.KLRYMNKLG...................-----....RFELVYMDEFID.NLL.......REERY...CD..I..QLPRLQKRQALED--ag...................................................................
W2R409_PHYPN/9-173                     ..............................................q-SVHGVNPQTLVEKIMRNRIYA..S.IY.WKEQCFGLTA................................-ETLVDKAVE-..LQEFGG..............-TFG.GNQ.............................................QP.THFLCLLLKM.LQLQPELE..........VVK.QFIE......................................................NEDYK..YVTVLGAV....Y...L.....RLVGK........................PLEV....YT.LLE.....PL..LSDYR.KIRKRNVIG...................-----....-WEITHVDEIAD.ALL.......HEEYY...ID..L..ALPRLADRELLEKN-e....................................................................
A0A180H0H8_PUCT1/10-148                ..............................................l-SIHGTNPQFLIDKVLRSRIYE..A.EY.WKESCFGLTA................................-ETIIDKTVFD..LKYLGS..............-TIT.ANL.............................................RP.TEFICLLLKL.LQLQPEKE..........IIL.EYLR......................................................AEEFK..YLRALAAF....Y...V.....RLTFT........................PINV....YQ.TLE.....PL..LQDYR.KLRTRNLDG..................sR----....------------.---.......-----...--..-..---------------ssskssyr.............................................................
K1Q5L4_CRAGI/7-191                     .............................................lp--NWGNEKTMNMNPLILTNIQA..S.PY.FKVNLYELKT................................YHEVIDEIYYK..VDHLEP..............WEKG.SRKtagqtgmcg...........................gvrgvgaggIV.SSAYCLLYKL.YTLKLTRK..........QLM.GLIT......................................................HKDSP..YIRGLGFM....Y...I.....RYCQD........................PKDM....WD.WYE.....PY..LDDEE.---------...................EIDVKa..gGGHKMTMGEVLR.QWM.......VKLEW...YS..T..LFPRIPVPIQKD---lmq..................................................................
A0A135UGP3_9PEZI/24-191                ............................................lap---NGENPATIMEKAVRERIID..S.YF.YKEQCFAVNE................................-ADIVDRVVEH..VTFIGG..............-TSG.VTQ.............................................KP.TPFLCLAFKL.LQLAPSDE..........VLE.TYLGf....................................................gGEKFK..YLRALACF....Y...V.....RMTRK........................AKDV....YL.FLE.....PF..LEDRR.KLRRKGRQG...................-----....-TSLTFMDDFVD.DLL.......TKTRV...CA..T..SFRELPKRVDLVD--lg...................................................................
A0A0V1NSJ9_9BILA/62-227                ..............................................a-SLKGTNPQYLIEKVTRSRIYD..S.RY.WKEECFALSA................................-ELLVDRGME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLLLKM.LQIQPEKD..........IVI.EFIR......................................................QEDSK..YIRALGAL....Y...L.....RMTFS........................YVEV....YK.YLE.....PL..LNDYR.KLRWINKQG...................-----....KFELIHMDEFVD.KLL.......REERF...CD..V..QLPRLQKRAFLEE--tn...................................................................
A0A078CCT6_BRANA/4-168                 ..............................................i-QTNGRAYESLLEKVLSMNIVS..S.DY.FK-ELYGLKT................................YHEVIDEIYNQ..VSHVEP..............WMGG.NCR.............................................GP.STAYCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HTDSP..YIRAVGFL....Y...L.....RYVAD........................AKTL....WT.WYE.....PY..IKDDE.---------...................EFAPG...sNGRTTTMGVYVR.DLL.......LGLYY...FD..T..LFPRIPVPVMR----qivs.................................................................
M1C6B4_SOLTU/5-167                     .......................................ktsgrpid---------QLLEKVLCMNILS..S.DY.FR-DLLRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYLGD........................FKTL....WG.WYE.....PY..LKDDE.---------...................EFSPG...sSGQMTTMGVYVR.DLF.......LGQYY...FD..T..LLPRIPVPVV-----rtav.................................................................
X6NM44_RETFI/10-176                    ..............................................r-QMHGTNPQWLVDKMIRGKVYD..S.LY.WKEHCFALTA................................-ELLIEKVIKH..VRYVGG..............-MHG.GMK.............................................RP.CEFLCLLIKL.LQIQPKKE..........III.EFIK......................................................QKEFK..YLRILSAF....Y...F.....RLIYD........................SVEI....YT.YLE.....PL..LNDYR.KIVEIDRNG...................-----....KFHLTHVDEIID.QFL.......QERFL...FG..I..NLPHLIDRSVLEK--ng...................................................................
A0A015NFA3_9GLOM/10-174                ..............................................i-AVHGTNPQYLIEKIMRTRIYE..S.LY.WKEFCFGLTA................................-ETLIDRAIE-..LTSFGG..............-EYG.N-Q.............................................KP.TEFLCLTLKL.LQLQPNKD..........IVM.EFIR......................................................NEDYK..YLRVLGAF....Y...L.....RLVGN........................SLEI....YQ.TLE.....PL..LNDYR.KLRKRTSEG...................-----....DFEIVCVDEFIE.ELL.......KEERV...CD..T..ILPRMLKRHVLEEN-g....................................................................
B8C555_THAPS/10-167                    ..............................................h-SVHGTNPQNLVEYITRQKIYD..S.LY.WKEECFGLSA................................-SDVATKATD-..LKALGG..............-SYG.GNN.............................................KP.TRFLCLALKL.LQIQPEEG..........IVE.EFLE......................................................NEEFK..YVRALGAF....Y...L.....RLTGR........................PAEI....YE.LIE.....PL..FNDFR.KLRFRESTG...................-----....-WKVTYMDELAD.ELL.......TSDRY...CG..I..ALPHLPKR-------.....................................................................
F6V7L2_ORNAN/39-223                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
F2UNQ1_SALR5/10-175                    ..............................................r-SVHGTNPQFIVDKIIRSRIYE..T.LY.WKEQCFALTA................................-ETVIEKAVE-..LTYVGG..............-VYG.GNI.............................................RP.TPFLCLTLKL.LQLQPDKD..........III.EYIK......................................................NEDFK..YLRALGAF....Y...L.....RLVGT........................SMDC....YR.YIE.....PL..LNDYR.KLKRMSRNG...................-----....VMELTHMDEFVD.ELL.......REDRV...CD..I..GLPRIQKRYALEV--nd...................................................................
A0A023BDW0_GRENI/56-217                ............................................lem----TNTTSYNLNPMLKENILV..S.EY.YK-SLYQFTT................................VPELIDEVVQY..VDHVEP..............HVTG.HLK.............................................IP.STFACCLYKL.FNLRCTED..........EML.TITE......................................................HPNL-..FVRTLGFV....W...L.....RFVHP........................PEKL....WQ.WFE.....TV..VLDDT.---------...................DFRPT....KNQTTTFGEFAE.SLL.......KEDRY...FN..T..PLPRLPAKIRTH---tnk..................................................................
A0A0D3GCQ3_9ORYZ/4-150                 ........................................qssgrpi--------DVLMEKVLSVNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.SSAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAVGFL....Y...L.....RYVAE........................PKTL....WS.WYE.....PY..IKDDE.---------...................EFSPG...sNGKMTTMGVYVR.DLL.......L----...--..-..---------------gqcpl................................................................
H2ARW2_KAZAF/14-209                    ...............................................KQLNHQSVSLIIPRLTRDRIHN..N.IY.YKVNLQPTSLrg............................dtLLELSKVIIRD..LGTLKDlsv........nkvHVLG.GME.............................................--.--FKCLLMKL.IEIRPTIN..........QLF.AMLNpan................................................antNFEDK..YITALIIT....Y...L.....RIQYFylt.................daqeCLRM....KN.LFK.....KC..IKDYR.KLKSLSLQSdc...............wsPSEEL....TVAVVHMDELTE.WLV.......SKEQI...WG..I..PLGKCQWA-D-----ifddd................................................................
C4WV68_ACYPI/10-175                    ...............................................KTIHGTNPQYLIEKIIRSRIYD..N.KF.WKEECFALSA................................-ELLVDKAML-..MRFIGG..............-VFG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEEFK..YVRALGAF....Y...M.....RLTGS........................SVDC....YK.YLE.....PL..LADSR.KLRRQNRDG...................-----....QFELIYIDEFID.SLL.......RDERV...CD..V..ILPRIQSRHVLEEN-n....................................................................
A0A091GZB5_BUCRH/28-187                ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEM--.---.......-----...--..-..---------------llf..................................................................
G4N721_MAGO7/23-190                    ............................................lap---NGLNRARIMEKAVVDRITE..S.YF.WKEQCFGVNE................................-ADIVDRVVDH..VTYIGG..............-VVG.QSQ.............................................KP.TPFLCLAFKL.LQLGPDDS..........ILA.EYLKf....................................................gGEKFK..YLRALAIF....Y...V.....RLTRT........................SADV....FR.TLE.....PF..LEDRR.KLRRKGRAG...................-----....-TSLTYMDEFAD.DLL.......TKDRV...CA..T..SLFKLTRRDVLEDL-d....................................................................
G5BQU6_HETGA/49-233                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
A0A091DHP7_FUKDA/10-70                 ..............................................h-SLHGTNPQNLV-KIIWMQIYE..S.KY.WKEECFGLLA................................-ELVVDKAIE-..LRDI--..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------mithfepsisfegl.......................................................
A0A093QD96_9PASS/10-175                ..............................................h-SIHGTNPQYVVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LKYVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HEERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
G3JII3_CORMM/24-191                    ............................................lap---NGLNPATIMEKAVKDRITD..S.YF.YKEQCFALNE................................-ADIVDRVVEH..VRFIGG..............-TSG.MTQ.............................................KP.SPFLCLAFKL.LELSPSDA..........VIA.EYLAy....................................................gGEHFK..YLRALACF....Y...L.....RLTRQ........................AKDV....YA.TLE.....PF..LEDRR.KLRRRGRDR...................-----....-TTLTYVDEFVD.DLL.......TKDRV...CA..T..SLWKMPKREILEDL-e....................................................................
H0XNF3_OTOGA/49-233                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
A0A0G2JEW4_MOUSE/48-138                ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRK.............................................TA.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------gqtgmcggvsrssrcwnrrhcfysilpsiq.......................................
B4L223_DROMO/28-212                    ..............................................l-PLWGNETSMNLNPLILANIQS..S.SY.FKVHLFKLKT................................YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.YTLRLTRK..........QVN.GLLN......................................................HTDSA..YIRALGFM....Y...L.....RYTQP........................PGDL....YD.WYE.....DY..LQDEE.---------...................EIDVKa..gGGQVMTIGQMVY.QFM.......TKLDW...FS..T..LFPRIPVPIQKQIE-k....................................................................
A0A183PCN6_9TREM/70-160                ..............................................y----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.---KLTRK..........QLK.GLLD......................................................HPDSP..YIRALGFI....Y...-.....--CIP........................PEDF....WW.WYS.....PY..LSDSE.---------...................ELDVKa..gGGCIMTIGNMLE.HWL.......TKLDW...FS..T..LFPRIPVPVQKK---lee..................................................................
Q29IQ7_DROPS/30-214                    ..............................................l-PFWGNETSMNLNPLILANIQS..S.SY.FKVHLFKLKT................................YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.YTLRLTRK..........QIN.GLLN......................................................HTDSA..YIRALGFM....Y...L.....RYTQP........................PGDL....YD.WYE.....DY..LQDEE.---------...................EIDVKa..gGGQVMTIGQMVY.QFM.......TKLDW...FS..T..LFPRIPVPIQKQIE-r....................................................................
G7E6U1_MIXOS/10-174                    ..............................................v-SIHGTNPQFLIETTIRYRIWD..S.NF.WKEHCFALTA................................-ESIIDRAVA-..LNYIGG..............-TYG.ASK.............................................-P.TDFLSLTLKM.LQIQPSKE..........IVL.EYLR......................................................AEEFK..YLRALAIF....Y...I.....RLTFD........................AMEV....YE.ILE.....PL..LEDYR.KLRYRQLDG...................-----....SYSIMTIDAFVD.SLL.......TEERV...CE..I..QLPRLTLRRVLEET-e....................................................................
B7FY05_PHATC/41-205                    ..............................................l-PLWGAPDSFHFNPLLLRNTVR..S.LY.FQKCCEKLLD................................WNAVVDEIYYE..VKYLQP..............FALD.--K.............................................SP.STAFCLLLRL.LTLRVTNH..........QME.LTLK......................................................HTDSP..YIRGIGFL....Y...L.....RYAGP........................PEQI....WS.FIE.....SS..LQDEE.ELVIEAGHR...................-----....-GKRSTIGQFVR.SLF.......SSRDF...YG..T..SLPRLPIQTERD---iq...................................................................
A0A0J6Y9X5_COCIT/21-209                ..............................................l--VRGVNPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LGYIGG..............-TYG.ANQ.............................................KP.TPFLCLAFKL.LQLAPERE..........VVL.EYLNfhdpaeddddng.............................dedggdgaavlksVGDFK..YLRALAAF....Y...I.....RLTFE........................PVEV....YN.VLE.....PL..LSDYR.KLKRRTKDG...................-----....-FVLTYMDQFVD.DLL.......NKDRV...CG..T..SLWKLPARRILEDL-d....................................................................
F7ALV5_CALJA/25-209                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
A0A0P1ARB7_9STRA/9-173                 ..............................................q-SVHGVNPQTLVEKIMRNRIYA..S.TY.WKEQCFGLTA................................-ETLVDKAVE-..LQEFGG..............-TFG.GNQ.............................................QP.THFLCLLLKM.LQLQPELE..........VVK.QFIE......................................................NEDYK..YVRVLGAV....Y...L.....RLVGK........................SLDC....YT.LLE.....PL..LCDYR.KIRKRNVIG...................-----....-WEITHIDEIAD.ALL.......TEEYY...ID..L..ALPRLINREVLEKN-e....................................................................
A0A0K0JVC6_BRUMA/73-120                ........................................lflvrgv----------------------..-.--.----------................................-----------..------..............---G.AGG.............................................VV.STAFCLLYKL.FTIRLSRK..........QLV.SMIN......................................................NSDSP..YIRG----....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------a....................................................................
M7YUL5_TRIUA/10-175                    ..............................................r-SIHGTNPQNLVEKIVRAKIYQ..S.NY.WKEQCFGLTA................................-ETLVDKAME-..LDHTGG..............-THG.GNR.............................................RP.TPFLCLALKM.LQIQPDKE..........IVV.EFIK......................................................NEDYK..YVRVLGAF....Y...L.....RLTGT........................VADV....YQ.YLE.....PL..YNDYR.KIRQKLSDG...................-----....KFTLTHVDEFID.ELL.......TKDYS...CD..T..ALPRIQKRWILEA--sg...................................................................
W5AB44_WHEAT/3-166                     ............................................iqt---SGKPIDMLMEKVLCMNILS..S.DY.FK-ELYRMKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKIL....WT.WYE.....PY..LKDDE.---------...................EFSPG...sNGRMTTMGVYVR.DLI.......LGQVC...FD..S..ILPRVPVPVV-----rqvt.................................................................
A0A016WJT5_9BILA/10-175                ..............................................h-TVRGTNPQFLIEKIIRQRIYD..S.KY.WKEYCFALSA................................-DLVVDRALE-..LRYIGG..............-IYA.GNV.............................................KP.TPFLCLSLKM.LQIQPEKD..........III.EFIQ......................................................QEQSK..YARALGAM....Y...L.....RLTFT........................SVEI....YK.YLE.....PL..FNDYR.KLRYMNKQG...................-----....RFELVYMDEFID.NLL.......REERY...CD..I..QLPRLQKRQALEE--vg...................................................................
A8IDN7_CHLRE/1-167                     ..............................................m-EIHGSNTTFNLENVLRQNILS..S.DY.YKGTCSELSN................................CSDIVDEIYES..VDHVEP..............WMSG.NAR.............................................GP.STAFCLLHRL.FTLKLSAK..........EVK.GMLD......................................................HKDSP..YIRAVGFL....Y...L.....RYVGD........................PKTL....WS.WVA.....PY..VKDQE.---------...................KFSPSg..pNEKEVAMGDYVR.DLL.......LSQYY...FE..T..IFPRIPKPVQDQIN-d....................................................................
A0A0C9MEM5_9FUNG/10-170                ..............................................l-ETWGNETTMNLNAIIYQNILS..S.PY.FR-SLYNKKT................................FHEIVDEIYNE..APFVKG..............----.-T-.............................................QP.STAYCCLFKM.WTLRLTVK..........QIE.NMID......................................................HVDSP..YIRAIGFL....Y...L.....RYVCA........................PAQL....WD.WLQ.....YY..LEDEE.EIAISS---...................----G...vNPTKITIGKLCR.MLI.......TEQKF...QN..T..MLPRIPVPIAR----dlek.................................................................
A0A016STJ3_9BILA/62-272                ..............................................l-PIWGNQQTMNLNGLVLENVKE..S.YY.YKNHLVEIDS................................AQQLLDEVFYK..VKHLEP..............WEKG.TRKvqgmtgmcg...........................gvrgvgaggVV.SSAFCLLYRF.FKVRLTRK..........QLI.SMIN......................................................SRVSP..YIRGLGFM....Y...I.....RYTQP........................PADL....WE.WFE.....PY..LVGCL.--SSIGKGNygfplstidahpffkddeeEIDPRs..gGGDIMTFGQVVR.IML.......TKLDW...YG..T..LFPRIPVPIQKEID-e....................................................................
A0A0L8GDY2_OCTBM/10-97                 ..............................................h-SVKGTNPQYLVEKIIRTRIYE..S.RY.WKEECFALTA................................-ELMVDKAME-..LKYIGG..............-VYG.GNI.............................................KP.TPFLCLVLKM.LQIQPEKD..........IVV.EFIR......................................................NEDFK..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------.....................................................................
A0A0C3NGM6_PHLGI/10-173                ..............................................q-AIHGQNPQFLVETVIRNRIYE..D.PF.WKEHCFALTA................................-ESLIDKTLE-..LKAVGG..............-VYG.NNK.............................................-P.TEFMCLLLKL.LQIQPEKE..........ILL.EYLQ......................................................ADEFK..YLRALAAM....Y...I.....RMTFR........................AAEV....YE.ILE.....PL..MRDFR.KIRYRNAGG...................-----....-YNLTFMDEFVD.QLL.......NEERV...CD..I..ILPRMTKREVLED--sg...................................................................
M2Y140_GALSU/5-87                      ..............................................l-EIYGNKKTFNFPEKVISNVLR..S.PY.FR-SLYELKT................................FNQVVDEIYNQ..VSYLEP..............WVAGkGVG.............................................TP.SSAFCLLYKL.FTLKLS--..........---.----......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------gvgvsv...............................................................
G3N166_BOVIN/47-231                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
A0A0B2UEZ7_9MICR/2-161                 ...........................................qykr-----------IGKIAREKIIE..S.QE.FR-AMRSLTY................................-SDLVNEICK-..LNSIGG..............MIR-.--N.............................................TP.HRFICLVHKL.DSISLIDD..........VVA.EALEdmkprhi.......................................gpsltandFKGNV..YLLTAFLL....Y...L.....RLSVN........................FHQY....RD.LIK.....CF..EADFR.KITVVNEQN...................-----....TRFSMYIDVFVD.DLL.......NKPRV...LG..I..CL-------------ni...................................................................
W5DUT1_WHEAT/1-85                      ...............................................----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........-MH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYAAD........................PKTL....WT.WYE.....PY..IQDDE.---------...................EFSPG...sNGKMTTMGVYVR.DVI.......LGQYY...FD..S..LLPRVPL--------lilrqvt..............................................................
A7APG3_BABBO/171-333                   ............................................ldm----TNSSTYNMNTLLLNNILN..S.DY.YK-SLSTMTS................................HHSIIDELAQY..ADHVEP..............YCKT.ATR.............................................VP.STLFCCLHKL.FTLRLTER..........QME.DLID......................................................CTKSP..YPRCCGFL....Y...L.....RFVLP........................SDQL....WA.WFE.....PY..LMDEE.---------...................TFVMSv..nPTRKTTIGKFCE.SLL.......VEDRY...FN..T..VLPRLPSRFK-----nmy..................................................................
T1HNK6_RHOPR/10-175                    ..............................................k-SVRGTNPQFLIEKIIRSRIYE..C.KY.WKEECFALSA................................-ELIVDKAME-..LRFLGG..............-VYG.GNV.............................................KP.SPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEEFK..YVRALGAL....Y...M.....RLVGT........................SIEC....YK.YLE.....PL..LNDGR.KLRNQTRDG...................-----....KFVMIHMDEYID.GLL.......HEERM...FD..I..ILPRIQKRHVLEEA-n....................................................................
A0A183ERW8_9BILA/1-32                  ...............................................----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------MDEFID.NLL.......REERY...CD..I..HLPRIQKRMTLEE--vg...................................................................
A0A091QWJ4_9GRUI/1-141                 ..............................................f----------------------..-.--.----------................................----------Q..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKTI--dq...................................................................
Q7JVL3_DROME/10-175                    ...............................................KNVHGTNPQYLIEKIIRSRIYD..S.KY.WKEQCFALTA................................-ELLVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TQFLCLTLKM.LQIQPEKD..........IVV.EFIK......................................................NEEFK..YVRALGAF....Y...L.....RLTGA........................ALDC....YK.YLE.....PL..YIDNR.KLRRQNRAG...................-----....QFEIVYMDEYID.ELL.......RNDRV...CD..I..ILPRIQKRSILEEN-n....................................................................
B6HM45_PENRW/21-204                    ..............................................l--VRGVNPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LTSIGG..............-TYG.VSE.............................................KP.TPFLCLAFKL.LQLGPDRD..........VIL.ELLNytdpgsgdea..................................edpdsalvkdRGDFK..YLRALAAF....Y...V.....RLTFD........................PVDV....YK.TLE.....PL..LLDYR.KLKRRVRDT...................-----....-FTLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKLPPRTQLEDL-d....................................................................
W7AWH2_PLAVN/10-175                    ............................................ikt---FGSNPQYLISNIIRNKIYD..S.PY.WKEKCFALTS................................-ESIIDQAVS-..LKYVGG..............-TYG.GNR.............................................KP.TRFLCLVLKL.LQLQPDKD..........IIY.EFIK......................................................NEEFI..YLRALGIF....Y...L.....RLVGK........................GIEI....YK.NIE.....PI..LFDYR.KIRLRLQDG...................-----....SFQKIYMDVFAD.NCL.......VFNNF...LD..V..DFPALTKRIVLEEN-n....................................................................
L5K4Z1_PTEAL/49-233                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
A0A154PJ62_9HYME/37-221                ..............................................l-PLWGNERTMNLNPLILTNIQS..S.HY.FKVNLYELKT................................YHEVIDEIYYK..VSHLEP..............WEKG.SRKtagqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.FTLRLTRK..........QLN.GLIN......................................................HPDSP..YIRALGFM....Y...I.....RYTQP........................PADL....FS.WYS.....DY..LEDEE.---------...................ELDVKa..gGGQVMKMGDILK.QFL.......TKLEW...FS..T..LFPRIPVPIQKEL--eh...................................................................
K6UDH3_9APIC/43-122                    ..............................................t----------------------..-.--.----------................................-----------..------..............----.---.............................................--.------LLKL.LQIQPDKD..........IIY.EYIK......................................................NEEFI..YLRALGIF....Y...L.....RLIGK........................SLEI....YR.YLE.....PI..LFDYR.KLRIRLQNG...................-----....TFEKIYMDEFVD.NCL.......-----...--..-..---------------.....................................................................
A0A0A0AJE5_CHAVO/33-217                ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKAI--dq...................................................................
T1EG64_HELRO/7-191                     ..............................................l-PIHGNEKTMNLNSLVLANIQA..S.PY.FKVHLYELKT................................YHKVIDEIYYK..VNHLEP..............WEKG.SRKlagqtgmcg...........................gvrgvgtggIV.SSAYCLLYKL.YTLKLTRK..........QLI.GLCT......................................................HTDSS..FIRALGLM....Y...I.....RYTQP........................PNTF....WE.WLE.....PY..LDDDE.---------...................EVDPKa..gGGNNMTIGEMCE.QLL.......LKLDW...YG..T..LFPRIPVPIQKDI--en...................................................................
A0A0A0KT86_CUCSA/8-91                  .....................................lrsygsnsii----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..HLVLIGFL....Y...L.....RYVAD........................PKTL....WN.WFE.....PY..VKDDE.---------...................EFSPG...sHGRMTTMGVYVR.DLL.......LGQYY...FD..T..LFPRIPVPV------lrqvv................................................................
E1C6A8_CHICK/10-175                    ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LKYVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HEERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A0T6AZN8_9SCAR/31-176                ..............................................l-QLWGNERTMNLNPLILTNIQS..S.HY.FKVNLYELKT................................YHEVVDEIYYK..VTHLEP..............WEKG.SRRtsgqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.FTLKLTRK..........QLN.GLIT......................................................HCDSP..YIRALGFM....Y...I.....RYVLP........................PAQL....LD.WYE.....PY..LDDEE.-VRT-----...................-----....------------.---.......-----...--..-..---------------yrn..................................................................
M1CAV6_SOLTU/10-175                    ...............................................KSIRGTNPQNLVEKILRSKIYQ..N.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHLGG..............-TFG.GNR.............................................KP.SPFICLVMKM.LQIQPEKD..........IVV.EFIK......................................................NEDYK..YVRVLGAF....Y...L.....RLTGT........................DIDI....YR.YLE.....PL..YNDYR.KLRRKLADG...................-----....QYALTHVDEYID.ELL.......TTDYS...CD..I..ALPRIKKRWILEQN-k....................................................................
K7V8Q5_MAIZE/76-246                    ...........................................iqss----GRSIEGLMDKVLSVNILS..S.DY.FK-ELFKYKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.SSAFCLLYKLlFTMKLTVK..........QMH.GLLK......................................................HQDSP..YIRADAKC....FrniV.....RSQAV........................SRNI....VN.AIRevldaPA..TADAR.VAKMLLAEE...................-----....------------.---.......-----...--..-..---------------mknevskeyflktvrnivgdkllkqaasqyqm.....................................
A0A0V1M1H2_9BILA/1-81                  .............................................my----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................----E..YIRALGAL....Y...L.....RMTFS........................YVEV....YK.YLE.....PL..LNDYR.KLRWINKQG...................-----....KFELIHMDEFVD.KLL.......REERF...CD..V..QLPRLQKRVLLEET-n....................................................................
A0A068SG10_9FUNG/10-173                ..............................................i-AVHGKDPQHLVEKIIRERIYD..S.LY.WKEHCFGLSS................................-ATLMDKAVK-..LTYIGG..............-QYA.GQH.............................................-P.TEFLCLTLKM.LQLQPEKE..........IVH.ELIK......................................................QEDFK..YLRALSAF....Y...L.....RLVGR........................SKEI....YL.ALE.....PL..LNDPR.KLRVRQGDG...................-----....-YSLTYMDEFVD.QLL.......HEERV...CD..V..ILPRLVSRYIMEEN-d....................................................................
W3XIF8_9PEZI/20-186                    .............................................cp---NGMNPATLLEKAMIERIID..S.FY.FKDACFGLNE................................-ADIVDRVVSH..VTFVGG..............-TYG.SSQ.............................................KP.TPFLCLLFKL.LQLGPGDD..........VLG.EYLSf....................................................gGERFK..YLRALAAF....Y...I.....RLTRR........................SEDV....YK.TLE.....PF..LEDRR.KLRRKGAQG...................-----....-TTLTFVDQFVD.DLL.......TKDRV...CG..T..TLWQLTKRELLED--le...................................................................
A0A183H881_9BILA/74-258                ..............................................l-PLWGNTQTMNLNALVLENIIQ..C.TY.YKNYLSETTG................................FQQLTEEIYYS..VKHLEP..............WERG.TRKtqgmtgmcg...........................gvrgvgaggVV.STAFCLLYKL.FTIRLSRK..........QLV.SMIN......................................................NSNSP..YIRGIGFM....Y...I.....RFCQP........................PQDL....WA.WME.....PY..LDDEE.---------...................QIDPRs..gGGDVMAMAQVVK.MML.......TKLDW...YG..T..LFPRIPVPIQKEI--el...................................................................
E2AHT2_CAMFO/35-218                    ..............................................l-PLWGNERTMNLNPLILTNIQS..S.HY.FKVNLYELKT................................YHEVIDEIYYK..VSHLEP..............WEKG.SRKtagqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.FTLRLTRK..........QLN.GLIN......................................................HPDSP..YIRALGFM....Y...I.....RYTQP........................PADL....FS.WYS.....DY..LEDEE.---------...................ELDVKa..gGGQTMKMGDILK.QFL.......TKLEW...FS..T..LFPRIPVPIQKD---le...................................................................
I3MQ15_ICTTR/10-175                    ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
H2ZFB4_CIOSA/10-175                    .............................................yt--IKGTNPQYLIEKIIRSRIYD..S.RY.WKEQCFALSA................................-ELLVDKAME-..LKYVGG..............-VYA.GNI.............................................KP.SPFLCLILKM.LQIQPDKD..........IIV.EFIR......................................................NEDFK..YVRCLGAF....Y...M.....RITGK........................SLEC....YK.YLE.....PL..LNDFR.KIKFQKRDG...................-----....NFVVTHMDEFID.ELL.......REERS...CD..V..ILPRIQKRQILEE--le...................................................................
Q57XW0_TRYB2/205-343                   ..............................heavtslresqrherrv----------------------..-.--.----------................................-ESLLHYCEQN..VLYIGV..............--MD.EEG.............................................KA.TPFLLAIGAF.YKLGLTRH..........DAL.VHFA......................................................RHHRR..TIRALALF....I...A.....RYTTA........................PEEL....EP.FFT.....PS..LTDEV.VVACAEDQQ...................-----....--VTCSMRQLAE.DLL.......LHDEV...CE..A..---------------wpptlhpf.............................................................
U9UJB9_RHIID/7-167                     ..............................................l-ETWGSETTMNLNNILYQNIQA..S.PY.FK-HLYELKT................................YHEVIDEIFN-..---HEP..............FLKG.TTA.............................................--.STAFCLLYKL.WTLRLTVK..........QVN.GLIE......................................................HTDSP..HIRALGFL....Y...L.....RYVCK........................PIHL....WE.WFE.....EY..LDDEE.E--------...................-VQIQg.gpRPVIITIGKMCR.QLL.......TEQKW...LG..T..ILPRIPVPIAREIE-q....................................................................
W5MMD1_LEPOC/32-216                    ..............................................l-PLWGNEKTMNLNPMILTNVLS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHIEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PADL....MD.WFD.....SF..LDDEE.---------...................ELDVKa..gGGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKL---idq..................................................................
A0A0A1NZQ0_9FUNG/11-122                .............................................tg--VHGRHPMHLVEKIIRERIQE..S.IY.WKEKCYGLTA................................-ATLMERAVE-..IEYIGG..............-TFG.NLQ.............................................-P.TEFLCLLLKL.LQLLPERE..........III.EYIM......................................................QDDFK..YLRALGAF....Y...L.....RLTGK........................SVEI....E-.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------sikie................................................................
A0A096RF19_MAIZE/1-55                  ..............................................m----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................----....--.WYE.....PY..LRDDE.---------...................EFSPG...sNGRKTTMGVYVR.DLI.......LGQYY...FD..S..LLPRIPLPVTRQ---ita..................................................................
A0A0D0DXK7_9HOMO/10-173                ..............................................l-AIHGQNPQFLVETVIRNRIWE..S.AY.WKEHCFALTA................................-ESLIDKAIE-..VHCIGG..............-VYG.NQR.............................................-P.TEFLCLLLKL.LQLQPEKE..........ILI.EYLQ......................................................ADEFK..YMRALAAM....Y...I.....RMTFS........................AVEV....YE.ILE.....PL..MKDYR.KLRHRDMAG...................-----....-YSLLYFDEFIY.SLL.......TEERV...CD..I..ILPRIAKRQTLEEN-g....................................................................
K2N6A4_TRYCR/38-206                    .............................................wn--LKGRSAVAALDPPTRHRIMQ..S.HA.MA-SCFHKPL................................-LATLEVLIT-..VQYVGG..............-ITG.PLQ.............................................KP.EPFICHVTRL.LQITPDPS..........IVL.AMLH......................................................QDVHK..YLRVAALF....I...I.....RLIGN........................EAMM....RE.AMR.....VG..WEDYR.KIRVYGYVE...................-----....------------.---.......-----...--..-..---------------dlagttdgkentasdedegfvrapaygimcvdeitdrlfnvg...........................
A0A165HA15_9APHY/10-173                ..............................................q-AIHGQNPQFLVEAVIRNRIYE..S.TY.WKEHCFALTA................................-ESLIDKAIE-..LKYVGG..............-VYG.N-Q.............................................KP.TEFLCLLLKL.LQIQPEKE..........ILL.EYLQ......................................................ADEFK..YLRVLAVM....Y...I.....RMTFR........................AVEV....YE.ILE.....PL..LKDYR.KLRYRGTNG...................-----....-FTLTYVDEFVD.NLL.......VEERV...CD..I..ILPRLTKRDVLED--ma...................................................................
A0A151Z6Y5_9MYCE/4-168                 ..............................................l-EIHGNDKTMNLDQVLLNSIQS..S.LY.FK-QLGSVRT................................FSDVVDEIYNN..VEYLAP..............YIP-.NTK.............................................SP.STAYCILYKL.FLMKLRDN..........EMV.TLLE......................................................HQDSP..YIRAIGFL....Y...L.....RYCHP........................PTKL....LE.WFD.....SY..FEDFE.YVKISPKSS...................-----....---EITMQRFMV.ILL.......TEPKF...NN.eS..LLPRLPVKTQKEID-e....................................................................
L1ICQ1_GUITH/10-169                    ..............................................a-SVHGTNPQFLVEKILRQKIYD..D.NY.WKEHLFGLTA................................-ETIVDRAME-..LDHIGG..............-TFG.GNN.............................................KP.TVFIQLVLKL.LQLQPEKE..........IVL.EFIR......................................................NEEFK..YVRALGAF....Y...L.....RLTGR........................ALDI....YQ.YLE.....PL..LNDYR.KLRV-----...................-----....-ISVMYMDVFID.QLL.......RDPMV...LD..V..ALPTLPKRLNLEDL-k....................................................................
C1H036_PARBA/21-214                    ..............................................l--IRGVNPATLFEKAVRDRITE..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LTYIGG..............-TYG.LAQ.............................................KP.TPFLCLAFKM.LQLSPEKE..........IVL.EYLNfndpetghdgvygen........................nveedhdtdsgvvkaVGDFK..YLRALAAF....Y...I.....RLTFD........................AAEI....YT.TLE.....PL..LADYR.KLKRRTKDG...................-----....-FLLTYMDQFVD.DLL.......TKDRV...CA..T..SLWKLPSRTQLEDL-d....................................................................
A0A0P7V7J0_9TELE/41-225                ..............................................l-PLWGNEKTMNLNPMILTNVLS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PADL....LN.WFD.....AF..FDDEE.---------...................ELDVKa..gGGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKVI--dq...................................................................
C5K8A2_PERM5/121-216                   ............................................lql----TNTTTYNYPQMLHQQLAK..S.AY.YH-SIQPLDT................................PEAIIDEIKTR..CKDAEP..............YAPG.SHT.............................................AP.STMFCCLYRL.FVMRINSK..........VLG.QLIN......................................................YHGAP..YVRSI---....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------ee...................................................................
A0A0L1HPK7_9PLEO/23-231                .............................................al--IRGQNPALLFEKGVRERITE..S.YY.WKEQCFGLNA................................-ATLCDRAAD-..LKFIGG..............-TTG.ITG.............................................KP.TPFLCLAFKM.LQLVPDKD..........IIL.EYLNfrddeddqepnaqvknehgdta..........adeeeeeedatkkeldlnasgkLGDFK..YLRCLAAF....Y...I.....RLAWE........................PVEI....YQ.TLE.....PL..LTDYR.KIKRRLKDT...................-----....-FTLTHVDQFID.DLL.......TKDRI...CA..T..SLWKLPSRANLEDL-e....................................................................
C4LZA0_ENTHI/2-162                     ..........................................sgper----------RLETILRNKIYN..C.EY.WKQQCFTLTS................................-ETILDEIVK-..LHDFGG..............-TYG.VLK.............................................KP.TKFIVLIMKL.LMLRPDKS..........IIY.EYIM......................................................NEEFK..YVRVIGAF....Y...L.....RLIGS........................SKEC....YQ.FIE.....PL..YYDYR.PLKYRIDSK...................-----....HYEIITIDQFAW.NLL.......HLDYY...CD..I..TLPIITPRPVIE---shg..................................................................
A2Q158_MEDTR/10-175                    ...............................................KSIRGTNPQNLVEKILRSKIYQ..H.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHLGG..............-TYG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKE..........IVI.EFIK......................................................NDDYK..YVRILGAF....Y...L.....RLTGS........................DTDV....YH.YLE.....PL..YNDYR.KLRRKLPDG...................-----....QFALTHVDEVID.ELL.......TTDYS...CD..I..AMPRIKKRWTLES--lg...................................................................
A0A165H573_9PEZI/21-184                ..............................................l--IRGENPANLIEKPLQDRITE..T.YY.WKEQCFALNE................................-ASLCDRAVD-..MNFIGG..............-TYG.QQK.............................................-A.SPFLCLVFKL.LQLQPERE..........IVL.YYLH.....................................................nEEGFK..YLTALAAF....Y...I.....RLTFE........................PVEI....YK.ALE.....PL..LSDYR.KLRRRRNDG...................-----....-FMITHMDQFID.DLL.......TKDRM...CG..T..TLWKLPKRQLLEDL-e....................................................................
A0A177BXT3_9PLEO/18-214                ............................................vrg----GVNPVTLIEKAMRERIIE..S.MY.WKEQLFAVNE................................-AMICDRAVS-..LTHVGG..............---S.VNN.............................................RP.TPFICILLKL.LSLVPSEE..........IIL.EMLNyeeegdegeepgsadpe...................qelqngdtndiekekagkKGSFK..YLRALAAF....Y...V.....RLTME........................PVQV....YK.TLE.....PL..LLDRR.KLKYRKQAG...................-----....-FTLTYIDEFVD.NLL.......TQPRL...CG..T..SLPALPPRSVLEDL-d....................................................................
Q28XW5_DROPS/10-175                    ...............................................KNVHGTNPQYLIEKIIRSRIYD..S.KY.WKEQCFALTA................................-ELLVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TQFLCLTLKM.LQIQPEKD..........IVV.EFIK......................................................NEEFK..YVRALGAF....Y...L.....RLTGV........................ALDC....YK.YLE.....PL..YIDNR.KLRRQNRAG...................-----....QFEIVYMDEYID.ELL.......RNDRV...CD..I..ILPRIQKRTILEEN-n....................................................................
F7G6K1_MONDO/12-177                    ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LRFMGG..............-VYG.STI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIR......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................ATDC....YK.YLE.....PL..YNDYR.KIRIQNRNG...................-----....EFELMRMDEFID.ELL.......HRERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
G3Y0M7_ASPNA/21-209                    ..............................................l--VRGVNPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LTSIGG..............-VYG.VSE.............................................KP.SPFLCLAFKL.LQLNPERD..........IIL.EYLNfsdpandedstg.............................heerehddgvvkaRGDFK..YLRALAAF....Y...V.....RLTFE........................PVEV....YK.TLE.....PL..LLDYR.KLKRRVRDS...................-----....-FTLTYMDQFVD.ELL.......TKERV...CG..T..SLWKLPARQVLEDL-d....................................................................
I1EAR9_AMPQE/1-144                     ...............................................----------------------..C.QY.WKEKCFALTA................................-ELLVDEAMA-..LDYVGG..............-VVG.GNI.............................................KP.TPFLCLILKM.LQIQPNKD..........IVI.EFIK......................................................NPDYK..YVRALGAL....Y...L.....RIVGT........................SVEC....YK.YLE.....PL..YNDYR.KIKYKNRQG...................-----....KFELSHVDEFVD.SLL.......REDRV...CD..V..ILPRIQKRHILEET-e....................................................................
A8X8F6_CAEBR/10-175                    ..............................................k-TVKGTNPQFLVEKIIRQRIYD..S.MY.WKEHCFALTA................................-ELVVDKGMD-..LRYIGG..............-IYA.GNI.............................................KP.TPFLCLALKM.LQIQPDKD..........IVL.EFIQ......................................................QEEFK..YIRALGAM....Y...L.....RLTFD........................STEI....YK.YLE.....PL..YNDFR.KLRFMNKMG...................-----....RFEAIYMDDFID.NLL.......REDRY...CD..I..QLPRLQRRWALEE--vd...................................................................
A0A132A7Z0_SARSC/10-175                ...............................................KTIHGTNPQYLIEKIIRTRIYE..S.RY.WKEECFGLTA................................-DLVVDRGAD-..LRYIGG..............-SYG.GNI.............................................KT.TPFLCLILKL.LQIQPEKD..........III.EFIR......................................................QENFK..YIRALGAF....Y...L.....RLVGN........................SLDI....YK.YLE.....PL..YNDYR.KLRRMTKMG...................-----....TFDVIYMDEFID.LLL.......RDDRV...FD..I..ILPRLTKRFVHEE--ng...................................................................
A0A0V0XSG6_TRIPS/126-309               .............................................ls--FWGNKETMNLNHLVLENIVS..S.PY.YKNTLLPLKT................................HFEVIDEIYYN..VEHLEP..............WEKG.TRKttgqtgmcg...........................gvrgvgaggVV.SSAFCLLYKL.FTLKLTRK..........QLT.AILN......................................................HPDSC..YIRGLGFM....Y...I.....RFCLH........................PATF....WS.WYE.....PY..FDDAE.---------...................EIDPKa..gGGDLMTIGEMVK.SLL.......TKLDW...YS..T..LFPRIPVPIQKEI--d....................................................................
A0A0M3JW10_ANISI/46-229                ..............................................l-PLWGNTQSMNLNALVLENIIQ..C.TY.YKNYLAETTG................................FQQLTEEIYYN..VKHLEP..............WERG.TRKtqgmtgmcg...........................gvrgvgaggVV.STAFCLLYKL.FTIRLTRK..........QLV.SMIN......................................................NRDSP..YIRGIGFM....Y...I.....RFCQP........................PTDL....WT.WME.....PY..LDDEE.---------...................QIDPRs..gGGDVMSMAQVVK.MML.......TKLDW...YG..T..LFPRIPVPIQKD---ie...................................................................
F6QPW1_MACMU/47-231                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
J3M4G7_ORYBR/3-166                     ............................................iqt---SGKPIDLLMEKVLCMNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKNL....WT.WYE.....PY..LKDDE.---------...................EFSPG...sNGRMTTMGVYVR.DLI.......LGQYY...FD..S..LLPRVPLPV------irqvt................................................................
U6PD84_HAECO/69-253                    ..............................................l-PCWGNQQTMNLNGLVLENVKE..S.YY.YKNHLVEIDT................................AQQLLDEVFYK..VKHLEP..............WEKG.TRKvqgmtgmcg...........................gvrgvgaggVV.SSAFCLLYRF.FKVRLTRK..........QLI.SMIN......................................................SRVSP..YIRGLGFM....Y...I.....RYTQP........................PADL....WE.WFE.....PY..LDDEE.---------...................EIDPRs..gGGDVMTFGQVVR.IML.......TKLDW...YG..T..LFPRIPVPIQKEID-e....................................................................
M1W229_CLAP2/24-191                    ............................................lap---NGLNPATIMEKAVRDRIVE..S.HF.YMEQCFAVNE................................-ADIIDRVVEH..VTFVGG..............-TYG.DSQ.............................................KP.SPFLCLAFKL.LELGPSDE..........ILA.EYLSy....................................................gGEQFK..YLRALASF....Y...F.....RMTRQ........................AKDI....YE.TLE.....PF..LEDRR.KLRRKGRAG...................-----....-TSLTYVDEFVD.DLL.......VKERV...CA..T..SLWKMPKREILEDL-e....................................................................
L1J4V0_GUITH/160-321                   ...........................................kqvc------NDAYNLNPVLRENILA..S.DY.FK-ALAEFTT................................FEELVDEIYNK..VTYATP..............-FIP.NTR.............................................SP.SSCFCLLYRL.FQMRLTYK..........QLA.DLLE......................................................HPDSP..MIPVVGIL....Y...V.....RYVVD........................PKEM....WG.FFK.....NK..INDST.---------...................EFDAS...pGGKKKTIGQFTR.EVI.......EDIHY...FD..T..ILPRIPVAIQRDM--qe...................................................................
W2QD97_PHYPN/37-201                    ..............................................l-PIYGNDTTYNLNTLLHQNILQ..S.AY.FH-ELYKFRT................................YHEVVDEIYYR..VDHAEP..............WSPG.TAR.............................................IP.SSCFCLLHKF.FLMRLTRK..........QMQ.GLLR......................................................HTDSP..YIRAVGFL....Y...L.....RFTCD........................PEEL....WT.WFE.....PF..LEDPE.---------...................EFNASa..nPSVKTTIGEWLI.SLL.......EENNY...FG..T..ILPRIPKKIE-----dgik.................................................................
A0A0A1N932_9FUNG/9-173                 ..............................................l-ETWGNETTMNMNAIIYQNILS..S.PY.FR-SLYEKKT................................FHEIVDEIYNE..VTVLTP..............FIKG.-N-.............................................QP.STAFCLLFKL.WTIRLTVR..........QIE.NLVE......................................................HGDSP..YIRAIGFL....Y...L.....RYVCA........................PAKL....WD.WFQ.....YY..LEDDE.EIAI-----...................----Ss.glHPTKVTVGNLIR.MLI.......TELKF...QG..T..MLPRIPIPIAR----dlek.................................................................
C5X6Q2_SORBI/10-175                    ...............................................KSIHGTNPQNLVEKIVRSKIYQ..S.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHTGG..............-TYG.GNR.............................................KP.TPFLCLALKM.LQIQPDKD..........IVV.EFIK......................................................NEDYK..YVRVLGAF....Y...L.....RLTGT........................IADV....YQ.YLE.....PL..YNDYR.KIRHKLSDG...................-----....QFTLTHVDEFID.ELL.......TKDYS...CD..T..ALPRIQKRWVLEA--sg...................................................................
R9P9R0_PSEHS/10-175                    ..............................................h-SIHGTNPQHLIEKPIRYRIYS..S.PY.WKQHCFALSA................................-STILPLATS-..LHHIGG..............-LIG.GLQ.............................................RP.SHFLCLLQKL.LQIQPDPS..........IID.AYLD......................................................ASDFK..YLRALTAF....Y...I.....RLTYD........................SKSI....YE.KLE.....PL..LEDGR.KLRWCRADG...................-----....GYEVMCVDEWVD.SLL.......REERV...CD..I..ILPRLVRREVCE---vrd..................................................................
A0A088A0G8_APIME/10-175                ...............................................KSIRGTNPQYLVEKIIRSRVYD..S.KY.WKEECFALTA................................-ELLVDKAME-..LRYIGG..............-VYG.GNV.............................................KP.TPFLCLILKM.LQIQPEKD..........IIV.EFIK......................................................NEEFK..YVRALGAL....Y...M.....RLTGS........................SLDC....YK.YLE.....PL..FNDNR.KLRRQNKQG...................-----....KFELIHMDEFID.DLL.......REERC...CD..V..ILPRIQKRHVLEEN-n....................................................................
A0A0B0P1S4_GOSAR/10-175                ...............................................KSIRGTNPQNLVEKIVRSKIYQ..N.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHIGG..............-TYG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKD..........IVV.EFIK......................................................NDDYK..YVRVLGAF....Y...L.....RLTGI........................DSDI....YR.YLE.....PL..YNDYR.KVRRKSPDG...................-----....NFMLTHVDEVID.ELL.......TRDYS...CD..I..ALPRIKKRWTLES--lg...................................................................
A0A0F8UXB5_9EURO/21-212                ..............................................l--VRGVNPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LTSIGG..............-TYG.TSE.............................................KP.SPFLCLAFKL.LQLNPERD..........VVL.EYLNfsdpeldtneaege..........................taagereqnsvlkqRGDFK..YLRALAAF....Y...V.....RLTFE........................PVEV....YK.TLE.....PL..LLDYR.KLKRRIRDS...................-----....-FTLTHVDAFID.DLL.......TKDRV...CG..T..SLWKLPSRQQLEDL-d....................................................................
E5RYR9_TRISP/10-175                    ..............................................a-SLKGTNPQYLIEKVTRSRIYD..S.RY.WKEECFALSA................................-ELLVDRGME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLLLKM.LQIQPEKD..........IVI.EFIR......................................................QEDSK..YIRALGAL....Y...L.....RMTFS........................YVEV....YK.YLE.....PL..LNDYR.KLRWINKQG...................-----....KFELIHMDEFVD.KLL.......REERF...CD..V..QLPRLQKRAFLEE--tn...................................................................
E1BVP9_CHICK/50-234                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKTI--dq...................................................................
A0A0J8QQH2_COCIT/21-209                ..............................................l--VRGVNPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LGYIGG..............-TYG.ANQ.............................................KP.TPFLCLAFKL.LQLAPERE..........VVL.EYLNfhdpaeddddng.............................dedggdgaavlksVGDFK..YLRALAAF....Y...I.....RLTFE........................PVEV....YN.VLE.....PL..LSDYR.KLKRRTKDG...................-----....-FVLTYMDQFVD.DLL.......NKDRV...CG..T..SLWKLPARRILEDL-d....................................................................
A0A0L7LKK1_9NEOP/87-152                ...........................................mcgg----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....----P........................PADL....FD.WYA.....EY..LYDEE.---------...................EVDPRa..gGGGPTTIGALVR.QMM.......IKLDW...FS..T..LFPRIPVPIQKQIE-q....................................................................
A0A093HAH5_STRCA/1-139                 ...............................................----------------------..-.--.----------................................-----------..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKTI--dq...................................................................
W5AKT7_WHEAT/3-166                     ............................................iqt---SGKPIDMLMEKVLCMNILS..S.DY.FK-ELYQMKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKIL....WT.WYE.....PY..LKDDE.---------...................EFSPG...sNGRMTTMGVYVR.DLI.......LGQYY...FD..S..ILPRVPVPVV-----rqvt.................................................................
K1WAK9_MARBU/21-188                    ............................................lap---NGLNPATIMEKPVRERIVD..C.YF.WKDQCFAVNE................................-ADIVDRVVAH..VTFIGG..............-TYG.DAQ.............................................RP.SPFLCLAFKL.LQLGPTDE..........ILT.EYLEy....................................................gGEKFK..YLRALAMF....Y...I.....RLTRQ........................AKDV....YR.LLE.....PF..LADYR.KLKRRGRMG...................-----....-TSLTYVDVFAD.ELL.......VKDRV...CG..T..TLWKMPKREILEDL-d....................................................................
T1JGX1_STRMM/10-175                    ..............................................h-SVKGTNPQYLVEKIIRSRIYD..S.RF.WKEECFALTA................................-ELLVDKAME-..MKFIGG..............-VFG.GNI.............................................KP.CAFLCLLLKM.LQIQPEKD..........IVV.EFIR......................................................NEDFK..YVRVLGAL....Y...M.....RLVGT........................SLDC....YK.YLE.....PL..YNDYR.KLKRQNRSG...................-----....LFEIVHMDELID.ELL.......RGERA...CD..I..ILPRIQKRYVLEE--ln...................................................................
W7X6X1_TETTS/10-175                    ..............................................l-SVRGQNPQNLIEAVIRNKIYQ..N.RY.WKEKLPGLTA................................-ASIIDEALE-..LDYVGG..............-TYG.GNR.............................................KP.SKFLMLSLKL.LQISPEKA..........EVM.EYIN......................................................QEDYK..YLTALGCF....Y...I.....RLVAS........................SEDI....YK.ILE.....PL..YADYR.KLRFRDLDG...................-----....SFKIIHMDEFVE.SLI.......NQEVY...LD..T..LLPNIQKRRVLEEN-g....................................................................
A0A183VNI8_TRIRE/118-184               ..............................................l----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....KYCIP........................PEDF....WW.WYS.....PY..WGDPE.---------...................ELDVKa..gGGCVMTIGHMIE.QWL.......TKLDW...FS..T..LFPRIPVPVQKK---lee..................................................................
E9EM03_METRA/24-191                    ............................................lap---NGLNPATIMEKAVKDRIVE..S.YF.YKEQCFALNE................................-ADIVDRVVEH..VRFVGG..............-THG.DAQ.............................................KP.SPFLCLAFKL.LELGPSEA..........VVR.EYLSy....................................................gGEHFK..YLRALACF....Y...Y.....RLTRR........................AADV....HR.ALE.....PF..LGDRR.KLRTRGRRG...................-----....-AALTYVDEFVD.GLL.......TRERV...CA..T..SLWKMPPREVLEDL-d....................................................................
A0A0N4X5Z2_HAEPC/70-254                ..............................................l-PCWGNQQTMNLNGLVLENVKE..S.YY.YKNHLVEIDT................................AQQLLDEVFYK..VKHLEP..............WEKG.TRKvqgmtgmcg...........................gvrgvgaggVV.SSAFCLLYRF.FKVRLTRK..........QLI.SMIN......................................................SRVSP..YIRGLGFM....Y...I.....RYTQP........................PADL....WE.WFE.....PY..LDDEE.---------...................EIDPRs..gGGDVMTFGQVVR.IML.......TKLDW...YG..T..LFPRIPVPIQKEID-e....................................................................
C5K487_PERM5/83-217                    ..................................khnngckkcreyk----------------------..-.--.----------................................--EWVVATLN-..VGNIRN..............---G.SLT.............................................VP.STMFCCLYRL.FVMRINSK..........VLG.QLIN......................................................YHGAP..YVRCAGFL....Y...V.....RFGLS........................PRDY....WS.FLQ.....PH..LLDDE.---------...................EFTPGc..dKGRIITMGEYVE.KLL.......TEDRY...YS..L..L--------------iiarlrsiee...........................................................
G1SEF5_RABIT/10-175                    ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
Q54J00_DICDI/3-165                     ............................................let---FGNEKSMNLDNVLLTNIQS..S.LY.FK-NLYPKRS................................YHEVIEEIKRN..VEILAP..............YIP-.NTK.............................................TP.STTFCLLYKF.FLMKLTVK..........QMK.GLLG......................................................NNESP..YIRAIGAL....Y...L.....RYCHP........................PANL....WD.WYV.....DY..LDDQE.---------...................TVFIS....KNTEVTIQRFLL.DLL.......KDNKF...SG..T..VLPRIPTKIQQD---ldk..................................................................
A0A0D9WLP6_9ORYZ/3-166                 ........................................iqssgrp-------IEVLMEKVLSVNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.SSAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYVAE........................PKTL....WG.WYE.....PY..ITDDE.---------...................EFSPG...sNGKMTTMGVYVR.DLI.......LGQYY...FD..S..LLPRVPL--------lilrqvt..............................................................
A0A0P1BIZ5_9BASI/10-175                ..............................................l-HVRGTNPQHLIEKVVRSRIYD..S.IY.WKEHCFALTA................................-ESLIPLAAD-..LKYVGG..............-TYG.GAI.............................................KP.SEYLCLVCKL.LQLQPEKE..........IVL.EYLK......................................................ADDLK..YLRAVAAM....Y...V.....RMVFS........................SVEV....YE.LLE.....PM..LNDYH.KLRWRDMDG...................-----....SYRLTHMDVFID.ELL.......TLDRV...AD..L..ILPRLARRDVLEET-e....................................................................
X0J3G6_FUSOX/26-192                    .............................................ap---NGLNPATIMEKAVKDRIVD..S.YF.YKEQCFALNE................................-ADIVDRVVEH..VNFIGG..............-TYG.VTQ.............................................KP.SPFLCLAFKL.LELSPSDA..........VLM.EYLKy....................................................gGEAFK..YLRALACF....Y...F.....RLTRQ........................AKDV....YE.MLE.....PF..LEDRR.KLRRRGRAG...................-----....-VVLTFMDEFVD.ELL.......TKERV...CG..T..SLWKMPKREVLEDL-e....................................................................
A0A096RF20_MAIZE/2-80                  ............................................tvl----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................----R..YLVQIGFL....Y...L.....RYVAD........................PKVL....WM.WYE.....PY..LRDDE.---------...................EFSPG...sNGRKTTMGVYVR.DLI.......LGQYY...FD..S..LLPRIPLPVTRQ---ita..................................................................
I3JV42_ORENI/25-209                    ..............................................l-PLWGNEKTMNLNPMILTNVLS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHIEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QLM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....FE.WYD.....GF..LDDEE.---------...................ELDVKa..gGGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKVI--dq...................................................................
K3ZF04_SETIT/3-166                     ............................................iqt---SGKPIDLLMEKVLCMNILS..S.EY.FK-ELYRLKT................................YHEVIDEIYTC..VEHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKTL....WT.WYE.....PY..LRDDE.---------...................EFSPG...sNGRMTTMGVYVR.DLI.......LGQYY...FD..S..LLPRIPLPVT-----rqvt.................................................................
W7AKF8_9APIC/252-414                   ............................................lem----TNTTTYNVNTLLRNNILS..S.EY.FR-SLISFKT................................IKEVLDEIHLY..ADHVEP..............YCIG.STR.............................................AP.STLFCCLYKL.FTMHLSEK..........QMK.MLIE......................................................SRDSC..YIRACGFL....Y...L.....RYVHS........................PANL....WM.WFE.....PY..LLDED.--QFVT---...................----Sa..dKRKKQTIGEYIQ.SLL.......ADDKY...FN..T..VLPRMPIKIK-----nty..................................................................
G1THN5_RABIT/1-139                     ...............................................----------------------..-.--.----------................................-----------..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
B2ATX0_PODAN/63-230                    ............................................lap---NGLNPATILEKAVRERIVD..S.YF.YKEQCYAINE................................-ADIVDRVVEH..VDHIGG..............-VTG.TVQ.............................................KP.TPFLCLAFKL.LQLAPNDD..........ILN.EYLNf....................................................gGEKFK..YLRALAVF....Y...I.....RLTRQ........................DKDV....YT.RLE.....PF..LEDRR.KLRRKGRNG...................-----....-VSLTYMDEFVD.DLL.......VKDRV...CA..T..SLWKMRRRDVLED--le...................................................................
V8PH37_OPHHA/10-175                    ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LRYTGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRLLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKNQNRNG...................-----....EFELMHVDEFID.QLL.......HDERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A0F9XUE7_TRIHA/26-193                ............................................lap---NGLNPATIMEKAVKDRIVD..S.YF.YKEQCFALNE................................-ADIIDRVVEH..VNFIGG..............-THG.ASQ.............................................KP.SPFLCLAFKL.LELAPSDA..........ILN.EYLSy....................................................gGEHFK..YLRALACF....Y...V.....RLTRQ........................PKDV....YQ.TLE.....PF..LEDRR.KLRRKARAG...................-----....-TSLTYVDEFVD.DLL.......TKDRV...CA..T..SLWKMPKRETLEDL-e....................................................................
H2MLH7_ORYLA/25-209                    ..............................................l-PLWGNEKTMNLNPMILTNVLS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHIEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QLM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....LD.WYD.....GF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKMI--dq...................................................................
W5MME7_LEPOC/32-216                    ..............................................l-PLWGNEKTMNLNPMILTNVLS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHIEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PADL....MD.WFD.....SF..LDDEE.---------...................ELDVKa..gGGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKL---idq..................................................................
B4QGS9_DROSI/10-175                    ...............................................KNVHGTNPQYLIEKIIRSRIYD..S.KY.WKEQCFALTA................................-ELLVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TQFLCLTLKM.LQIQPEKD..........IVV.EFIK......................................................NEEFK..YVRALGAF....Y...L.....RLTGA........................ALDC....YK.YLE.....PL..YIDNR.KLRRQNRAG...................-----....QFEIVYMDEYID.ELL.......RNDRV...CD..I..ILPRIQKRSILEEN-n....................................................................
V7BAP5_PHAVU/3-165                     .......................................iqtcgkpi--------DSLLEKVLCMNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAVGFL....Y...L.....RYCGD........................PKTL....WS.WFE.....PY..IKDDE.---------...................EFSPG...sNGRMTTMGVYIR.DLL.......LGQYY...FD..T..LFPRIPVPV------lrqv.................................................................
Q7PMU1_ANOGA/45-223                    ..............................................l-PLWGNETSMNLNPLILANIQG..S.SY.FKVSLFKLKT................................YHEVVDEIYYQ..VKHLEP..............WERG.SRKtagqtgmcg...........................gvrgvgaggIV.STAFCLLYKL.YTLRLTRK..........QVN.GLLS......................................................HGDSP..YIRALGFM....Y...L.....RYTQP........................PSDL....FE.WYE.....PY..LLDEE.---------...................EIDVKa..gGGQIMTIGQMIR.QWL.......TKLDW...FS..T..LFPL-----------aqpdr................................................................
A0A0S4KHF4_BODSA/9-161                 .............................................dl---KGRSALNAIQPQQQQRILR..S.QL.WL-QVVGKPL................................-MWVIERGID-..LERVGC.............vYGRG.DVV.............................................LP.DLFICLVARL.LQILPKPE..........LVL.AMVR......................................................QEEHK..YLRILGAV....V...V.....RLIGN........................QTMS....NV.TME.....IC..FEDYR.NIRVRGSDG...................-----....NVSVEPLDKLCE.SLF.......-----...--..-..---------------fgsdqpdepl...........................................................
A0A094A3V8_9PEZI/1-139                 ...............................................----------------------..-.--.----CFALNE................................-ADIVSRVVEH..VQFVAG..............-TYG.DSQ.............................................RP.SPFLCLAFKL.LQLGPGDD..........ILK.EYLGy....................................................gGERFK..YLRALACF....Y...V.....RLTRP........................AKEV....YE.TLE.....PF..LEDGR.KLRRRGRQG...................-----....-TSLTFVDQFVD.ELL.......TKERI...CA..T..SLWKMPKREVLEDL-e....................................................................
A0A093GN88_TYTAL/1-141                 ..............................................f----------------------..-.--.----------................................----------Q..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKTI--dq...................................................................
K6UDH3_9APIC/10-45                     ..............................................i-KIFGSNPQYLISNIIRSKIYE..S.PY.WKEKCFALTL................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------l....................................................................
B8P4M7_POSPM/8-160                     ..............................................q-AIHGQNPQFLVETVIRNRIYE..S.PF.WKEHCFALTA................................-ESLIDKAID-..LKAIGG..............-VYG.N-Q.............................................KP.TEFLCLLLKL.LQIQPEKE..........ILL.EYLQ......................................................ADEFK..YLRALAVM....Y...I.....RMTFS........................AADV....YE.ILE.....PL..LKDYR.KIRYRGMNG...................-----....-YSLTYMDEFVD.NLL.......VDERV...CD..I..ILPR-----------.....................................................................
G8BDC4_CANPC/23-200                    ..........................................dkrni-----LNKAYLVEPIVRHRIHD..S.IF.YKQHLYLTNE................................-STILPVITQN..VQYIAG..............--VD.SIG.............................................RP.SPFLQCLLRL.LELEPAKE..........IIN.VYLDq...................................................lsYNEFK..YLTALTLL....Y...I.....RLVYP........................SEDI....YN.IFD.....KH..AQDYR.KLRFKLKTPq................fnA---VqqpiYYKLGYMDEFID.DLL.......TQERV...VD..L..ILPRLIPRLSLV---erg..................................................................
B7F7E9_ORYSJ/3-166                     ............................................iqt---SGKPIDLLMEKVLCMNIMS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKIL....WT.WYE.....PY..LKDDE.---------...................EFSPG...sNGRMTTMGVYVR.DLI.......LGQYY...FD..S..LLPRVPLPV------irqvt................................................................
A0A0D2USY9_GOSRA/10-175                ...............................................KSIRGTNPQNLVEKIVRSKIYQ..N.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHIGG..............-TYG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKD..........IVV.EFIK......................................................NDDYK..YVRVLGAF....Y...L.....RLTGI........................DSDI....YR.YLE.....PL..YNDYR.KVRRKSPDG...................-----....NFMLTHVDEVID.ELL.......TRDYS...CD..I..ALPRIKKRWTLES--lg...................................................................
A0A194SAL1_RHOGW/10-174                ..............................................l-SIHGTNPQYLVPTVIRQRVYD..T.IY.WKEHCFALTS................................-ATVIDRAVE-..LEAVGG..............-TYA.NTR.............................................-P.TEFICLVLKL.LQLQPERE..........IVL.EYLR......................................................AEEFK..YLRALAAF....Y...V.....RLTFD........................SLNC....YE.VLE.....PL..LNDYR.KLRFRAMDG...................-----....SYSILTIDEFAD.QLL.......HGESV...CE..I..QLPRLTQRKVLEET-e....................................................................
L7JXS8_TRAHO/4-152                     ............................................ykl-----------FSNPIKEKILK..S.PY.FK-EIKNYDL................................-DQTISDAHK-..LSSIGS..............LVYG.S--.............................................-P.HPFICLLQKL.ESLNVDNN..........TML.EKYHg...................................................alREENS..TVIMFFVF....Y...F.....RMTAK........................MKNE....FN.EIK.....KP..LENKKlLVKIVDENN...................-----....ESYSVTIKEVLN.MLQ.......SNKYV...FG..I..FMK------------si...................................................................
F9X714_ZYMTI/19-186                    .............................................tl--IRGDNPLKLFEKPVRDRIVD..S.YY.WKEQCFGLNA................................-ATVLDRAVE-..LTFLGG..............-TYG.VAQ.............................................KP.TPFLCLAFKL.LQLTPEKE..........IIM.YYLEq....................................................aGEEFK..YLRALAAF....Y...V.....RMAWE.......................kDEDV....YT.TLE.....PY..LADFR.KLKRRTREG...................-----....-WALTHVDQFID.DLL.......VKSRV...CA..T..TLPKINPRTFLEDE-d....................................................................
A0A163AMV6_DIDRA/23-241                .............................................al--IRGQNPALLFEKGVRERITE..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LKFIGG..............-TSG.ITG.............................................RP.TPFLCLAFKM.LQLVPEKA..........VVL.EMLNfrgdeeeedeemlnlrgdedgedkemgvkletqengeakaeeeakkrdlnaegkLGTFK..YLRCLAAF....Y...I.....RLAWE........................PVEI....YT.TLE.....PL..LTDYR.KIKRRLKEN...................-----....-FSLTYVDQFVD.DLL.......TKERI...CA..T..SLWKLPSRANLEDL-d....................................................................
N6U570_DENPD/23-207                    ..............................................l-PLYGNERTMNLNALILTNIQS..S.HY.FKVNLYELKT................................YHEVVDEIYYK..VSHLEP..............WEKG.SRRtsgqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.FTLKLTRK..........QLN.GLIT......................................................HCDSP..YIRALGFM....Y...I.....RYVFP........................PSAL....LD.WYE.....EY..LEDEE.---------...................ELDVKa..gGGQNMTMGQILR.QWL.......VKLEW...FS..T..LFPRIPVPIQHRI--qk...................................................................
B4M6P8_DROVI/28-212                    ..............................................l-PLWGNETSMNLNPLILANIQS..S.SY.FKVHLFKLKT................................YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.YTLRLTRK..........QLN.GLLN......................................................HTDSA..YIRALGFM....Y...L.....RYTQP........................PGDL....YD.WYE.....DY..LQDEE.---------...................EIDVKa..gGGQVLTIGQMVY.QFM.......TKLDW...FS..T..LFPRIPVPIQKQIE-k....................................................................
A0A022R4J6_ERYGU/6-166                 ........................................ssgrpid---------QLFEKVLSINIVS..S.DY.YR-DLLRLNT................................YNEVIDEIYVT..VTHVEP..............WMTG.NCR.............................................GP.STAYCLLYKF.FTMKLTVK..........QMH.GLLQ......................................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKTL....WS.WYE.....PY..IKDDE.---------...................EFSPG...sNGRTTSMGAYLR.DLL.......LGQYY...FD..T..LFPRIPVL-------virsi................................................................
V9DTB5_PHYPR/11-61                     ..............................................q-SVHGVNPQTLVEKIMRNRIYA..S.IY.WKEQCFGLTA................................-EALVDKILS-..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------rqqegsw..............................................................
Q7RLR7_PLAYO/177-256                   ............................................lem----TNTSTYNVNNLLRNNILS..S.EY.FR-SLITLKT................................FKEVLDEILSY..ADHAEP..............YCIG.STR.............................................AP.STLFCCLYKL.FTMHLSKK..........QV-.----......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------i....................................................................
B2WHZ6_PYRTR/23-234                    ..............................................k-LIRGQNPALLFEKGVRERITE..S.YY.WKEQCFGLNA................................-ATLCDRAAE-..LKFIGG..............-TTG.ING.............................................KP.TPFLCLAFKM.LQLVPDKD..........IIL.EYLNfrdddddeeqkdhdtdanadaen.......ghisdtdsttaaakktldlnakgkLGNFK..YLRCLAAF....Y...I.....RLAWE........................PVEI....YT.TLE.....PL..LTDYR.KIKRRLKDA...................-----....-FTLTYIDQFVD.DLL.......TKERI...CG..T..SLWKLPSRANLEDL-d....................................................................
C5LD14_PERM5/10-181                    ............................................aga---HGGNPQFLISQIVRDRVYS..L.RY.WKEECFGLNA................................-ETILDKAAE-..LKYVGT..............-VYG.SLQ.............................................RP.SPFLCLLVKL.LQIGPEKE..........IIK.SFIDlsa................................................gddAGELR..YLRALACT....Y...L.....RYIGR........................PDEI....YN.WLE.....PV..LWDYR.QIVVRKLDG...................-----....SFEISNLDTWVN.TLL.......TEDEI...IT..L..GLPKLPQRHILEER-e....................................................................
A0A167KJK7_PHYB8/9-165                 .............................................va--VHGRDPQHLIEKIIRERIYD..S.LY.WKEHCFGLSA................................-ATLMDKAVE-..LSAVGG..............-QYG.NQQ.............................................-P.TEFLCLVLKM.LQLQPEKD..........IVI.ELIK......................................................QEDFK..YLRALGVF....Y...L.....RLVGR........................SKEI....YQ.YLE.....PL..LNDYR.KLRVRQGDG...................-----....-FILSHMDVFVD.QLL.......REERV...CD..V..ILPRLVA--------r....................................................................
A0A091KAI8_9AVES/1-111                 ..............................................i----------------------..-.--.----------................................-----------..------..............----.---.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HEERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A074Z976_9PEZI/19-183                .............................................tl--IRGQNPLLLFEKAVRDRIID..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LSFIGG..............-TYG.IGQ.............................................KP.TPFLCLAFKL.LQLTPEKE..........IIL.HYLQ......................................................QEEWK..YLRALAAF....Y...I.....RLTWE........................PKDI....YE.TLE.....QY..LGDYR.KLKRRTRDA...................-----....-YSLSYVDQFVD.DLL.......TKDRI...CA..T..SLWKMPTRTQLEDL-d....................................................................
B4HSN2_DROSE/10-175                    ...............................................KNVHGTNPQYLIEKIIRSRIYD..S.KY.WKEQCFALTA................................-ELLVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TQFLCLTLKM.LQIQPEKD..........IVV.EFIK......................................................NEEFK..YVRALGAF....Y...L.....RLTGA........................ALDC....YK.YLE.....PL..YIDNR.KLRRQNRAG...................-----....QFEIVYMDEYID.ELL.......RNDRV...CD..I..ILPRIQKRSILEEN-n....................................................................
R1F3N7_EMIHU/15-180                    ..............................................i-SVHGTNPQNLVEKILRSKIYN..H.AY.WKEHCFGLTA................................-ESLVDKAME-..LDTVGG..............-TFG.GIR.............................................EP.SHFIQLTLKM.LQIQPEKE..........IVL.EFIK......................................................NEDYK..YVRALGAF....Y...L.....RLTGR........................PAEV....FQ.YLE.....PL..YNDYR.KLRRRLASG...................-----....EYCLVHVDELVD.ELL.......RDEYV...FD..L..ALPHLPKRHTL----vasg.................................................................
Q7SHZ0_NEUCR/24-191                    ............................................lap---NGLNPATIMEKAVRERIID..S.YF.YKEQCFGVNE................................-ADIVDRVVEH..VDFIGG..............-VYG.TVQ.............................................KP.SPFLCLAFKL.LQLAPSDD..........ILN.EYLQf....................................................gGEKFK..YLRALALF....Y...I.....RLTRK........................DQDV....YK.TLE.....PF..LEDRR.KLRRKGRNG...................-----....-TSLTYMDVFVD.DLL.......TKDRV...CA..T..SLWKMRKRDILEDL-d....................................................................
E7NHW7_YEASO/15-219                    ...............................................KQLNNQSVSLVIPRLTRDKIHN..S.MY.YKVNLSNESLrg............................ntMVELLKVMIGA..FGTIKGqng.......hlhmMVLG.GIE.............................................--.--FKCILMKL.IEIRPNFQ..........QLN.FLLNvk.................................................nenGFDSK..YIIALLLV....Y...A.....RLQYYylngn.............nkndddENDL....IK.LFKvq.lyKY..SQHYF.KLKSFPLQVdc...............faHSYNE....ELCIIHIDELVD.WLA.......TQDHI...WG..I..PLGKCQWNK------iynsde...............................................................
G2R425_THITE/24-192                    ............................................lap---NGLNPATIMEKAVRERIVE..S.YF.YKEQCFGVNE................................-ADIVDRVVEH..VHFIGG..............VYGS.GGQ.............................................RP.TPFLCLAFKL.LQLAPGDD..........VLR.EYIGf....................................................gGDKFK..YLRALALF....Y...V.....RLTRP........................DKDV....YM.TLE.....PF..LEDRR.KLRRKGRNG...................-----....-TSLTYMDEFVD.DLL.......TKDRV...CG..T..SLWKMRKRDILED--le...................................................................
E3KGQ2_PUCGT/10-176                    ..............................................l-SIHGTNPQFLIDKVLRSRIYE..S.EY.WKESCFGLTA................................-ESIIDKTVFE..LSYLGS..............-TFT.ANL.............................................RP.TVFICLLLKL.LQLQPEKE..........IIL.EYLR......................................................AEEFK..YLRALAAF....Y...V.....RLTFS........................PINV....YQ.TLE.....PL..LQDYR.KLRTRNLDG...................-----....SYGLMTFDELID.SLL.......TETIV...FE..V..VLPRLTSRKVLEE--le...................................................................
A0A0B2S9W3_GLYSO/4-166                 .......................................qtcgrpid---------SLLEKVLCMNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HLDSP..YIRAVGFL....Y...L.....RYCAD........................PKTL....WN.WFE.....PY..VKDDE.---------...................EFSPG...sNGRMTTMGVYVR.DLL.......LGQYY...FD..T..LFPRIPVPV------lrqvv................................................................
A0A058ZG82_9EUKA/14-178                ..............................................k-SYHGTNPMNLIPKIMRERIFN..S.LY.WKERCFGLND................................-ADVVDRAAE-..ITHIGG..............-TYG.HTN.............................................TA.TPFICLALKL.LR-SPNRE..........TLI.AFID......................................................QTHFK..YLRALGAF....V...F.....RLIAP........................SADI....YN.YLE.....PL..LIDLR.KLRMRNQEG...................-----....EFYLSFLDSFVD.ELL.......TETHV...LG..V..PMPTLVQRHVLEA--ag...................................................................
A0A183QLW9_9TREM/26-210                ..............................................l-KLWGNPQTMNLNTMIYTNIVQ..S.PY.FKANLVELKT................................YHEVIDEIYYK..VEHLEP..............WERG.SRRigvqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.FTLKLTRK..........QLK.GLLD......................................................HPDSP..YIRALGFM....Y...I.....RYCIP........................PEDF....WW.WYS.....PY..WSDSE.---------...................ELDVKa..gGGCIMTIGNMLE.HWL.......TKLDW...FS..T..LFPRIPVPVQKK---lee..................................................................
A0A0R3UJQ0_9CEST/26-210                ..............................................l-KLWGNQVTMNINPMIHTNIIQ..S.PY.FKTNLIELKT................................YHEVIDEIYYK..VTHLEP..............WERN.SRRmggqtgmcg...........................gvrgvgaggIV.STAYCLLFKL.FTLKLTRK..........QLR.GLLE......................................................HPDSP..YIRALGFM....Y...I.....RYCLP........................PEDL....WM.WFA.....PY..LDDEE.---------...................EIDVRa..gGGCSMTIGSMLE.QWL.......TKLDW...FS..T..LFPRIPVPVQKKIE-e....................................................................
A0A0E0AZ81_9ORYZ/10-175                ...............................................KSIHGTNPQNLVEKIVRSKIYQ..S.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHTGG..............-TYG.GNR.............................................KP.TPFLCLALKM.LQIQPDKD..........IVV.EFIK......................................................NEDYK..YVRVLGAF....Y...L.....RLTAT........................VADV....YQ.YLE.....PL..YNDYR.KIRHKLSDG...................-----....KFTLTHVDEFID.DLL.......TKDYS...CD..T..ALPRIQKRWVLET--sg...................................................................
Q95Y35_CAEEL/55-239                    ..............................................l-PVWGNKVTMNLNTLVLENIRE..S.YY.YKNNLVEIDN................................FQTLIEQIFYQ..VKHLEP..............WEKG.TRRlqgmtgmcg...........................gvrgvgaggVV.SSAYCLLYRL.FNLKISRK..........QLI.SMLN......................................................SRQSV..YIRGLGFM....Y...I.....RYTQP........................PADL....WY.WLE.....PY..LDDDR.---------...................EIDPRs..gGGDLMTFGQLVR.TMI.......NKLDW...YG..T..LFPRIPVPIQKDID-e....................................................................
J9B997_WUCBA/47-231                    ..............................................l-PLWGNTQTMNLNALVLENIIQ..C.TY.YKNYLAETTG................................FQQLTEEIYYS..VKHLEP..............WERG.TRKtqgmtgmcg...........................gvrgvgaggVV.STAFCLLYKL.FTIRLSRK..........QLV.SMIN......................................................NSDSP..YIRGIGFM....Y...I.....RFCQP........................PQDL....WA.WME.....PY..LDDEE.---------...................QIDPRs..gGGDVMVMAQVVK.MML.......TKLDW...YG..T..LFPRIPVPIQKEI--el...................................................................
A0A074RWM6_9HOMO/10-173                ..............................................i-HIHGQNPQFLVEKVIRTRIWE..S.SY.WKEECFALTA................................-ESVIDKAIE-..LNTIGG..............-VYG.NQR.............................................-P.THFICLLLKL.LQIQPEKE..........ILI.EYLM......................................................VDEFK..YLRALAAM....Y...V.....RMTFP........................AVEV....YE.LLE.....PL..LKDYR.KIRLRNMAG...................-----....-YSLTFIDEFVD.QLL.......TEERV...CD..I..ILPRMSKREVFEE--te...................................................................
A0A183DZ28_9BILA/94-186                ...........................................fasl----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.-------K..........QLV.SMIN......................................................NRDSP..YIRGVGFM....Y...I.....RFCQP........................PNDL....WS.WME.....PY..LDDEE.---------...................QIDPRs..gGGDVMAMSQVVK.MML.......TKLDW...YG..T..LFPRIPVPIQKEI--el...................................................................
A0A183FVP2_HELBK/10-175                ..............................................h-TVKGTNPQFLVEKIIRQRIYD..S.KY.WKESCFALSA................................-DLIVDRALD-..LRYVGG..............-IYA.GNV.............................................KP.TPFLCLALKM.LQIQPEKD..........III.EFIQ......................................................QEQSK..YARALGAM....Y...L.....RLTFT........................SVEI....YK.YLE.....PL..FNDYR.KLRYMNKLG...................-----....RFELLYMDEFID.NLL.......REERY...CD..I..QLPRLQKRQALEE--ag...................................................................
E9AIG4_LEIBR/4-153                     .........................................nlkgra-------AIAALDPPTRHRVLH..S.QT.MT-RCANKPL................................-LWVLEELTT-..LRSLGG..............-LTG.PLH.............................................RA.NYFICLVVRL.LQICPSVA..........IAR.VMLE......................................................QDVHK..YLRAAALL....L...I.....RFIGN........................MELQ....RE.AMH.....VG..WSDYR.KLCLYGSDP...................-----....------------.---.......-----...--..-..---------------aqewkestsatvagaggmatdtfr.............................................
A0A0G2JGW4_MOUSE/48-93                 ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIY--..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------fk...................................................................
A0A074XVB6_AURPU/19-183                .............................................tl--IRGQNPLLLFEKAVRDRIID..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LSFIGG..............-TYG.IGQ.............................................KP.TPFLCLAFKL.LQLTPEKD..........IIL.HYLR......................................................QEEWK..YLRALAAF....Y...I.....RLTWE........................PKDI....YE.TLE.....GY..LSDYR.KLKRRTRDG...................-----....-YQLSYVDQFVD.DLL.......TKDRV...CA..T..SLWKMPSRTQLED--id...................................................................
A0A067DF16_CITSI/4-97                  .......................................iqtcgkpi--------DSLLEKVLCMNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRA----....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------.....................................................................
K7JAP2_NASVI/32-188                    ..............................................l-PLWGNERTMNLNPLILTNIQS..S.HY.FKVNLYELKT................................YHEVIDEIYYK..VSHLEP..............WEKG.SRK.............................................TA.G---------.-QTGMCGG..........QLN.GLIN......................................................HPDSP..YIRALGFM....Y...I.....RYTQP........................PPDL....FS.WYD.....DY..LEDEE.---------...................ELDVKa..gGGQVMKMGDILK.QFL.......TKLEW...FS..T..LFPRIPVPIQKEL--eq...................................................................
PR38A_DANRE/10-175                     ..............................................n-SVHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LKFVGG..............-VYG.GNV.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRLLGAM....Y...M.....RLTGT........................SVDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HAERM...CD..I..ILPRLQKRQVLEEA-e....................................................................
A5K1F2_PLAVS/159-321                   ............................................lem----TNTTTYNVNTLLRNNILS..S.EY.FR-SLVPLKT................................FKEVVDEIHLY..ADHVEP..............YCIG.STR.............................................AP.STLFCCLYKL.FTMHLSEK..........QMK.MLIE......................................................SRDSC..YIRACGFL....Y...L.....RYVHS........................PANL....WM.WFE.....PY..LLDED.--QFVT---...................----Sa..dKRKKQTIGEYIQ.CLL.......ADDKY...FN..T..VLPRMPIKIK-----nty..................................................................
A0A0C3D9I8_9PEZI/1-157                 ...............................................-----------MEKPVRERIVD..S.YF.WKDQCFAVNE................................-ADIIDRVVEH..VKFVGG..............-TYG.DSQ.............................................KP.SPFLCLAFKL.LQLGPTDD..........VLQ.EYLEy....................................................gGEKFK..YLRALAVF....Y...V.....RLTRK........................ATDV....YL.FLE.....PF..LEDKR.KLVMRTRTG...................-----....-KRLTFMDEFVD.SLL.......TKERM...CS..T..TLWKMPSRAQLEDE-e....................................................................
K7H0X6_CAEJA/52-236                    ..............................................l-PIWGNQVTMNLNTLVLENIRE..S.YY.YKNNLIEIDS................................FQALVEQIFYQ..VKHLEP..............WEKG.TRRlqgmtgmcg...........................gvrgvgaggVV.SSAFCILYRL.FNLRMTRK..........QLI.SMLN......................................................SRQSV..YIRGIGFM....Y...I.....RYTQP........................PSDL....WY.WLE.....PY..LDDES.---------...................EIDPRs..gGGDCMTFGMMVR.TMI.......NKLDW...YG..T..LFPRIPVPIQKEID-e....................................................................
A0A0R3SDC1_HYMDI/10-175                ..............................................h-TLHGTNPQYLIEKIIRSRIYE..C.QF.WKEHCFALTS................................-ELLVDKAVE-..LKYIGG..............-TYS.GLT.............................................KP.TPFICLVLKM.LQIQPDKD..........IVI.EFIK......................................................QEDYK..YARALGAF....Y...L.....RLVGE........................SVEI....YK.YLE.....AL..YNDFR.KLKQQDTTG...................-----....KFSIIRVDEFID.QLL.......NEERV...CD..V..ILPRLQKRSVLED--ln...................................................................
S6EYV6_ZYGB2/14-210                    ...............................................KQLNHQSVSLVIPRIARDKIHN..A.MY.YRVNLNTVSLrg............................dtIECLSKVIVRD..LGSLAEpvs.......fqqvHVLG.GIE.............................................--.--FQCLLMKL.VEIRPTWD..........QLE.VMLQed..................................................ntGFNNK..YIVGLILA....Y...I.....RIQYYflqv................edplAQRF....RV.LFK.....HY..YNDYR.KMKSVLFDQdc...............wtKSQTV....SVNILHMDELVE.WLL.......EREEI...WG..I..PLGKCQWKELE----esss.................................................................
M2MPP1_BAUCO/19-184                    .............................................rl--IRGDNPLKLFEKAVRDRIID..S.YY.WKEQCFGLNA................................-ATILDRATE-..LTFIGG..............-TYG.VAQ.............................................KP.TPFLCLAFKL.LQIVPDKE..........IIL.FYLE......................................................QEEFK..YLRALAAF....Y...I.....RLAWE.......................kDEEV....YT.TLE.....PY..LSDAR.KLKRRTREG...................-----....-WALTHVDEFID.DLL.......IKGRL...CA..T..TLPKINPRLFLEDE-d....................................................................
K1W8G5_TRIAC/59-194                    ........................................srhgpaa----------------------..-.--.----------................................-ESLIDKAIA-..LHAIGG..............-VYD.-RQ.............................................TP.TPFMCLLLKL.LQIQPEKE..........ILF.EYLL......................................................AEEFK..YLRALAAM....Y...I.....RLTFR........................SIEV....YE.ILE.....PL..MKDYR.KLRYRQVGG...................-----....-YYLTTFDEFID.DLL.......TQDRV...CD..I..ILPRLTQRSVLEE--ve...................................................................
A0A132AFB3_SARSC/21-116                ............................................cva----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.---RLTRK..........QVM.AMIR......................................................HKDSP..YIRALGFM....Y...I.....RFTQP........................FQDL....WQ.WYE.....PF..LDDDE.---------...................IVDPKa..gGGSPMTIGEMVQ.HFL.......SKIEW...FS..I..LFPRIPRHIKIKIE-e....................................................................
A0A183EQT3_9BILA/51-133                .....................................fclnipllcy----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................----R..YIRALGAM....Y...I.....RLTFS........................SIEV....YK.YLE.....PL..YNDYR.KLRMMNKDG...................-----....RFEIIYMDEFID.NLL.......REERY...CD..I..HLPRIQV--------lf...................................................................
W6Q0P6_PENRF/21-204                    ..............................................l--VRGVNPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LTSIGG..............-TYG.VSE.............................................KP.TPFLCLAFKL.LQLGPDRE..........VIL.ELLNytdpgsgdea..................................edpddalvkeRGDFK..YLRALAAF....Y...V.....RLTFD........................PVDV....YK.TLE.....PL..LLDYR.KLKRRVRDT...................-----....-FTLTYMDQFID.DLL.......TKDRV...CG..T..SLWKLPPRSQLEDL-d....................................................................
G3I797_CRIGR/6-94                      ............................................vky---AHHNPQYMVEKIIRTRIYE..S.KY.WKEESYGLTA................................-ELVVNKAME-..LRFVGV..............-VYG.GNI.............................................KP.TPFLGLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDF-..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------ne...................................................................
A0A0D2CFM8_9EURO/19-185                .............................................pl--IRGQNPALLLETAMRDRITD..S.LY.WKEQCFGLNA................................-ATLCDRAVE-..LTYIGG..............-TYG.VAM.............................................KP.TPFICLAFKL.LTLVPDRE..........IVL.EYLQy....................................................gGEEWK..YLRALAAF....Y...V.....RLTFN........................PADV....YK.TLE.....PF..LEDSR.KLRQRRKEE...................-----....-YILIHMDEFVD.NLL.......TKDRV...CG..T..TLWKLPARQVLEDL-d....................................................................
A0A0D9WDE8_9ORYZ/3-166                 ............................................iqt---SGKPIDLLMEKVLCMNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKIL....WT.WYE.....PY..LRDDE.---------...................EFSPG...sNGRMTTMGVYVR.DLV.......LGQYY...FD..S..LLPRVPLPVT-----rqvt.................................................................
A0A0L0GFE0_9EUKA/10-175                ..............................................m-QIHGRNPQHLVDKIIRTRIYD..C.RY.WKEDCFALTA................................-ESLVEKAVD-..LNYCGG..............-VYG.GSV.............................................KA.TPFICLLLKM.LQIQPDRE..........IIV.EFIK......................................................NEDYK..YVRLLGAL....Y...L.....RLTAN........................SQDC....YK.YLE.....PL..YDDFR.CIRVKNKLG...................-----....KLVRSHVDEFVD.ELL.......HEERV...CD..V..QMPRVQKRFILEE--tg...................................................................
Q756P8_ASHGO/14-224                    ...............................................KQLSNQSTSLVIPKIARLRIHN..S.MY.YKINLYPTGLrg............................ntLKQLVRVLVRD..LGACKHrsg........pmlHICG.NTE.............................................--.--FQCLLMKV.IEIRPTWS..........QIY.TLLQlgde..............................................rktgKFNNK..YIAVLILV....Y...L.....RIQYYfladekaes.....fppeadgdvtAAKV....KA.LFA.....HF..LADYR.KVKCLDLEVdc...............wsGATQK....SVSVQHVDEIVD.WLC.......TKDSI...WG..I..PLGRCRWLAD-----vlead................................................................
A0A0N0DUZ1_9TRYP/258-435               .................................hfnfdaelwgvlaa----------------------..-.--.----------................................--KLTNDLVEE..VRACGR..............-TQD.TQQgngrlltaferheqdvaa........vlryceqkvhyagvfdddeEA.SPFLIAMGLC.WRLSLTMD..........DVC.RHFA......................................................RHPRR..VIRALALY....L...A.....RYVLA........................PEDY....VY.FFL.....PS..LTDEV.IIACTEDAQ...................-----....--VTYTMKDLSR.QLL.......TKNDI...VD..A..WLPMLAKY-------wqdqv................................................................
C5Z3V3_SORBI/3-166                     ...........................................iqss----GRSIEGLMEKVLSVNILS..S.DY.FK-ELFKYKT................................YHEVVDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.SSAFCLLYKL.FTMKLTVK..........QMH.GLLK......................................................HQDSP..YIRAIGFL....Y...L.....RYVAE........................PKTL....WS.WYE.....PY..IKDGE.---------...................EFAPG...sNGKSTTMGVYVR.DLL.......LGQYY...FD..S..LLPRVPLPI------lrqvt................................................................
R8BK18_TOGMI/23-190                    ............................................lap---NGLNPATIMEKAVRERIVD..S.YF.FKEQCFGVNE................................-ADVVDRVVEH..VSFVGG..............-TYG.GVQ.............................................KP.TPFLCLAFKL.LQLAPGDD..........VLA.EYLEy....................................................gGDKFK..YLRALAAF....Y...I.....RLTRQ........................AKEV....YT.MLE.....PY..LEDRR.KLRRKGRAG...................-----....-TSLTYVDEFID.DLL.......IKDRV...CG..T..SLWKMPKRDLLED--le...................................................................
M7NMD2_PNEMU/15-179                    ..............................................q-SIHSMNPVNLIEKIIRERILE..C.RY.YKEMCFGLTA................................-ATICDRAVK-..MKYIGG..............-QY-.LNQ.............................................RP.TEFLCLTFKL.LQLQPEKE..........IIL.EYLY......................................................ANDFK..YLQALAAF....Y...I.....RLTFP........................AKEC....YL.ILE.....PF..LNDYR.KLRIRYSTG...................-----....LYGLSYIDEFVD.HLL.......NQERV...CD..I..ALPRLPTRFILEE--me...................................................................
A0A0L0N1A5_9HYPO/24-191                ............................................lap---NGLNPATIMEKAVKDRIVD..S.YF.YKEQCFALNE................................-ADIVDRVVEH..VSFIGG..............-THG.AAQ.............................................KP.SPFLCLAFKL.LELSPSDA..........ILR.EYMAy....................................................gGEAFK..YLRALACF....Y...V.....RLTRQ........................AKDV....YE.TLE.....PY..LEDRR.RLRRRGRQG...................-----....-IRLTFVDEFVD.ELL.......TADRV...CA..T..SLWKMPKREILEDL-e....................................................................
W6MI80_9ASCO/16-181                    ..............................................a-RVHGVNPVFLVEKIIRERILD..S.LY.WKKDCFHLNA................................-LTILDKAVA-..LRMVGT..............YSNV.NRT.............................................KP.CIFMCLLLKM.LQIQPSPE..........IVN.YLLR......................................................QPHFK..YVTALAAL....Y...V.....RLTSS........................SVQV....YK.TLE.....PL..LEDYR.KLVLFDGMK...................-----....-KRLIHMDELVD.DLL.......TKEKF...CD..L..MMPRLVDRLQLEEQ-e....................................................................
G2XP06_BOTF4/21-188                    ............................................lap---NGLNPATVLEKPVRERIVD..C.YF.WKDQCFALNE................................-ADIVSRVVSH..VTFIAG..............-TYG.DSQ.............................................RP.SPFLCLAFQL.LQLGPGDD..........ILK.EYMGy....................................................gGEKFK..YLRALALF....Y...W.....RMTRQ........................AKDV....YT.MLE.....GY..LEDRR.KLRRKTRTG...................-----....-TTLTFMDQFVD.DLL.......TKDRV...CG..T..TLWKMPKREILEDL-e....................................................................
Q4Z0V3_PLABA/10-175                    ...........................................iksf----GSNPQFLISNIIRNKIYD..S.PY.WKEKCFALTS................................-ESIIDQAVN-..LKYAGG..............-TYG.GNR.............................................KP.TRFLCLVLKL.LQLQPDKD..........IIY.EFIK......................................................NEEFI..YLRALGIF....Y...L.....RLIGK........................GIEI....YK.NIE.....PI..LFDYR.KIRIRLQDG...................-----....SFQKMYMDVFAD.NCL.......VFNNF...LD..V..DFPPLTKRIVLEEN-n....................................................................
A0A0V1NSK1_9BILA/62-227                ..............................................a-SLKGTNPQYLIEKVTRSRIYD..S.RY.WKEECFALSA................................-ELLVDRGME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLLLKM.LQIQPEKD..........IVI.EFIR......................................................QEDSK..YIRALGAL....Y...L.....RMTFS........................YVEV....YK.YLE.....PL..LNDYR.KLRWINKQG...................-----....KFELIHMDEFVD.KLL.......REERF...CD..V..QLPRLQKRAFLEE--tn...................................................................
B6K0B4_SCHJY/16-179                    ..............................................g-PVHEMNPTFLIEKILRERIVE..C.AY.WKEQCFGLNA................................-ASLVDRAVQ-..IQCIGG..............--QS.SHQ.............................................RP.TEFICLVYKL.LQLAPEDE..........IVL.QYLN......................................................ATEFK..YLRAIAAF....Y...I.....RLVWK........................DARV....FE.TLE.....PL..LNDYS.KLRTLDMNG...................-----....-YGLTHMDEYVD.ALL.......NEQRV...CD..I..ALPPLMSRIQLEDL-e....................................................................
G8ZTX6_TORDC/14-208                    ...............................................KELNNQSVSLVIPRLTRDRIHN..V.IY.YKANLHTVALrg............................dtMKQLCKVIIRD..LGTLQStsi........nrkNVLG.GVE.............................................--.--FKCILMKL.VEIRPTWD..........QLA.LLLRnp..................................................hpSYNNK..YVIALVLT....Y...L.....RVQYFylkn................ddilAQNI....KG.AFK.....EY..ICDYR.KMKSVSLEMdc...............wsASQNV....TVEIIHMDELVD.WLT.......TKDEI...WG..I..PLGRCQWCSS-----ldld.................................................................
A9V7J1_MONBE/525-692                   ...........................................yvcd------SKTMNLGHVLYSNIRD..S.SY.FRERCAELES................................IDHIIDEIYEQ..VNHLEP..............FVRK.PSN.............................................AP.STAFCLLYTL.FCFRPKER..........DLD.KIVT......................................................HKDSP..YIRAIGFL....Y...L.....RYTAD........................ADTI....WT.WFS.....DF..LDDPT.PLKVKYAKM...................-----....-APEEPIGLWLR.SLL.......TDLQY...CDpqA..RLPRIPVMKEREIR-d....................................................................
A0A0V1L1W8_9BILA/35-218                ..............................................l-NFWGNKETMNLNHLVLENIVS..S.PY.YKNTLLPLKT................................HFEVIDEIYYN..VEHLEP..............WEKG.TRKttgqtgmcg...........................gvrgvgaggVV.SSAFCLLYKL.FTLKLTRK..........QLT.AILN......................................................HPDSC..YIRGLGFM....Y...I.....RFCLH........................PATF....WS.WYE.....PY..FDDSE.---------...................EIDPKa..gGGDLMTIGEMVK.SLL.......TKLDW...YS..T..LFPRIPVPIQKEI--d....................................................................
A0A058Z0D6_9EUKA/4-170                 .............................................le--RHGNETTMNLNPALHQNIMG..S.RY.FK-NLYNLTT................................FEEVVSEISDE..VTFLEP..............FIPG.T-R.............................................DP.SSAFCLLLKL.FTMKPTVN..........QMR.RMLN......................................................YPRSV..YVRCVGLL....Y...L.....RYAFP........................PARL....ME.WYA.....DM..LFDET.PVVVEGRHG...................-----....-ARSMPLGRYVRnHLL.......LDNKY...FG..T..IMPLLPFRVMES---ikq..................................................................
A4HYV7_LEIIN/4-146                     .....................................nlkgraaias-----------LDPPTRYRVLH..S.HT.MT-RCASKPL................................-LWVLEELIT-..LRYLGG..............-LTG.PLH.............................................TA.NYFICLVVRL.LQICPSVA..........IVR.VMLE......................................................QDVHK..YLRAAALL....I...I.....RLIGN........................VELQ....RE.AMR.....VG..WSDYR.KLCLYGSDP...................-----....------------.---.......-----...--..-..---------------aqelaestsntaagaeg....................................................
H3H0K3_PHYRM/37-201                    .............................................la--VYGNDTTYNLNTLLHQNILQ..S.AY.FH-DLYKLKT................................YHEVVDEIYYR..VDHAEP..............WSPG.TAR.............................................IP.SSCFCLLHKF.FLMRLTRK..........QMQ.GLLR......................................................HTDSP..YIRVVGFL....Y...L.....RFAFD........................PDEL....WT.WFE.....PF..LEDPE.---------...................EFNASa..nTSLKTTIGEWLI.SLL.......EENNY...FG..T..ILPRIPKKIE-----dgik.................................................................
A0A0N4YCI5_NIPBR/1-176                 ...............................................---------MNLNGLVLENVKE..S.YY.YKNHLVEIDS................................AQQLLDEVFYK..VKHLEP..............WEKG.TRKvqgmtgmcg...........................gvrgvgaggVV.SSAFCLLYRF.FKVRLTRK..........QLI.SMIN......................................................SRVSP..YIRGLGFM....Y...I.....RYTQP........................PADL....WE.WFE.....PY..LDDEE.---------...................EIDPRs..gGGDVMTFGQIVR.VML.......TKLDW...YG..T..LFPRIPVPIQKEID-e....................................................................
A0A091Q0Z9_LEPDC/17-201                ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCIMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKTI--dq...................................................................
K3WW49_PYTUL/39-203                    ..............................................l-PIYGNQTTYNLNTLLHQNILQ..S.AY.FH-ELYNLKT................................YHEVVDEIYYR..VDHAEP..............LSPG.TAR.............................................IP.STCFCLLHKF.FLMRLTMK..........QMQ.GLLK......................................................HTDSP..YIRAVGFL....Y...L.....RYTCD........................PEKL....WG.WYE.....PY..LDDKE.---------...................EFNAAa..nPNVKTTIGEWLV.GLL.......EDINY...FG..T..ILPRIPKKIED----sik..................................................................
I2FP71_USTH4/10-174                    ..............................................v-SIHGRNPQHLIEKTIRYRIYE..S.AF.WKEHCFGLSS................................-STILPLAVS-..LHHIGG..............-LVG.L-E.............................................RP.SHFLCLVQKL.LQIQPEDS..........VIK.AYLD......................................................ACEFK..YLRALTAF....Y...I.....RLTCK........................STEV....YQ.LLE.....PM..LQDGR.KLRWRSADG...................-----....GYEVLHMDEWVD.MLL.......REERV...CD..I..ILPRLSKREV-----cqvrd................................................................
A0A180GN67_PUCT1/10-176                ..............................................l-SIHGTNPQFLIDKVLRSRIYE..A.EY.WKESCFGLTA................................-ETIIDKTVFD..LKYLGS..............-TIT.ANL.............................................RP.TEFICLLLKL.LQLQPEKE..........IIL.EYLR......................................................AEEFK..YLRALAAF....Y...F.....RLTFT........................PINV....YQ.TLE.....PL..LQDYR.KLRTRNLDG...................-----....PYGLMTFDELID.NLL.......TESIV...FE..I..VLPRLTSRKVLEE--le...................................................................
Q6FNB5_CANGA/14-216                    ...............................................KQLNNQSVSLVIPRITRDKIHN..N.IY.YRCNLHPVSMrg............................dtMLNLAPIIIRD..LGKLRNpyqk.....plnatLLLG.GSE.............................................--.--FKCLLMKL.IEIRPTWE..........QIM.TLINeem................................................veeSFENK..YIVALVLV....Y...G.....RIQYYfltfs.............ddyyddAIKW....RR.LFK.....KY..LNDYR.KLKALDLNVdc...............wsTSQMQ....NVELIHLDEIVD.WLA.......TKDDI...WG..I..PLGKCQWANV-----yndd.................................................................
G1KHK2_ANOCA/10-175                    ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LRYTGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRLLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.QLL.......HDERM...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A0L0CXQ8_PLAFA/2-136                 ...........................................gnga----------------------..-.--.----------................................-ESIIDQAIN-..LKYVGG..............-TYG.GNR.............................................KP.TRFLCLILKL.LQIQPDKD..........IIY.EYIK......................................................NEDFV..YLRALGIF....Y...L.....RLIGK........................SLEV....YN.HLE.....PI..LFDYR.KIRMRLQNG...................-----....TFEKIYMDVFVD.NCL.......ILNNF...LD..V..DFPTLTKRQVLEEN-n....................................................................
A0A0R3TRU6_HYMNN/27-211                ..............................................l-KLWGNQVTMNINPMIHTNIIQ..S.PY.FKTNLIELKT................................YHEVIDEIYYK..VTHLEP..............WERN.SRRvggqtgmcg...........................gvrgvgaggIV.STAYCLLFKL.FTLKLTRK..........QLK.GLLE......................................................HPDSP..YIRSLGFM....Y...I.....RYCLP........................PEDL....WM.WFS.....PY..LDDEE.---------...................EVDVRa..gGGCTMTIGAMLE.QFL.......TKLDW...FT..T..LFPRIPVPVQKKIE-e....................................................................
T5ACD4_OPHSC/26-193                    ............................................lap---NGLNPAMIMEKAVKDRIVD..S.YF.YKEQCFALNE................................-ADIIDRVVEH..VSFIGG..............-THG.AAQ.............................................KP.SPFLCLAFKL.LELGPSDA..........ILR.EYLAh....................................................gGEHFK..YLRALACF....Y...V.....RLTRQ........................AKDV....YE.TLE.....PF..LEDRR.KLRRKGRAG...................-----....-TSLTYVDDFVD.DLL.......YKERI...CA..T..SLWKMPKREILEDL-d....................................................................
K3XXF9_SETIT/3-166                     ............................................iqs---SGRSIDVLMEKVLSVNILS..S.DY.FK-ELYKFKT................................YHEVVDEIYHQ..VDHVEP..............WMTG.NCR.............................................GP.SSAFCLLYKF.FTMKLTVN..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYVAE........................PKTL....WA.WYE.....PY..IKDDE.---------...................EFSPG...sNGKMTTMGVYVR.DLL.......LGQYY...FD..S..LLPRVPLPI------lrqvt................................................................
A0A183TIV1_SCHSO/28-212                ..............................................l-KLWGNLTTMNLNNMIYTNIQQ..S.PFiYCDTCYLLLVeh...........................lepWERGSRRIGSQ..TGMCGG..............----.-VRgvg.......................................tggIV.STAYCLLYKL.FTLKLTRK..........QLK.GLLE......................................................HPDSP..YIRGLGFM....Y...I.....RLVFHitpss.............sryclpPEDL....WI.WYA.....PY..LDDTQ.---------...................EIDVRa..gGGCIMTIGAMLE.QWL.......TKLDW...FS..T..LFPRIPVPVQKKIE-e....................................................................
F4PA36_BATDJ/1-156                     ...............................................---------MNIHNILYLNIMS..S.RY.FK-SLYEKKT................................YHEVIDEIYYN..VSSLEP..............FFKG.TNA.............................................--.TSAFCLLYKL.FTLKLTEK..........QLE.GLLD......................................................HPDSP..HIRALGFL....Y...L.....RYAGQ........................PSQI....WD.WFE.....PY..LDDTE.ELPVRGGPH...................-----....-PKTMTIGTFCK.ALL.......TEQKW...FE..T..MLPRIPIPIAREIE-q....................................................................
A0A0D3H3F9_9ORYZ/10-175                ...............................................KSIHGTNPQNLVEKIVRSKIYQ..S.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHTGG..............-TYG.GNR.............................................KP.TPFLCLALKM.LQIQPDKD..........IVV.EFIK......................................................NEDYK..YVRVLGAF....Y...L.....RLTAT........................VADV....YQ.YLE.....PL..YNDYR.KIRHKLSDG...................-----....KFTLIHVDEFID.DLL.......TKDYS...CD..T..ALPRIQKRWVLET--sg...................................................................
A0A0V0ZZH3_9BILA/35-219                ..............................................l-NFWGNKETMNLNHLVLENIVS..S.PY.YKNTLLPLKT................................HFEVIDEIYYN..VEHLEP..............WEKG.TRKttgqtgmcg...........................gvrgvgaggVV.SSAFCLLYKL.FTLKLTRK..........QLT.ALLN......................................................HPDSC..YIRGLGFM....Y...I.....RFCLH........................PATF....WS.WYE.....PY..FDDSE.---------...................EIDPKa..gGGDLMTIGEMVK.SLL.......TKLDW...YS..T..LFPRIPVPIQN----mprr.................................................................
D2VCT3_NAEGR/48-213                    ..............................................i-NVWGNSSTMNITPYLYKKVLA..S.PY.FK-SLYEYKT................................YHEVLDLIKN-..IKYIHP..............FTDG.DTN............................................aEP.SIAFSLLFKL.HTLKLSYK..........QLK.GMLQ......................................................KDMST..NTKAMALL....Y...V.....RFAVQ........................PDEM....WD.YFR.....DF..VNDEN.---------...................NTVNI....YTKRISLGEFVR.SLI.......TNQKL...FG..SqcILPILPANLV-----rrmed................................................................
A0A096UWA6_WHEAT/3-165                 ...........................................lqts----GRPIEVLMEKVLSMNIVS..S.DY.FK-ELYKIKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKL.FTMKLTVN..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYAAD........................PKTL....WT.WYE.....PY..IQDDE.---------...................EFSPG...sNGKMTTMGVYVR.DVI.......LGQYY...FD..S..LLPRVPL--------lilrqv...............................................................
V5G3J8_BYSSN/21-207                    ..............................................l--IRGVNPATLFETAVRDRITD..S.YY.WKEQCFALNA................................-ATLCDRAAE-..LTSIGG..............-TYG.VGQ.............................................KP.TPFLCLAFKM.LQLAPDKE..........IVL.EYLNftdpgsdaegd...............................taeeadngvvksRGDFK..YLRALAAF....Y...I.....RLTFD........................PVDI....YK.SLE.....PL..LLDYR.KLRRRMRDG...................-----....-FVLTTIDQFVD.DLL.......TKDRV...CA..T..SLWKIPSRQQLEDL-d....................................................................
A0A0L0P213_9ASCO/2-178                 ............................................dkr---RAENKAYLIGPIVRHRIQD..S.LF.YKEKLYLTNE................................-SSIVPVIVEH..VHSVGG..............--TD.EAG.............................................RP.SPFLCCLLRL.LELEPSPA..........IIQ.LLLTq...................................................ngYNEFK..YLTALALV....Y...C.....RLVFD........................AKEM....YA.LYD.....EY..IKDYR.KLRMQLKTP...................RFENDl.piHYKLVHMDEWVD.MLV.......EEESV...VD..L..TLPYIAPRK------vyvekg...............................................................
H0ZFB3_TAEGU/10-175                    ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.NR.ASIAVPSFIS................................-ELVVDKAME-..LKYVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HEERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
H2KVI1_CLOSI/10-175                    ..............................................h-TVHGTNPQYLVEKIIRSRIYE..S.KY.WKEHCFALTA................................-ELLVDKAVE-..LRYVGG..............-VYS.GNV.............................................KP.TPFLCLALKM.LQIQPDKD..........IVI.EFIK......................................................QEPYK..YARALGAF....Y...L.....RLVGE........................SVEI....YK.YLE.....TL..YNDFR.RLKFQDRAG...................-----....NFSLIYMDDFID.KLL.......TEERV...CD..V..ILPRLQKRSVLEE--an...................................................................
I1CST4_RHIO9/3-153                     ............................................sdk----------------------..-.--.--------KT................................FHEIVDEIYNE..APFIKG..............----.--N.............................................QP.STAFCLLFKL.WTLKLTIR..........QLE.NLVEhgdsplvkk...................................ksvlqlasklTCSVS..YIRAIGFL....Y...L.....RYVCA........................PAQL....WD.WYQ.....YY..LEDDE.---------...................EVAISs.glHPTKVTVGQLIR.MLI.......IEPKF...QG..T..MLPRIPIPIAR----dlek.................................................................
M2RIP2_CERS8/10-173                    ..............................................q-AIHGQNPQYLVESVIRNRIYE..S.AY.WKEHCFALTA................................-ESLIDKTIE-..LRAIGG..............-VYG.N-Q.............................................KP.TEFLCLLLKL.LQIQPEKE..........ILL.EYLQ......................................................ADEFK..YLRALAVM....Y...I.....RMTFR........................PAEV....YE.ILE.....PL..LKDYR.KIRYRGMNG...................-----....-YSLTFMDEFVD.SLL.......VQERV...CD..I..ILPRLTKRDVLEE--lg...................................................................
A0A0N5CXD3_THECL/10-175                .............................................vt--VRGTNPQYLIEKIIRTRIYD..S.KY.WKEECFALTA................................-ELLVDQGME-..LRYVGG..............-VYA.GNV.............................................KP.TPFLCLCLKM.LQIQPEKD..........IIV.EFLR......................................................QEDYK..YIRALGAM....Y...I.....RLTFP........................SIEV....YK.YLE.....PL..YNDYR.KMRMMTRQG...................-----....KFEVIYVDEFID.NLL.......REDRY...CD..I..HLPRLQKRITLEE--ig...................................................................
I1MBS7_SOYBN/4-166                     .......................................qtcgrpid---------SLLEKVLCMNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAVGFL....Y...L.....RYCAD........................PKTL....WN.WFE.....SY..VKDDE.---------...................EFSPG...sNGRMTTMGVYVR.DLL.......LGQYY...FD..T..LFPRIPVPV------lrqvv................................................................
A0A0J8C706_BETVU/4-167                 ...........................................lqts----GKPIDSLLEKVLCMNILS..S.DY.FR-DLLRLKT................................YHEVVDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTAK..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYAGD........................PKQL....WS.WFE.....PY..ITDDE.---------...................EFSPG...sNGRMTTMGVYVR.DLL.......LGQYY...FD..T..LFPRVPVPVVR----qiv..................................................................
A0A024VKM8_PLAFA/173-301               ............................................lem----TNTTTYNVNTLLRNNILS..S.EY.FK-SLIPIKT................................FKEVVDEIHSY..ADHVEP..............YCIG.SNR.............................................AP.STLFCCLYKF.FTMQLSEK..........QVT.HKL-......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------vsilprlpikiknvygarlmiiddhrrrlkknkeniskflkgepvl.......................
I1QLT6_ORYGL/10-175                    ...............................................KSIHGTNPQNLVEKIVRSKIYQ..S.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHTGG..............-TYG.GNR.............................................KP.TPFLCLALKM.LQIQPDKD..........IVV.EFIK......................................................NEDYK..YVRVLGAF....Y...L.....RLTAT........................VADV....YQ.YLE.....PL..YNDYR.KIRHKLSDG...................-----....KFTLIHVDEFID.DLL.......TKDYS...CD..T..ALPRIQKRWVLET--sg...................................................................
A0A0A1T126_9HYPO/24-191                ............................................lap---NGLNPATIMEKTVKDRIIE..S.YF.YKEQCFALNE................................-ADIIDRVVEH..VNFIGG..............-THG.SMQ.............................................KP.SPFLCLAFKL.LELAPSDE..........ILS.EYLKy....................................................gGEEFK..YLRALACF....Y...L.....RMTRQ........................AKDV....YE.QLE.....PY..LEDRR.KLRRKGRAG...................-----....-TALTYMDEFVD.DLL.......TKERV...CA..T..SLWKMTKREILEDL-e....................................................................
B6AGF3_CRYMR/3-168                     .............................................eq--IGDTRKLFLISSILRNRVFS..C.IY.WKSECFGLDS................................-ETILDKAIQ-..LDYVGS..............-TFG.PER.............................................RP.CTFLCLLVKL.LQIQPSLD..........IIL.EYIT......................................................NPEFK..YLTALGII....Y...L.....RLVAS........................PKDI....YI.NLE.....PL..YKDYR.KLKCRDLDG...................-----....SFYILCIDELID.RCL.......RDNVL...FD..I..DLPYLPKRLMLV---keg..................................................................
I1F011_AMPQE/7-103                     ..............................rqnsekipihidvlmlc----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................---SK..YVRALGSL....Y...L.....RIVGT........................SVEC....YK.YLE.....PL..YNDYR.KIKYKNRQG...................-----....KFELSHVDEFVD.SLL.......REDRV...CD..V..ILPRIQKRHILEET-e....................................................................
A0A061DC29_BABBI/10-175                .............................................hl--VHGTNPQFLFSKIMRDKVYN..C.MY.WKESCFGLTA................................-ESIIDKAIE-..LQYVGG..............-TFG.GNR.............................................QP.SPFICLVLKL.LQIQPDLD..........IIE.EYIR......................................................NTEFK..YLRALGIY....Y...M.....RLVGS........................SVKV....YE.TLE.....PI..YSDYR.KLRFRLNDG...................-----....SYELKHMDEFVD.DCL.......RLSSY...LD..V..DLPPLPKRMVLEDA-n....................................................................
Q4Q9W3_LEIMA/270-441                   nfdaelwgvlesrltdelveqvrsagaapnggrlltafeqheqnvka----------------------..-.--.----------................................---VLRYCEQN..VRYAGV..............--FD.DSE.............................................EA.SPFLLAMGLC.WRLGLTMD..........DVC.RHFA......................................................RHPRR..VVRALALY....L...A.....RYTLA........................PEDY....VY.FFT.....PS..LCDEV.IIACTEDAQ...................-----....--VTFSMKDLSR.QLL.......TKKDV...VD..A..WLPILSKRWQE----dv...................................................................
W9QIC3_9ROSA/10-174                    ...............................................KSIRGTNPQNLVEKIVRSKIYQ..N.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHVGG..............-TFG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKE..........IVI.EFIK......................................................NDDYK..YVRVLGAF....Y...L.....RLTGS........................DTDV....YQ.YLE.....PL..YNDYR.KIRRKLADG...................-----....NFSLTHVDEVID.ELL.......TKDYS...CD..I..ALPRIKKRWTLE---si...................................................................
E9IFJ0_SOLIN/10-175                    ...............................................KSIRGTNPQYLIEKIIRSRIYD..S.KY.WKEECFALTA................................-ELLVDKAME-..LRFLGG..............-VYG.GNV.............................................KP.TPFLCLILKM.LQIQPEKD..........IIV.EFIK......................................................NEEYK..YVRALGAL....Y...M.....RLTGS........................SLDC....YK.YLE.....PL..FNDNR.KLRIQNKQG...................-----....VFELIHMDELID.HLL.......REERC...CD..V..ILPRIQKRHVLEEN-n....................................................................
A0A0V0VGZ7_9BILA/62-227                ..............................................a-SLKGTNPQYLIEKVTRSRIYD..S.RY.WKEECFALSA................................-ELLVDRGME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLLLKM.LQIQPEKD..........IVI.EFIR......................................................QEDSK..YIRALGAL....Y...L.....RMTFS........................YVEV....YK.YLE.....PL..LNDYR.KLRWINKQG...................-----....KFELIHMDEFVD.KLL.......REERF...CD..V..QLPRLQKRAFLEE--tn...................................................................
I1PSX7_ORYGL/3-166                     ............................................iqt---SGKPIDLLMEKVLCMNIMS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKIL....WT.WYE.....PY..LKDDE.---------...................EFSPG...sNGRMTTMGVYVR.DLI.......LGQYY...FD..S..LLPRVPLPV------irqvt................................................................
A0A091LHI4_CATAU/12-196                ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKTI--dq...................................................................
B3S4R2_TRIAD/10-175                    .............................................vt--VKGTNPQYLVEKITRSRIYE..C.KY.WKEKCFAVTA................................-ELLVDRAME-..LDHIGG..............-TFG.GNI.............................................KP.TPFLCLILKM.LQIQPEKD..........IIV.EFIK......................................................NEDYK..YVRALGAI....Y...M.....RLVGT........................SNDC....YN.YLE.....PL..YNDFR.KLKRKQRSG...................-----....QFQVIHMDEFVE.ELL.......TEDRA...CD..T..ILPRIQKRYILEQ--tn...................................................................
A0A139AJN0_GONPR/10-175                ...............................................KSVHGTNPQYLVEKILRARIYE..S.LF.WKEHCFALTA................................-ETLIDKAVQ-..LNAIGG..............-HFG.GNM.............................................KP.TEFICLILKM.LQIQPDRS..........ICL.EYLR......................................................QEDFK..YLRALGAY....Y...W.....RLTQR........................AEDV....YK.ELE.....PL..LEDFR.KLRERNKDG...................-----....GLIITHMDEFID.ALL.......REERV...CD..V..QLPRLTKREVLEEQ-g....................................................................
G7XH18_ASPKW/21-207                    ..............................................l--VRGVNPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LTCIGG..............-VYG.VSE.............................................KP.SPFLCLAFKL.LQLNPERD..........IIL.EYLNfsdpanddnnd...............................esyeegngvvkaRGDFK..YLRALAAF....Y...V.....RLTFE........................PVEV....YK.TLE.....PL..LLDYR.KLKRRVRDS...................-----....-FTLTYMDQFVD.ELL.......TKERV...CG..T..SLWKLPARQVLEDL-d....................................................................
A0A0V1HJ47_9BILA/542-725               ..............................................l-NFWGNKETMNLNHLVLENIVS..S.PY.YKNTLLPLKT................................HFEVIDEIYYN..VEHLEP..............WEKG.TRKttgqtgmcg...........................gvrgvgaggVV.SSAFCLLYKL.FTLKLTRK..........QLT.AILN......................................................HPDSC..YIRGLGFM....Y...I.....RFCLH........................PATF....WS.WYE.....PY..FDDAE.---------...................EIDPKa..gGGDLMTIGEMVK.SLL.......TKLDW...YS..T..LFPRIPVPIQKEI--d....................................................................
A0A0N4UBE6_DRAME/47-98                 ..............................................l-PLWGNNQTMNLNALVLENIVQ..C.TY.YKNYLAETTG................................FQQLIEEIYYR..VS----..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------lrnc.................................................................
A0A158PEY3_ANGCS/493-658               ..............................................h-TVRGTNPQFLVEKIIRQRIYD..S.KY.WKENCFALSA................................-DLIVDRALD-..LRYIGG..............-IYA.GNV.............................................KP.TPFLCLSLKI.LQIQPEKD..........III.EFIQ......................................................QEQSK..YARALGAM....Y...L.....RLTFT........................SVEI....YK.YLE.....PL..FNDYR.KLRYMNKQG...................-----....RFELVYMDEFID.NLL.......REERY...CD..I..QLPRLQKRQALEE--ag...................................................................
M7XZP0_RHOT1/10-174                    ..............................................l-SVHGTNPQYLVPTVIRKRVYD..T.LY.WKEHCFALNS................................-ATIIDRAVE-..LKYIGG..............-TYA.NTR.............................................-P.TEFMCLVLKL.LQLQPERE..........IVL.EYLR......................................................AEEFK..YLRALAAF....Y...V.....RLTFD........................SLNA....YE.TLE.....PL..LDDYR.KLRFRGMDG...................-----....SYSILTMDEFVD.QLL.......AGEMV...CE..I..QLPRLTQRKVLEDT-e....................................................................
Q4QCT1_LEIMA/4-144                     .....................................nlkgraaias-----------LDPPTRYRVLH..S.HT.MT-RCANKPL................................-LWVLEELIT-..LRYLGG..............-LTG.PLH.............................................TA.NYFICLVVRL.LQICPSVA..........IVR.VMLE......................................................QDVHK..YLRAAALL....I...I.....RLIGN........................VELQ....RE.AMR.....VG..WSDYR.KLCLYGSDP...................-----....------------.---.......-----...--..-..---------------aqelaeststtaaga......................................................
A0A0G4IQ99_PLABS/427-592               ..............................................s-SVHGQHPQFLIEKIVRLKIYD..L.PY.WKEQCFALNA................................-ETLVDRAVA-..LDCVGG..............-CYG.GTR.............................................QP.SRFLCLLLKM.LQISPELD..........IVL.ALID......................................................AEDFK..YMRLLGAV....Y...L.....RLTAD........................PLDV....YT.YLE.....PL..LNDYR.KVVLRKDGG...................-----....ELELSHIDQVID.ELL.......TGEHF...CN..V..TLPRLPKRRILEE--tg...................................................................
F6SUR6_MONDO/10-175                    ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A0N0U780_9HYME/37-71                 ..............................................l-PLWGNERTMNLNPLILTNIQS..S.HY.FKVNLY----................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------vrgv.................................................................
E1ZPB8_CHLVA/2-179                     .............................................eq---YGNQTTFNLESVLLQNIKR..S.QY.WEKRAKDIAD................................WSELVDEIFET..VDNVEP..............WMSG.NAR.............................................GP.STAFNLLYRL.CQLKPDVR..........QVR.QMLD......................................................HVDST..FIRAIGLL....Y...L.....RYVCD........................PRQL....WD.WFR.....NY..VRDEE.ICKAGLLSLlf...............tqEFEPSp.pgLGRTVTIGAFAR.DIL.......LDQFY...FE..T..IFPRVPKP-------ggadr................................................................
A0A0H5S2F2_BRUMA/10-175                .............................................vt--VKGTNPQYLVEKIIRTRIYD..S.KY.WKEECFALTA................................-ELLVDKGME-..LRYIGG..............-IYA.GNV.............................................KP.TPFLCLCLKM.LQIQPEKD..........IAV.EFIR......................................................QEEYK..YIRALGAM....Y...I.....RLTFT........................SIEV....YK.YLE.....PL..YNDYR.KLRMMNNEG...................-----....RFEIVHMDEFID.SLL.......RDERY...CD..I..HLPRIQKRITLEE--vg...................................................................
W2S0L2_9EURO/19-185                    .............................................pl--IRGQNPATFIETATRDRITD..S.LY.WKEQCFGLNA................................-ATLLDRAVE-..LTYIGG..............-TYG.VGM.............................................RP.TPFLCLAFKL.LTIVPDRD..........IVL.EYLNr....................................................gGEEWK..YLRALAAF....Y...I.....RLTFD........................PAEI....YK.TLE.....PF..LEDSR.KLRRRRKEI...................-----....-YVLTYMDEFVD.ELL.......TKKRS...MG..T..ALWPMPSRQALEDL-d....................................................................
J3MVI2_ORYBR/10-175                    ...............................................KSIHGTNPQNLVEKIVRSKIYQ..S.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHTGG..............-TYG.GSR.............................................KP.TPFLCLALKM.LQIQPDKD..........IVV.EFIK......................................................NEDYK..YVRVLGAF....Y...L.....RLTGT........................VADV....YQ.YLE.....PL..YNDYR.KIRQKLSDG...................-----....KFTLTHVDEFID.ELL.......TKDYS...CD..T..ALPRIQKRWVLET--sg...................................................................
A0A0L1KXD1_9EUGL/17-211                ..............................nmkrkrswrcekllrsd---------------IYELIES..S.SL.WT-EIANVNT................................-VRLISMAIDR..LKVVEG.............tRFSG.KSR.............................................EA.STFQVLLAKL.LELKLPTS..........VIT.AMLC......................................................QPYFK..YITLLSAV....V...I.....RLTQP........................HWVI....WQ.LLG.....PL..LNDYR.NLIIRVPPCp................snSIESS....GHESFLLDNLIM.TLD.......-----...--..-..---------------gqqtyallnmdvlifdllhltghyrildihlphisitpsn.............................
A0A0B2Q8E4_GLYSO/10-175                ...............................................KSIRGTNPQNLVEKILRSKIYQ..N.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHLGG..............-TYG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKE..........III.EFIK......................................................NEDYK..YVRILGAF....Y...L.....RITGS........................DIDV....YR.YLE.....PL..YNDYR.KLRRKLADG...................-----....QFALTHVDEVID.ELL.......TKDYS...CD..I..AMPRVKKRWTLES--lg...................................................................
F0XVG8_AURAN/1-161                     .............................................mv--LHGNQETFNLNPLLANCILN..H.EY.SR-VLWEMGP...............................sFDKLVAEARTK..VTHVEP..............WQRG.TSR.............................................TP.STAFCIVMRL.FQLNLHEG..........HVR.ALLD......................................................QRDAP..WVRCVGFL....Y...L.....RYVCP........................PGDL....WK.WCE.....DV..LLDDG.---------...................AAPVE....PRGDVSLSQWLR.GLL.......TDQKY...FG..T..ILPRIPLKIE-----r....................................................................
A0A0A2VHG9_BEABA/24-191                ............................................lap---NGLNPANIMEKAVKDRITD..S.YF.YKEQCFALNE................................-ADIVDRVVEH..VRFIGG..............-TSG.TTQ.............................................KP.SPFLCLAFKL.LELSPSDA..........VLA.EYLAy....................................................gGEHFK..YLRALACF....Y...L.....RLTRQ........................AKDV....YE.TLE.....PF..LADRR.KLRRKGRER...................-----....-TTLTYMDEFVD.DLL.......SKDRV...CA..T..SLWKMPKREILEDL-e....................................................................
A0A074XMF4_9PEZI/19-183                .............................................tl--IRGQNPLLLFEKAVRDRIID..S.YY.WKEQCFGLNA................................-ATLCDRAID-..LSFIGG..............-TYG.IGQ.............................................KP.TPFLCLAFKL.LQLTPEKE..........IIL.HYLQ......................................................QDDWK..YLRALAAF....Y...I.....RLAWE........................PKDI....YE.TLE.....MY..LSDYR.KLKRRTRDA...................-----....-YALSHVDQFID.DLL.......TKDRV...CA..T..SLWKMPTRTQLEDL-d....................................................................
A4HE72_LEIBR/304-441                   .....................ftafeqheqnvkavlhycetnvcyag----------------------..-.--.----------................................-----------..------..............-VFD.DHE.............................................EA.SPFLVAMGLC.WRLGLTMD..........DVC.RHFA......................................................RHPRR..VIRALALY....L...A.....RYTLA........................PEDY....VY.FFT.....PS..LCDEV.VIACTEDAQ...................-----....--VTLSMRDLSR.QLL.......TKNDV...VD..A..WLPILSKHWQ-----vnv..................................................................
H2KT99_CLOSI/29-213                    ..............................................l-KLWGNQQTMNLNTMVYTNIVQ..S.PY.FKANLIELRT................................YHEVIDEIYYK..VEHLEP..............WERG.SRRvggqsgmcg...........................gvrgvgaggIV.STAFCLLYKL.FTLKLTRK..........QLK.GLLD......................................................HPDSP..YIRALGFM....Y...I.....RYCLP........................PEDF....WW.WYA.....PY..LDDAE.---------...................EIDVKa..gGGSMMTIGSMIQ.HWL.......TKLDW...FG..T..LFPRIPVPVQKK---lee..................................................................
PR38A_HUMAN/10-175                     ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
#=GR PR38A_HUMAN/10-175          SS    ..............................................---BTTB-GGGGS-HHHHHHHHH..S.HH.HHHHSTT--G................................-GGHHHHHTT-..---EE-..............-EET.TTT.............................................EE.-HHHHHHHHH.HHH---HH..........HHH.HHHH......................................................-SS-H..HHHHHHHH....H...H.....HHHS-........................HHHH....HH.HHG.....GG..GG---.EEEEE-TTS...................-----....-EEEEEHHHHHH.HHH.......H-SEE...TT..E..E------HHHHHHT-T....................................................................
A0A0H1BL65_9EURO/21-214                ..............................................l--IRGVNPATLFEKAVRDRITE..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LTYIGG..............-TYG.LAQ.............................................KP.TPFLCLAFKL.LQLAPEKD..........IVL.EYLNfhdpendrveggerd........................gmeeeqdvndgvvkaVGDFK..YLRALAAF....Y...I.....RLTFG........................AADI....YK.TLE.....PL..LVDYR.KLKRRTKDG...................-----....-FMLTYIDQFVD.DLL.......TKDRV...CG..T..SLWKLPSRTQLEDL-d....................................................................
A0A0C2ZA08_9HOMO/10-173                ..............................................a-SIHGQNPQFLVETVIRNRIWE..S.VY.WKEQCFALTA................................-ESLIDKAID-..LRTIGG..............-VYG.NQR.............................................-P.TEFLCLLLKL.LQIQPEKE..........ILI.EYLQ......................................................ADEFK..YMRALAAM....Y...I.....RMTFR........................SVEV....YE.ILE.....PL..MKDYR.KLRYHDMAG...................-----....-YSLVYFDEFIY.QLL.......TEERA...CD..I..ILPRLPKRQTLEE--sg...................................................................
A4RRH8_OSTLU/10-175                    ..............................................k-TVRGMDPQNIMERITRDKVYA..M.TY.WKEKCFAVSA................................-EALVDLAVD-..LRAVGG..............-IYG.GNN.............................................RA.TEFLCLTLKL.LQIQPEKE..........IIL.EFIK......................................................NEDHK..YVRLLGAF....Y...L.....RLVGK........................PTDV....YQ.YLE.....PL..LNDYR.KVRYRSRDG...................-----....KYVLTHVDEFVN.NLL.......TKDMF...CD..V..ALPRVPHRQALEA--ag...................................................................
A0A0D2WQ43_CAPO3/10-175                ..............................................v-SVHGTNPQYLIEKILRERIVE..D.AY.WKEHCFALTA................................-ESVIDKAVE-..LAYVGG..............-TFG.QHV.............................................KP.SPFLCLTLKL.LQLQPSHD..........IIM.TYIE......................................................NTDFK..YLRALGAF....Y...L.....RLTAQ........................SLEI....YE.VLE.....PL..YTDFR.KLRTRNKEG...................-----....EYGLTHMDEFID.RML.......RDDRV...CD..V..ALPRLMQRHVLE---vsg..................................................................
A0A178AI16_9PLEO/25-232                .............................................al--IRGQNPALLFEKGVRERITE..S.YY.WKESCFGLNA................................-ATLCDRAAD-..LKFIGG..............-TTG.ITG.............................................KP.TPFLCLAFKL.LQLVPEKA..........IIL.EYLNfrgdddeeeeeqegqnghtsk...........eedgsdterketpqkdlnaagaLGSFK..YLRCLAAF....Y...I.....RLAWE........................PVEI....YT.TLE.....PL..LTDYR.KIKRRTKDA...................-----....-FTLTHIDQFVD.DLL.......TKDRI...CA..T..SLWKLPSRANLEDL-e....................................................................
A0A0J7LB91_LASNI/37-224                ..............................................l-PLWGNERTMNLNPLILTNIQS..S.HY.FKVNLYELKT................................YHEVIDEIYYK..VSHLEP..............WEKG.SRKtagqtgmcggr.......................fmqvrgvgaggIV.STAYCLLYKL.FTLRLTRK..........QLN.GLIN......................................................HPDSP..YIRALGFM....Y...I.....RYTQP........................PADL....FS.WYS.....DY..LEDEE.-----DLDV...................--KAG....GGQTMKMGDILK.QFL.......TKLEW...FS..T..LFPRIPVPIQKD---le...................................................................
A0A087R9K3_APTFO/25-209                ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....VYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKTI--dq...................................................................
H2R123_PANTR/10-175                    ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
G3VUT2_SARHA/10-175                    ..............................................h-HIHGTNPQFLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDRATE-..LRFVGG..............-VFG.PNI.............................................QP.TPFLCLTLKM.LQIQPEKD..........IVI.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AMDC....YN.YLE.....PL..YNDNR.KSRIQNRNG...................-----....DFEFIHVDEFID.QLL.......HSERV...CD..I..ILPRLQKRHVLEET-n....................................................................
A0A0V1CKQ0_TRIBR/10-175                ..............................................a-SLKGTNPQYLIEKVTRSRIYD..S.RY.WKEECFALSA................................-ELLVDRGME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLLLKM.LQIQPEKD..........IVI.EFIR......................................................QEDSK..YIRALGAL....Y...L.....RMTFS........................YVEV....YK.YLE.....PL..LNDYR.KLRWINKQG...................-----....KFELIHMDEFVD.KLL.......REERF...CD..V..QLPRLQKRAFLEE--tn...................................................................
A0A0V1HJH3_9BILA/45-228                ..............................................l-NFWGNKETMNLNHLVLENIVS..S.PY.YKNTLLPLKT................................HFEVIDEIYYN..VEHLEP..............WEKG.TRKttgqtgmcg...........................gvrgvgaggVV.SSAFCLLYKL.FTLKLTRK..........QLT.AILN......................................................HPDSC..YIRGLGFM....Y...I.....RFCLH........................PATF....WS.WYE.....PY..FDDAE.---------...................EIDPKa..gGGDLMTIGEMVK.SLL.......TKLDW...YS..T..LFPRIPVPIQKEI--d....................................................................
A3GFM9_PICST/15-192                    ............................................dkr---NVLNRAHLIEPIVRHRIQD..S.LF.YKQHLHLTNE................................-ASILPVIIDQ..VHYLAG..............--MD.SSG.............................................RP.SPFICCLLRL.LELEPSME..........IVQ.TCLDq...................................................lgYNEFK..YLTALMLI....Y...I.....RLVGS........................SDLV....YT.TFD.....KY..LSDFR.KLRTKLKSP...................IFNEKglpiNYRLTYFDEWID.NML.......LQERV...MD..I..ILPRLTPRRNLVE--kg...................................................................
A0A078A0F3_STYLE/218-371               .........................................pincdy-------KNGNLPDMLRNNILS..C.QY.FK-DLYALKS................................FQEVIEEIKTN..VTYTDA..............WVIG.ANS.............................................IP.SSLFCCLYKL.MLMRLNEK..........QVG.NLIK......................................................YKHSQ..YVRACGAL....Y...I.....RFLSP........................HDQL....WD.RLS.....PY..MLDEQ.---------...................EFCYS...iDKSKINFGEYVE.KLL.......EIQ--...--..-..---------------kkllsipekr...........................................................
A0A0E0QYC5_ORYRU/23-76                 ...........................................kkvv---------------LSVNILS..S.DY.FK-ELYRLKT................................YHEVINVIYNQ..VDHVEQ..............WMTG.Q--.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------llwplqrll............................................................
PR38B_RAT/47-231                       ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
G3TY10_LOXAF/47-231                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
L9KRQ0_TUPCH/10-175                    ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.ANI.............................................KP.MPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
B4NCI0_DROWI/29-213                    ..............................................l-PFWGNETSMNLNPLILANIQS..S.SY.FKVHLFKLKT................................YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.YTLRLTRK..........QIN.GLLN......................................................HTDSA..YIRALGFM....Y...L.....RYTQP........................PGDL....YE.WYK.....DY..LQDEE.---------...................EIDVKa..gGGQVLTMGQMVY.QFM.......TKLDW...FS..T..LFPRIPVPIQKQIE-k....................................................................
Q4GZ20_TRYB2/36-209                    .............................................wn--LKGRSAVAAFDPVTRHRILQ..S.QT.MA-ACFHRPL................................MATMEDLI-S-..VSYVGG..............-LSG.PLR.............................................KP.EPFICLIARV.LQITPNTA..........IVM.AMLR......................................................QDVHK..YLRVAALF....I...I.....RLIGN........................GTAM....RE.ALR.....IG..WNDYR.KIRVYGSKDd.................cT----....------------.---.......-----...--..-..---------------cetksqdgekadtnevegealvaapihaimcvdeitdrlfntgr.........................
D7MIA4_ARALL/4-168                     ..............................................i-QTNGRAYESLLEKVLSMNILS..S.DY.FK-ELYGLKT................................YHEVIDEIYNQ..VNHVEP..............WMGG.NCR.............................................GP.STAYCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HTDSP..YIRAVGFL....Y...L.....RYVAD........................AKTL....WT.WYE.....PY..IKDDE.---------...................EFSPG...sNGRMTTMGVYVR.DLL.......LGLYY...FD..T..LFPRIPVPVMR----qivs.................................................................
U3IFV6_ANAPL/4-188                     ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKTI--dq...................................................................
A0A0D9S7A0_CHLSB/1-34                  ...............................................----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....----MHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
G5B2Y6_HETGA/1-99                      ...............................................----------------------..-.--.----------................................-----------..------..............----.---.............................................--.---------M.LQIQPEKE..........III.EFLK......................................................NEDCK..YVRLLGAL....Y...T.....RLTGT........................AIDC....YK.YLE.....PL..YKDYR.KIKSQKQNG...................-----....ELELMHVDDFID.VLL.......HSETV...CE..I..ILPRLQKRYVLQE--ae...................................................................
A0A0D0BBL9_9HOMO/10-173                ..............................................i-AIHGQNPQFLVETVIRNRIWE..S.NY.WKEHCFALTA................................-ESLIDQAIA-..LRCIGG..............-VYG.NQR.............................................-P.TEFLCLLLKL.LQLQPEKE..........ILI.EYLQ......................................................ADEFK..YMRALAAM....Y...I.....RMTFS........................AVEV....YE.LLE.....PL..MKDFR.KLRYRDMAG...................-----....-YSLTHFDEFIH.SLL.......TEERV...CD..I..ILPRNAKRSILEE--ng...................................................................
U5FR78_POPTR/10-175                    ...............................................KNIRGTNPQNLVEKILRSKIYQ..H.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHLGG..............-TYG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKD..........IVV.EFIK......................................................NEDYK..YVRVLGAF....Y...L.....RLTGT........................DIDV....YR.YLE.....PL..YNDYR.KLRKKLTDG...................-----....KFALTHMDEVID.ELL.......TKDYS...CD..I..AMPRIKKRWTLET--la...................................................................
A0A067TR38_9AGAR/10-173                ..............................................q-AIHGQNPQFLVETVIRNRIYE..S.TY.WKEHCFALTA................................-ESLIDKAID-..SRFIGG..............-VYG.NQR.............................................-P.TEFLCLLLKL.LQIQPEKE..........ILV.EYLR......................................................AEEFK..YLRALAAL....Y...I.....RMTFR........................AVDV....YE.LLE.....PL..LKDYR.KLRMRNMSG...................-----....-YSLVFMDEFIC.SLL.......TEERV...CD..I..IMPRIAKRQVLEEN-g....................................................................
A0A094GDZ7_9PEZI/22-189                ............................................lap---NGLNPATIFEKPVRERIID..C.YF.WKDQCFALNE................................-ADIVSRVVEH..VHFVAG..............-TYG.DSQ.............................................RP.SPFLCLAFKL.LQLGPGDD..........ILN.EYLGy....................................................gGERFK..YLRALACF....Y...V.....RLTRP........................AKEV....YE.TLE.....PF..LEDGR.KLRRRGRQG...................-----....-TTLTFVDQFVD.ELL.......TKERI...CA..T..SLWKMPKREVLEDL-e....................................................................
A0A166AGB7_EXIGL/10-173                ..............................................q-SVHGQNPQSLVEYTIRLRIYE..S.EF.WKEHCFALTA................................-ETLIDKALE-..LNAIGG..............-VYG.NQR.............................................-P.TKFLCLLLKL.LQIQPEKE..........ILV.EYLL......................................................ADEFK..YLRALAAM....Y...I.....RMTFR........................ANEV....YE.LLE.....PL..MKDFR.KLRVRSMSG...................-----....-YSLTFIDAFVD.DLL.......REERV...CD..I..ILPRIARREILEE--sg...................................................................
H0WS15_OTOGA/10-175                    ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
Q8II38_PLAF7/11-175                    ............................................knf----GSNPQYLISNIIRSKIYD..S.PY.WKEKCFALTS................................-ESIIDQAIN-..LKYVGG..............-TYG.GNR.............................................KP.TRFLCLILKL.LQIQPDKD..........IIY.EYIK......................................................NEDFV..YLRALGIF....Y...L.....RLIGK........................SLEV....YN.HLE.....PI..LFDYR.KIRMRLQNG...................-----....TFEKIYMDVFVD.NCL.......ILNNF...LD..V..DFPTLTKRQVLEEN-n....................................................................
E3RUL4_PYRTT/23-233                    ..............................................k-LIRGQNPALLFEKGVRERITE..S.YY.WKEQCFGLNA................................-ATLCDRAAE-..LKFIGG..............-TTG.ING.............................................KP.TPFLCLAFKM.LQLVPDKD..........IIL.EYLNfrdddedeehnedntdanadaen........ghvsdtestaaakktldlnakgkLGNFK..YLRCLAAF....Y...I.....RLAWE........................PVEI....YT.TLE.....PL..LTDYR.KIKRRLKDA...................-----....-FTLTYIDQFVD.DLL.......TKERI...CA..T..SLWKLPSRANLEDL-d....................................................................
V9FB38_PHYPR/37-201                    ..............................................l-PIYGNDTTYNLNTLLHQNILQ..S.AY.FH-ELYKFRT................................YHEVVDEIYYR..VDHAEP..............WSPG.TAR.............................................IP.SSCFCLLHKF.LLMRLTRK..........QMQ.GLLR......................................................HTDSP..YIRVVGFL....Y...L.....RFTCD........................PEEL....WT.WFE.....PF..LEDPE.---------...................EFNASa..nPSVKTTIGEWLI.SLL.......EENNY...FG..T..ILPRIPKKIE-----dgik.................................................................
A0A093L358_FULGA/1-111                 ..............................................i----------------------..-.--.----------................................-----------..------..............----.---.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HEERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A067D0W8_SAPPC/50-213                ..............................................l-PVHGNATTYNLNKMLFDNIMQ..S.VY.FG-QLYALKT................................YHEVVDEIYYR..VDHAEP..............LSPG.TAR.............................................IP.SSCFCLLLKF.CTMRLTHN..........QMQ.GLLK......................................................HVDSP..YIRCVGFL....Y...L.....RYTMD........................PEEL....WA.WFE.....PY..LDDAE.---------...................EFNASa..nDKIITTIGVWLR.TLL.......EEINY...FG..T..ILPRIPKKI------ldgi.................................................................
A0A183AZC0_9TREM/10-175                ..............................................h-TVHGTNPQYLVEKIIRSRIYE..S.KY.WKEHCFALTA................................-ELLVDKAVE-..LRYVGG..............-VFG.GNV.............................................KP.TPFLCLALKM.LQIQPDKD..........IVI.EFIK......................................................QEPYK..YARALGAF....Y...L.....RLVGE........................SVEI....YK.YLE.....TL..YNDFR.RLKFQDRNG...................-----....NFSLIYMDDFID.SLL.......TEERV...CD..V..ILPRLQKRSVLEET-n....................................................................
B4NNL6_DROWI/10-175                    ...............................................KNVHGTNPQYLIEKIIRSRIYD..S.KY.WKEQCFALTA................................-ELLVDKAME-..LRFVGG..............-VFG.GNI.............................................KP.TQFLCLTLKM.LQIQPEKD..........IVV.EFIK......................................................NEEFK..YVRALGAF....Y...L.....RLTGA........................ALDC....YK.YLE.....PL..YIDNR.KLRRQNRSG...................-----....QFEIVYMDEYID.ELL.......RNDRV...CD..I..ILPRIQKRTILEEN-n....................................................................
A0A059ADM4_EUCGR/1-112                 ...............................................----------------------..-.--.----------................................-----------..------..............-MTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYAAD........................PKTL....WS.WCE.....PY..VKDEE.---------...................EFSPG...sNGRMTTMGVYLR.DLL.......LGQYY...FD..T..LFPRIPVPVL-----rqiv.................................................................
Q6CS55_KLULA/14-213                    ...............................................KQLNHQSASLVVPQIFRNKVSS..C.MY.YKFNLTPASLrg............................dtIVELIPVIVRD..FGTMDErkt........phvTVLG.GIE.............................................--.--FKCLLMKL.INLRPPWE..........QLK.VLLEp...................................................hePLNNK..YIAALVLC....Y...M.....RISYYfltesn...........pseqdisFNLL....HD.LMK.....KY..ILDHR.KLKSYSLDMdc...............wsSSIKK....EIKLIHFDELID.WLC.......DRNEI...WG..I..PLGKCNW-CKIW---ddee.................................................................
E6NU38_JATCU/10-175                    ...............................................KSIRGTNPQNLVEKILRSKIYQ..N.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHLGG..............-TFG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKD..........IVV.EFIK......................................................NDDYK..YVRILGAF....Y...L.....RLTGT........................DVDV....YR.YLE.....PL..YNDYR.KLRQKLPDG...................-----....KFALTHVDEVID.ELL.......TKDYS...CD..V..ALPRIKKRWTLES--lg...................................................................
A0A0W4ZL05_PNEJI/15-179                ..............................................q-SVHSMNPTNLIEKIIRERVLD..C.RY.YKEMCFGLTA................................-ATICDRAVR-..LKCIGG..............-QY-.LNQ.............................................RP.TEFLCLAFKL.LQLQPEKE..........IVL.EYLY......................................................AKDFK..YLQALAAF....Y...I.....RLTFP........................AKEC....YI.ILE.....PF..LSDYR.KLRIRHSTG...................-----....SYGLTYIDEFID.HLL.......NEERV...CD..I..ALPRLPTRFMLEEM-d....................................................................
A0A0V1MZ07_9BILA/438-621               ..............................................l-NFWGNKETMNLNHLVLENIVS..S.PY.YKNTLLPLKT................................HFEVIDEIYYN..VEHLEP..............WEKG.TRKttgqtgmcg...........................gvrgvgaggVV.SSAFCLLYKL.FTLKLTRK..........QLT.AILN......................................................HPDSC..YIRGLGFM....Y...I.....RFCLH........................PATF....WS.WYE.....PY..FDDAE.---------...................EIDPKa..gGGDLMTIGEMVK.SLL.......TKLDW...YS..T..LFPRIPVPIQKEI--d....................................................................
A0A0R3W7J4_TAEAS/27-211                ..............................................l-KLWGNQVTMNINPMIHTNIIQ..S.PY.FKTNLIELKT................................YHEVIDEIYYK..VTHLEP..............WERN.SRRmggqtgmcg...........................gvrgvgaggIV.STAYCLLFKL.FTLKLTRK..........QLK.GLLE......................................................HPDSP..YIRALGFM....Y...I.....RYCLP........................PEDL....WM.WFA.....PY..LDDEE.---------...................EIDVRa..gGGCNMTIGAMLS.QWL.......TKLDW...FS..T..LFPRIPVPVQKKID-e....................................................................
A0A158NBQ6_ATTCE/10-175                ...............................................KSIRGTNPQYLIEKIIRSRIYD..S.KY.WKEECFALTA................................-ELLVDKAME-..LRFLGG..............-VYG.GNV.............................................KP.TPFLCLILKM.LQIQPEKD..........IIV.EFIK......................................................NEEFK..YVRALGAL....Y...M.....RLTGS........................SLDC....YK.YLE.....PL..FNDNR.KLRIQNKQG...................-----....VFELVHMDEFID.NLL.......RDERC...CD..V..ILPRIQKRHVLEEN-n....................................................................
G8YR38_PICSO/12-187                    ............................................dkr---NVLNKASLVEPIVRHRVQD..S.IF.YKQYLYLTNE................................-STILNVIIEH..VHYIGG..............--TS.ANG.............................................KP.SPFLCCMVRL.LELEPKQE..........IIQ.MYLSq...................................................mgTNTFK..YLTAMTLM....Y...I.....RFVGS........................SEEI....YS.ILE.....EY..YKDYR.KLRFQLKYPr................dhNGVHK....LYTLTYMDEWVD.DLL.......HKERL...VD..L..ILPRLPPRRFL----qei..................................................................
A0A0V0R7M2_PSEPJ/10-175                .............................................sf--VRGTNPQYLIDKILRNKIYN..C.RY.WKENCTGLTA................................-ESLVDEAIQ-..LEYVSG..............-SYG.GFR.............................................QP.SKFICLVAKM.LQLSPEKE..........IVL.EYMR......................................................NEDYK..YVTALAMF....Y...W.....RMIAT........................TEEC....YK.ILE.....EY..YSDYR.KIRYRNEDG...................-----....SFQIIHIDEFAD.DLL.......KKEVL...CS..T..VLPHIQSRINLEE--fn...................................................................
I3ND88_ICTTR/50-234                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
G1Q147_MYOLU/28-211                    ..............................................l-QLWGNEKTMNLNPMILTNI-S..S.PY.FKGQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgiggIV.STAFCLLYKL.FTLKLTRK..........QVV.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLW.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
A0A168IF30_CORDF/24-191                ............................................lap---NGLNPANIMEKAVKDRITD..S.YF.YKEQCFALNE................................-ADIVDRVVEH..VRFIGG..............-TSG.MTQ.............................................KP.SPFLCLAFKL.LELSPSDA..........VLA.EYLAy....................................................gGEHFK..YLRALACF....Y...L.....RLTRQ........................ARDV....YE.TLE.....PF..LADRR.KLRRKGRDR...................-----....-TYLSWMDEFVD.ELL.......TKDRV...CA..T..SLWKMPKRETLEDA-e....................................................................
A0A087RHR9_APTFO/10-175                ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LKYVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HEERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A091MUQ9_9PASS/1-141                 ..............................................l----------------------..-.--.----------................................----------Q..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKTI--dq...................................................................
Q7PX02_ANOGA/10-175                    ...............................................KNVHGTNPQYLIEKIIRSRIYD..S.KY.WKEQCFALTA................................-ELLVDKAME-..LRFVGG..............-VFG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IVV.EFIK......................................................NEEFK..YVRALGAF....Y...L.....RLTGS........................SLDC....YK.YLE.....PL..YNDNR.KLRKQNRMG...................-----....AYELIHMDEFID.ELL.......REERV...CD..I..ILPRIQKRHVLEEN-n....................................................................
W7TLT3_9STRA/33-198                    ..............................................l-PIHGNQTTYNVNTLLANNIMG..C.DY.FR-ALYPLQT................................YHEVIDEVYNK..VTHVEP..............WATG.TSR.............................................LP.STAFCLLFKF.FTMRLTKK..........QVT.GLLT......................................................HSDSP..YIRAIGFL....Y...L.....RYACD........................PKQI....WD.WYA.....PY..LDDSE.---------...................EFAPSs..dPNALTTLGLWLR.GLL.......SDLHY...YG..T..MLPRIPVPLERK---ikm..................................................................
W4IUL8_PLAFP/173-301                   ............................................lem----TNTTTYNVNTLLRNNILS..S.EY.FK-SLIPIKT................................FKEVVDEIHSY..ADHVEP..............YCIG.SNR.............................................AP.STLFCCLYKF.FTMQLSEK..........QVT.HKL-......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------vsilprlpikiknvygarlmiiddhrrrlkknkeniskflkgepvl.......................
W6XT96_COCCA/23-228                    .............................................al--IRGQNPALLFEKGVRERITE..S.YY.WKEQCFGLNT................................-ATLCDRAAE-..LKFIGG..............-TTG.ITG.............................................KP.TPFLCLAFKM.LQLVPEKE..........IIL.EYLNfrddeddeddkaevkkengd.............aaanddddsakkeldlnaagkLGCFK..YLRCLAAF....Y...I.....RLAWE........................PVEI....YK.TLE.....PL..LTDYR.KIKRRLKDT...................-----....-FTLTHVDQFID.DLL.......TKDRI...CA..T..SLWKLPSRAILEDL-d....................................................................
A0A0D2IT05_9EURO/19-185                .............................................pl--IRGQNPALLLETAMRDRITD..S.LY.WKEQCFGLNA................................-ATLCDRAVE-..LTYIGG..............-TYG.VAM.............................................KP.TPFICLAFKL.LTLVPDKE..........IVL.EYLNs....................................................gGEEWK..YLRALAAF....Y...A.....RLTFD........................PADI....YK.TLE.....PF..LEDSR.KLRQRRKES...................-----....-YVLTHMDEFVD.SLL.......TKDRV...CG..T..SLWKLPARQLLEDL-d....................................................................
A0A087VRT3_BALRE/10-175                ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LKYVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HEERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
F2TX53_SALR5/105-247                   .............................................iw----------------------..-.--.----MFALKT................................FEDIVDEIYTF..VDHLEP..............IILS.PQN.............................................SP.STAFCLLYRL.FCLRLNEA..........QLD.TLVT......................................................HKDSV..YIRAIGFL....Y...L.....RYTAD........................PETL....WT.WFS.....DY..IDDPE.PVKVKMAAA...................-----....-APQMPLGEYLR.MLI.......TELQY...LHpvC..RLPRIPVMEH-----rdmld................................................................
A0A063BZU8_9HYPO/25-192                ............................................lap---NGLNPATIMEKAVRDRITE..S.YF.YKEQCFALNE................................-ADVVDRVVEH..VRFVGG..............-THG.DAQ.............................................KP.SPFLCLAFKL.LELAPGDD..........ILR.EYLAh....................................................gGAHFK..YLRALACF....Y...V.....RLTRP........................ARDV....YA.SLE.....PL..LRDGR.KLRRRGRAG...................-----....-TSLTFVDEFVD.DLL.......TKERV...CA..T..SLWKMPAREVLEDL-e....................................................................
A0A066XD06_COLSU/24-191                ............................................lap---NGENPATIMEKAVRERIID..S.YF.YKEQCFAVNE................................-ADIVDRVVEH..VSFIGG..............-TYG.VTQ.............................................KP.TPFLCLAFKL.LQLAPSDA..........VLE.TYLGf....................................................gGDKFK..YLRALACF....Y...V.....RMTRK........................PRDV....YL.LLE.....PF..LEDRR.KLRRKGRQG...................-----....-TSLTYMDDFVD.DLL.......TKTRV...CA..T..SFRELPKRSDLVD--ld...................................................................
PR38B_HUMAN/47-231                     ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
F7HY13_CALJA/10-175                    ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A0D2GU34_9EURO/20-185                ..............................................l--VRGQNPALLLETAMRDRITD..S.LY.WKEQCFGLNA................................-ATLCDRAVE-..LSYIGG..............-TYG.VAM.............................................KP.TPFICLAFKL.LTLVPDRE..........IVL.EYLQn....................................................gGEEWK..YLRALAAF....Y...V.....RLTFE........................PADV....YK.TLE.....PY..LEDSR.KLRQRRKES...................-----....-YVLIHMDEFVD.NLL.......TKDRV...CG..T..SLWKLPARQLLEDL-e....................................................................
A0A0B7MVN4_9FUNG/11-178                ..............................................s-SIHGRHPLHLVEKIIRERIQN..S.IY.WKEKCYGLTDw.............................qtAATLMDRAFE-..LEYIGG..............-MYG.NNQ.............................................-P.TEFLCLTLKL.LSLEPEKN..........IVI.ELIK......................................................QEDSK..YLRALGAF....Y...L.....RLTGK........................SKEI....YQ.YLE.....PL..LNDYR.KLRVRAGSG...................-----....-YELTHMDSFID.ELL.......RNERV...CD..I..ILPRITNRYVLEQN-d....................................................................
C1GJF7_PARBD/21-214                    ..............................................l--IRGVNPATLFEKAVRDRITE..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LTYIGG..............-TYG.LAQ.............................................KP.TPFLCLAFKM.LQLSPEKE..........IVL.EYLNfhdpetghdgvygen........................nveedhdkdsgvvkaVGDFK..YLRALAAF....Y...I.....RLTFD........................AAEI....YT.TLE.....PL..LADYR.KLKRRTKDG...................-----....-FLLTYMDQFVD.DLL.......TKDRV...CA..T..SLWKLPSRTQLEDL-d....................................................................
A0A0G4PH36_PENCA/21-204                ..............................................l--VRGVNPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LTSIGG..............-TYG.VSE.............................................KP.TPFLCLAFKL.LQLGPDRD..........VIL.ELLNytdpgsgdea..................................enpddalvkeRGDFK..YLRALAAF....Y...V.....RLTFE........................PVDV....YK.TLE.....PL..LLDYR.KLKRRVRDT...................-----....-FTLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKLPPRSQLEDL-d....................................................................
A0A151M4G2_ALLMI/10-175                ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LKYVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HKERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
W7JYK7_PLAFO/173-335                   ............................................lem----TNTTTYNVNTLLRNNILS..S.EY.FK-SLIPIKT................................FKEVVDEIHSY..ADHVEP..............YCIG.SNR.............................................AP.STLFCCLYKF.FTMQLSEK..........QLK.SLIE......................................................NKDSC..YIRACGFL....Y...L.....RYVHS........................PANL....WM.WFE.....PY..LLEED.---------...................EFSISc..dKRRKVTIGEYVQ.SLL.......SDDKY...FN..T..VLPRLPIKIK-----nvy..................................................................
G3QMW7_GORGO/10-175                    ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
Q9FHS8_ARATH/4-159                     .............................................iq--SNGRAYESLLEKVLSMNILS..S.DY.FK-ELYGLKT................................YHEVIDEIYNQ..VNHVEP..............WMGG.NCR.............................................GP.STAYCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HTDSP..YIRAVGFL....Y...L.....RYVAD........................AKTL....WT.WYE.....PY..IKDDE.---------...................EFSPG...sNGRMTTMGVY--.---.......---YY...FD..T..LFPRIPVPVM-----rqiv.................................................................
A0A0F4GLW9_9PEZI/19-186                .............................................tl--IRGDNPLKLFEKPVRDRIVD..S.YY.WKEQCFGLNA................................-ATVLDRAVE-..LTFLGG..............-TYG.VAQ.............................................KP.TPFLCLAFKL.LQLTPEKE..........IIM.YYLEq....................................................aGEEFK..YLRALAAF....Y...V.....RMAWE.......................kDEDV....YT.TLE.....PY..LADFR.KLKRRTREG...................-----....-WALTHVDQFID.DLL.......VKSRV...CA..T..TLPKINPRTFLEDE-d....................................................................
N4VSA6_COLOR/24-191                    ............................................lap---NGENPATIMEKAVRERIIK..S.EY.YLAQCFALNE................................-ADIVDRVVED..VTCVGG..............-TYG.VTQ.............................................KP.TTFLCLAFKL.LQLAPSDD..........VVQ.TYLAh....................................................gGDKFK..YLRALACF....Y...V.....RMTRR........................PKDV....YL.LLE.....PF..LEDRR.KLRKKGREQ...................-----....-TTLTYVDEFVD.DLL.......VKTRV...CA..T..SFRELPKRVDLVD--lg...................................................................
A0A0E0A4V7_9ORYZ/4-166                 ........................................qssgrpi--------DVLMEKVLSVNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.SSAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAVGFL....Y...L.....RYVAE........................PKTL....WS.WYE.....PY..IKDDE.---------...................EFSPG...sNGKMTTMGVYVR.DLL.......LGQYY...FD..S..LLPRVPLPI------lrqvt................................................................
I1RQR3_GIBZE/26-192                    .............................................ap---NGLNPATIMEKAVRDRIVD..S.IY.YKMQCFACNE................................-ADIVDRVVED..VKFIGG..............-TYG.TTQ.............................................VP.SPFLCLAFKL.LELSPSDA..........VLL.EYLKf....................................................gGEAFK..YLRALACF....Y...F.....RLTRQ........................AKNV....YE.MLE.....PF..LEDRR.KLRRRGREG...................-----....-VKLSYMDEFVD.DLL.......TKERV...CG..T..SLWKMPKREVLEDL-e....................................................................
J3K8Q1_COCIM/21-209                    ..............................................l--VRGVNPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LGYIGG..............-TYG.ANQ.............................................KP.TPFLCLAFKL.LQLAPERE..........VVL.EYLNfhdpaeddddng.............................dedggdgaavlksVGDFK..YLRALAAF....Y...I.....RLTFE........................PVEV....YN.VLE.....PL..LSDYR.KLKRRTKDG...................-----....-FVLTYMDQFVD.DLL.......NKDRV...CG..T..SLWKLPARRILEDL-d....................................................................
J6E9Q7_SACK1/15-219                    ...............................................KQLNNQSVSLIIPRLTRDKIHN..S.MY.YKVNLSNESLrg............................ntMLELLKVIIDA..LGTLRGqdg.......hlnmAVLG.GVE.............................................--.--FKCILMKL.VEIRPNLK..........QLA.FLLDvk.................................................nvkDFNSK..YIIALVLV....Y...A.....RLQYYylndq.............nknnsyENDL....IQ.LFKvq.lyKY..SQQFF.KLKSFPLQVdc...............faHSQNE....GLCIVHVDELVD.WLV.......TQDHI...WG..I..PLGKCQWSK------iydsee...............................................................
A0A0V0TYL1_9BILA/1-71                  ...............................................----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..-------L....Y...L.....RMTFS........................YVEV....YK.YLE.....PL..LNDYR.KLRWINKQG...................-----....KFELIHMDEFVD.KLL.......REERF...CD..V..QLPRLQKRAFLEE--tn...................................................................
R1EHA8_BOTPV/20-176                    .............................................al--IRGQNPALLFEKAVRDRIIE..S.YY.WKEQCFGLNA................................-ATLCDRAAE-..LTFVGG..............-TYG.GLG.............................................KP.TPFLCLAFKL.LQLVPEKE..........IIL.AYLNwpedeeredg..................................esdeghapgvKGDFK..YLRALAAF....Y...I.....RLAWE........................PVDI....YK.TLE.....PL..LADYR.KLKRRMRDG...................-----....------------.---.......-----...--..-..---------------fvltplnll............................................................
G0VC19_NAUCC/15-211                    ...............................................KELNNQSVSLVIPRLTRDKIHN..V.LY.YKVNLTSTSLrg............................ntMLQLSKIIIRD..LGQLKDsns........lknYLVG.GVE.............................................--.--FKCLLMKL.IEIRPTFD..........QIT.MLLEkkk...............................................spddTFENK..YIVALILT....Y...L.....RIQYYylk..................lhdASHL....IN.LFR.....EY..INDYR.KLKGIDMDMdc...............wsMSQQL....KVEIIHIDELVD.RLA.......TNNNI...WG..I..PLGKCQWSNI-----feldd................................................................
A0A024W143_PLAFA/173-335               ............................................lem----TNTTTYNVNTLLRNNILS..S.EY.FK-SLIPIKT................................FKEVVDEIHSY..ADHVEP..............YCIG.SNR.............................................AP.STLFCCLYKF.FTMQLSEK..........QLK.SLIE......................................................NKDSC..YIRACGFL....Y...L.....RYVHS........................PANL....WM.WFE.....PY..LLEED.---------...................EFSISc..dKRRKVTIGEYVQ.SLL.......SDDKY...FN..T..VLPRLPIKIK-----nvy..................................................................
A0A0N1IAW4_PAPMA/22-206                ..............................................l-PIWGNEQTMNLNPLILANIQG..S.SY.FKVHLFKLKT................................YHEVVDEIYYQ..VKHLEP..............WERG.SRKtagqtgmcg...........................gvrgvgaggIV.STAFCLLYKL.YTLRLTRK..........QVN.GLLQ......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PADL....FD.WYV.....DY..LDDEE.---------...................EIDPRa..gGGGPTTIGALVR.QML.......IKLDW...FS..T..LFPRIPVPIQKQIE-q....................................................................
V4ZI95_TOXGV/10-175                    ..............................................q-QVHGCNPQTLVSRIIRRKIYE..S.AF.WKEQCFALTA................................-ETVLEPCVG-..LTYVGG..............-TYG.GKR.............................................QP.APFLCLVLKL.LQIQPEPE..........IIL.EFIK......................................................QEQFK..YLRAVGAF....Y...L.....RLVGR........................ACEV....YT.HLE.....PL..LADYR.KLRLRLADG...................-----....KFTIVCMDEFVD.DCL.......RKTNF...LD..V..DLPVLPKREVLES--eg...................................................................
A0A175YMA7_DAUCA/6-165                 ..........................................kpidq----------LLEKVLCMNILS..S.DY.FK-ELYRFKT................................IYEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTSK..........QMH.VLLD......................................................HPDSP..YIRAVGFL....Y...L.....RYAAD........................PKTL....WG.WFE.....PY..IKDNE.---------...................EFSPG...sNGRMTTMGVYIR.DLL.......LGQYY...FD..T..LFPRIPVPVMR----liqa.................................................................
PR38B_DANRE/25-209                     ..............................................l-PLWGNEKTMNLNPMILTNVLS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VNHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HSDSP..DIRALGFM....Y...I.....RYTQP........................PPDL....VD.WYD.....EF..LDDEE.---------...................ELDVKa..gGGCVMTVGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKAI--dq...................................................................
A0A085NTX6_9BILA/422-604               .............................................la--FWGNKQTMNLNHLVYENIMI..S.PY.YKNTLSQVVT................................YHEVLDEIYYN..VDHLEP..............WERG.TRKttgqtgmcg...........................gvrgvgaggVV.SSAFCILYKL.FTLKLTRK..........QLI.SMLN......................................................HSDSC..YIRGLGFM....Y...V.....RYCLH........................PNSF....WY.WFE.....PY..LDDEE.---------...................EIDPKa..gGGEVMTIGDMIR.QML.......NKLEW...YT..T..LFPRIPVPIQV----rr...................................................................
H2ZEL3_CIOSA/29-213                    .............................................lt--CWGNPRTMNLNHLVLTNVQN..S.PY.FKVRLFELKT................................YHEVVDEIYYK..VDHLEP..............WERG.TRKtagqtgmcg...........................gvrgvgaggVV.STSFCILFKL.FTLKLTRK..........QVN.GLLN......................................................HTDSP..FIRGLGVM....Y...I.....RYTQA........................PKDL....WN.WYE.....PY..LEDEE.---------...................EIDVKa..gGGCVMTIGMMIR.TVL.......TKLDW...FS..T..LFPRIPVPIQKEID-e....................................................................
U6L8R2_EIMTE/10-173                    .............................................va--VHGKNPQLLFSRIVRRKVYE..S.FF.WKEECFAATA................................-ATVAELAAA-..LQYVGG..............-TFG.GIR.............................................AA.SPFLCLVLKL.LQLQPEKE..........IIL.EFIK......................................................QEDFK..YLRAVAAF....Y...L.....RLVGP........................SAEV....YV.HLE.....PL..LADYR.KLRLRLRDG...................-----....SFRVSFMDEFVD.QCL.......RNNSL...FD..V..DFPPLVKR-------pvfvl................................................................
A0A0F8C5Y3_LARCR/1-124                 ..............................................m----------------------..-.--.----------................................----------E..LKYVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRLLGAM....Y...M.....RLTGT........................AVDC....YK.YLE.....PL..YNDYR.KIKTQNRNG...................-----....EFELMHVDEFID.ELL.......HAERM...CD..I..ILPRLQKRHVLEEA-e....................................................................
A0A167R152_9BASI/10-173                ..............................................t-SVHGTNPQYLIETVIRSRIYE..S.LF.WKEQCFALTA................................-ETLIDKAIE-..LNCIGG..............-VYG.NQR.............................................-P.THFMCLLLKL.LQIQPEKE..........ILI.EYLL......................................................VDEFK..YLRALAAI....Y...I.....RLVFR........................PAEV....FE.LLE.....PL..LKDYR.KIRLRNTSG...................-----....-YRLTYMDEYVD.ELL.......REERV...CD..I..ILPRMTKREVLEE--ve...................................................................
M7YZV4_TRIUA/3-103                     ...........................................lqts----GRPIEVLMEKVLSMNIVS..S.DY.FK-ELYKIKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKL.FTMKLTVN..........QMH.GLLK......................................................HPDSP..YIRAVTLM....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------eys..................................................................
B8B2Q7_ORYSI/4-173                     ........................................qssgrpi--------DVLMEKVLSVNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.SSAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAVGFL....Y...L.....RYVAE........................PKTL....WS.WYE.....PY..IKDDE.---------...................EFSPG...sNGKMTTMGVYVR.DLLlgqvhseQKRYY...FD..S..LLPRVPLPI------lrqvt................................................................
B3MXQ1_DROAN/35-219                    ..............................................l-PFWGNETSMNLNPLILANIQS..S.SY.FKVHLFKLKT................................YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.YTLRLTRK..........QIN.GLLN......................................................HTDSA..YIRALGFM....Y...L.....RYTQP........................PGDL....YD.WYE.....DY..LQDEE.---------...................EIDVKa..gGGQVLTIGQMVY.QFM.......TKLDW...FS..T..LFPRIPVPIQKQIE-k....................................................................
A0A0C2FSM3_9BILA/5-81                  ........................................svtssss----------------------..-.--.----------................................-----------..------..............----.---.............................................--.-------MKS.AMVRLTRK..........QLI.SMIN......................................................SRVSP..YIRGLGFM....Y...I.....RYTQP........................PADL....WE.WFE.....PY..LDDEE.---------...................EIDPRs..gGGDVMTFG----.---.......-----...--..-..---------------q....................................................................
A0A0J7L2G9_LASNI/10-175                ...............................................KSIRGTNPQYLVEKIIRSRIYD..S.KY.WKEECFALTA................................-ELLVDKAME-..LRFLGG..............-VYG.GNV.............................................KP.TPFLCLILKM.LQIQPEKD..........IIV.EFIK......................................................NEEFK..YVRALGAL....Y...M.....RLTGS........................SLDC....YK.YLE.....PL..FNDNR.KLRIQNKQG...................-----....VFELVHMDEFID.NLL.......RDERS...CD..V..ILPRIQKRYVLEEN-n....................................................................
A0A0D1CL78_USTMA/10-174                ..............................................v-SIHGTNPQFLIEKPVRARIYE..S.PF.WKEHCFALSA................................-ATILPLAVS-..LNHIGG..............-LVG.L-Q.............................................RP.SHFLCLLQKL.LQIQPEPA..........IIN.AYLE......................................................AREFK..YLGALTAF....Y...I.....RLTYT........................SKHV....YT.LLE.....PM..LEDGR.KLRWRSGDG...................-----....AYEILHMDEWVD.MLL.......REERV...CD..I..ILPRLTRRDVCET--rd...................................................................
W4KIC8_9HOMO/10-173                    ..............................................q-AIHGQNPQFLVETVIRNRIYE..S.SF.WKEHCFALTA................................-ETLIDKSLE-..LRCIGG..............-VYG.NQR.............................................-P.TEFLCLLLKL.LQIQPEKE..........ILL.EYLQ......................................................ADEFK..YLRALTAI....Y...I.....RMTFG........................ASDV....YE.LLE.....PL..LKDFR.KLRYRNTTG...................-----....-NNITFIDDFVD.QLL.......NDERV...CD..I..ILPRIPKRQMLEE--ag...................................................................
A7F153_SCLS1/21-188                    ............................................lap---NGLNPTTILEKPVRERIVD..C.YF.WKDQCFALNE................................-ADIVSRVVSH..VTFIAG..............-TYG.DSQ.............................................RP.SPFLCLAFKL.LQLGPSDE..........ILQ.EYMGy....................................................gGEKFK..YLRALALF....Y...W.....RMTRQ........................AKDV....FM.VLE.....GY..LDDRR.KLRRKTRTG...................-----....-TTLTFMDQFVD.DLL.......TKDRV...CG..T..TLWKMPKREILEDL-e....................................................................
A0A0D2MW08_9CHLO/10-175                ...............................................KSIHGTNPQNLVEKITRNKIQA..S.VY.WKEKCFGLSA................................-ETLIDRAVE-..LRSVGG..............-MYG.EPN.............................................KP.TEFVCLILKM.LQIQPDFD..........IVV.ELIR......................................................NEDYK..YVRLLGAF....Y...L.....RLVGR........................ALDV....YT.YME.....PL..YNDFR.KVRLRTSEG...................-----....GFVLSHVDAVVD.DML.......RKDYL...FD..I..ALPHIPNRLTMEN--tg...................................................................
L8X0R2_THACA/10-163                    ..............................................i-HIHGQNPQFLVEKVIRTRIWE..S.AY.WKEQCFALTG...............................rPESLIDKAIE-..LNSIGG..............-VYG.NQR.............................................-P.TDFISLLLKL.LQIQPEKE..........ILI.EYLM......................................................VDEFK..YLRALAAM....Y...I.....RMTFP........................PVEV....YE.LLE.....PL..LKDYR.KLRLRNMDQ...................-----....------------.-LL.......TEERV...CD..I..ILPRLAKREVLEET-e....................................................................
A0A151U559_CAJCA/10-175                ...............................................KSIRGTNPQNLVEKILRSKIYQ..N.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHLGG..............-TYG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKE..........IVI.EFIK......................................................NEDYK..YVRILGAF....Y...L.....RLTGS........................DIDV....YR.YLE.....PL..YNDYR.KLRRKLPDG...................-----....QFALTHVDEVID.ELL.......TKDYS...CD..I..ALPRVKRRWTLES--lg...................................................................
A0A194PRK7_PAPXU/22-206                ..............................................l-PIWGNEQTMNLNPLILANIQG..S.SY.FKVHLFKLKT................................YHEVVDEIYYQ..VKHLEP..............WERG.SRKtagqtgmcg...........................gvrgvgaggIV.STAFCLLYKL.YTLRLTRK..........QVN.GLLQ......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PADL....FD.WYV.....DY..LDDEE.---------...................EIDPRa..gGGGPTTIGALVR.QML.......IKLDW...FS..T..LFPRIPVPIQKQIE-q....................................................................
A0A067P368_PLEOS/10-173                ..............................................k-AIHGQNPQFLVENVIRNRIYE..S.SY.WKEYCFALTA................................-ETLIDKAIE-..IKFIGG..............-VYG.NQR.............................................-P.TEFLCLLLKL.LQIQPEKE..........ILI.EYLQ......................................................AEEFK..YLRALAAL....Y...V.....RMTFS........................AVDV....YE.ILE.....PL..LKDYR.KLRNRNMAG...................-----....-YSLTFMDEFVY.SLL.......TEERV...CD..I..ILPRLQKRSVLEER-g....................................................................
K3W962_PYTUL/10-174                    ..............................................q-SIHGVNPQHLIEKIMRNRIYA..S.VY.WKEQCFGLTS................................-ETLVDKAIE-..LNYFGG..............-TFG.GNQ.............................................QP.TPFLCLLLKM.LQLQPELE..........VVR.EFIQ......................................................NEEYK..YVSVLGAV....Y...L.....RLVGK........................PLEI....YS.ILE.....PM..YSDYR.KIRKRNVIG...................-----....-WEITHIDEIVD.ALL.......FEEYY...ID..L..ALPRMVDREF-----yekng................................................................
A0A087SCL4_AUXPR/45-210                ............................................eqy----GNTSTYNLENVLRQNILT..S.TY.YQKTAVPIEQ................................WQDLVDEIYYS..VDHVEP..............WMSG.NAR.............................................GP.STAFNLLYRL.GQLKPTPK..........ELR.MMLD......................................................HKDSP..YIRAVGFL....Y...L.....RYTCN........................PRYL....WE.WVK.....DY..LEDAE.---------...................EFTPSp.pgWGHSVTMGCFLR.DIL.......LDQYY...FE..T..IFPRIPTKVTD----evl..................................................................
B7QBZ1_IXOSC/10-175                    ..............................................h-SVRGTNPQYLIEKIIRSRIYD..S.RY.WKEECFALTA................................-ELLVDKAME-..LKFIGG..............-VYG.GNV.............................................KP.TPFLCLLLKM.LQIQPEKD..........IVV.EFIR......................................................QEDFK..YVRALGAN....Y...M.....RLVGS........................SLDC....YK.YLE.....PL..YNDYR.KLRRQNRDG...................-----....TFAIVHMDELID.ELL.......REERA...AD..V..ILPRIQKRHVLEET-n....................................................................
M3Y690_MUSPF/10-175                    ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A0W8E100_PHYNI/40-203                .............................................yt---YGNDTTYNLNTLLHQNILQ..S.AY.FH-ELYKFRT................................YHEVVDEIYYR..VDHAEP..............WSPG.TAR.............................................IP.SSCFCLLHKF.FLMRLTRK..........QMQ.GLLR......................................................HTDSP..YIRAVGFL....Y...L.....RFTCD........................PEEL....WT.WFE.....PF..LEDPE.---------...................EFNASa..nPSVKTTIGEWLI.SLL.......EENNY...FG..T..ILPRIPKKIE-----dgik.................................................................
A2G7A6_TRIVA/40-204                    .............................................ky--VRGVAPQHLIDTSTRHRIYN..S.VY.WQQHCFGVNL................................-LTLVDRAQS-..LKGVGG..............-VYG.LFR.............................................EP.CNFICLFLKL.LELEPSKK..........VIE.GFLNt....................................................kSWQMK..HLRLLAAL....Y...V.....RFVFP........................AEEV....YL.ILE.....GL..LGQYF.KVAVLREEG...................-----....-FKVEYFDTVIY.SFL.......HDKFW...CG..I..TFPPLTPRNNL----pp...................................................................
K4B140_SOLLC/10-175                    ...............................................KSIRGTNPQNLVEKILRSKIYQ..N.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHLGG..............-TFG.GNR.............................................KP.SPFICLVMKM.LQIQPEKD..........IVV.EFIK......................................................NEDYK..YVRVLGAF....Y...L.....RLTGT........................DIDI....YR.YLE.....PL..YNDYR.KLRRKSADG...................-----....QYALTHVDEYID.ELL.......TTDYS...CD..I..ALPRIKKRWILEQN-k....................................................................
A0A0V0Z8G5_9BILA/10-175                ..............................................a-SLKGTNPQYLIEKVTRSRIYD..S.RY.WKEECFALSA................................-ELLVDRGME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLLLKM.LQIQPEKD..........IVI.EFIR......................................................QEDSK..YIRALGAL....Y...L.....RMTFS........................YVEV....YK.YLE.....PL..LNDYR.KLRWINKQG...................-----....KFELIHMDEFVD.KLL.......REERF...CD..V..QLPRLQKRAFLEE--tn...................................................................
A0A165Y4A4_9HOMO/10-173                ..............................................l-AIHGQNPQYLVETVIRNRIYE..S.QF.WKEHCFALTA................................-ETLIDKAIE-..LRYIGG..............-VYG.NQR.............................................-P.TEFICLLLKL.LQIQPEKE..........ILI.EYLQ......................................................ADEFK..YLRALAAL....Y...I.....RMTFR........................PVDV....YE.LLE.....PL..LKDYR.KLRLRDMAG...................-----....-YSLTFIDEFVD.QLL.......NEERT...CD..I..ILPRIQKRQILEEN-g....................................................................
E9QD55_DANRE/25-170                    ..............................................l-PLWGNEKTMNLNPMILTNVLS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VNHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HSDSP..YIRALGFM....Y...I.....RYTQP........................PPDL....VD.WYD.....EF..LDDEE.V--------...................-----....------------.---.......-----...--..-..---------------crhgs................................................................
A0A026WAG5_CERBI/37-224                ..............................................l-PLWGNERTMNLNPLILTNIQS..S.HY.FKVNLYELKT................................YHEVIDEIYYK..VSHLEP..............WEKG.SRKtagqtgmcggr.......................fmqvrgvgaggIV.STAYCLLYKL.FTLRLTRK..........QLN.GLIN......................................................HPDSP..YIRALGFM....Y...I.....RYTQP........................PADL....FT.WYS.....DY..LEDEE.---------...................ELDVKa..gGGQTMKMGDILK.QFL.......TKLEW...FS..T..LFPRIPVPIQKD---le...................................................................
A0A0K9RIM5_SPIOL/10-174                ...............................................KSIRGTNPQNLVEKIVRSKIYQ..N.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHVGG..............-TYG.GNR.............................................KP.SPFMCLVMKM.LQIQPEKD..........IVV.EFIK......................................................NEDYK..YVRILGAF....Y...L.....RLTGT........................DSDI....YL.YLE.....PL..YNDYR.KLRMRKPDG...................-----....QYLLTHVDEFID.ELL.......TKDYS...CD..I..AMPRIKKRWNLEN--i....................................................................
A0A061J015_TRYRA/27-195                .............................................wn--LKGRSAVAALDPTTRHRILQ..S.HA.MT-SCVHKPL................................-LATIEALIT-..LRCVGG..............-LSG.PLR.............................................RP.EPFICHVTRL.LQITPDPS..........VVL.AMLH......................................................QDVHK..YLRVAALF....V...I.....RLIGN........................DAMM....RE.AMR.....VG..WDDYR.KIRVYGYMEdwggttc.....akdsaapE----....------------.---.......-----...--..-..---------------eeeegfvpspsygimcvdqitdrlfnv..........................................
A0A091R870_MERNU/1-109                 ...............................................----------------------..-.--.----------................................-----------..------..............----.---.............................................-P.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HEERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A0V0UWK2_9BILA/578-761               ..............................................l-NFWGNKETMNLNHLVLENIVS..S.PY.YKNTLLPLKT................................HFEVIDEIYYN..VEHLEP..............WEKG.TRKttgqtgmcg...........................gvrgvgaggVV.SSAFCLLYKL.FTLKLTRK..........QLT.AILN......................................................HPDSC..YIRGLGFM....Y...I.....RFCLH........................PATF....WS.WYE.....PY..FDDSE.---------...................EIDPKa..gGGDLMTIGEMVK.SLL.......TKLDW...YS..T..LFPRIPVPIQKEI--d....................................................................
A0A183HLN6_9BILA/1-124                 ..............................................m----------------------..-.--.----------................................----------E..LRYIGG..............-IYA.GNV.............................................KP.TPFLCLCLKM.LQIQPEKD..........IAV.EFIR......................................................QEEYK..YIRALGAM....Y...I.....RLTFT........................SIEV....YK.YLE.....PL..YNDYR.KLRMMNNEG...................-----....RFEIVHMDEFID.NLL.......REERY...CD..I..HLPRIQKRITLEE--vg...................................................................
A0A176VPQ7_MARPO/10-175                ..............................................r-SVHGTNPQNLVEKILRSKIYQ..N.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHFGG..............-TFG.GNR.............................................KA.TPFMCLILKM.LQIQPEKE..........IVV.EFIK......................................................NEDYK..YVRILGGF....Y...L.....RLVGK........................PTDV....YH.YLE.....PL..YNDYR.KLRRKNADG...................-----....SFSLDHVDEFID.ELL.......TKDYS...CD..I..ALPRVPKRWTLE---gsg..................................................................
A0A165D0E2_9BASI/10-173                ..............................................t-SVHGTNPQYLIETVIRSRIYE..S.LY.WKEQCFALTA................................-ETLIDKAIE-..LNSIGG..............-VYG.NQR.............................................-P.THFMCLLLKL.LQIQPEKE..........ILI.EYLL......................................................VDEFK..YLRALAAL....Y...I.....RLVFR........................PSEV....FE.LLE.....PL..LKDYR.KLRVRNMSG...................-----....-YALTYMDEYVD.ELL.......REERV...CD..I..ILPRMTKREVLEE--ve...................................................................
M8A466_TRIUA/3-166                     ............................................iqt---SGKPIDMLMEKVLCMNILS..S.DY.FK-ELYRMKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKIL....WT.WYE.....PY..LKDDE.---------...................EFSPG...sNGRMTTMGVYVR.DLI.......LGQYY...FD..S..ILPRVPVPVV-----rqvt.................................................................
A0A061GA69_THECC/5-76                  ............................................hig----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...L.....RLTGT........................DIDV....YR.YLE.....PL..YNDYR.KLRQKSPDG...................-----....NFSLTHVDEVID.ELL.......TRDYS...CD..I..ALPRIKKRWTLES--lg...................................................................
A0A0D9ZUW6_9ORYZ/3-166                 ............................................iqt---SGKPIDLLMEKVLCMNIMS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKIL....WT.WYE.....PY..LKDDE.---------...................EFSPG...sNGRMTTMGVYVR.DLI.......LGQYY...FD..S..LLPRVPLPV------irqvt................................................................
A0A0E9NPH2_9ASCO/27-194                .............................................ln--YHGINPALLIEKIIRERILD..S.LY.YKDACFALTS................................-STILDRIVA-..LTYIGG..............-QYG.AQ-.............................................KP.TEFLCLVFKL.LQLQPEKE..........IVV.EMLKsd..................................................dgGEEWK..YLRAVAAF....Y...V.....RLTFP........................AREV....YE.LLE.....PF..YADYR.KLRVRHLGG...................-----....-WSLTTMDQFVD.ELL.......REERV...CD..I..ALPRIPTRMMLEE--ag...................................................................
A0A0E0PTE3_ORYRU/4-158                 ........................................qssgrpi--------DVLMEKVLSVNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.SSAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAVGFL....Y...L.....RYVAE........................PKTL....WS.WYE.....PY..IKDDE.---------...................EFSPG...sNGKMTTMGVYVR.DLL.......L----...--..-..---------------gqcplvtqaplwa........................................................
A0A081CIH8_PSEA2/10-174                ..............................................v-SIHGTNPQFLVEKPVRARIYE..S.PF.WKEHCFALSA................................-ATLLPLAVD-..LHHVGG..............-LTG.-LQ.............................................RP.SHFLCLLQKL.LQIQPEPA..........IVD.AYLA......................................................AKEFK..YLRVLAAF....Y...V.....RLTFA........................SSDV....YA.RLE.....PM..LEDYS.KLRWRDAGG...................-----....AYSVVHMDEVVD.MLL.......REERV...CD..I..ILPRLTRRDVCEA--rd...................................................................
A0A016STM2_9BILA/62-272                ..............................................l-PIWGNQQTMNLNGLVLENVKE..S.YY.YKNHLVEIDS................................AQQLLDEVFYK..VKHLEP..............WEKG.TRKvqgmtgmcg...........................gvrgvgaggVV.SSAFCLLYRF.FKVRLTRK..........QLI.SMIN......................................................SRVSP..YIRGLGFM....Y...I.....RYTQP........................PADL....WE.WFE.....PY..LVGCL.--SSIGKGNygfplstidahpffkddeeEIDPRs..gGGDIMTFGQVVR.IML.......TKLDW...YG..T..LFPRIPVPIQKEID-e....................................................................
A0A0V0S2D9_9BILA/10-175                ..............................................a-SLKGTNPQYLIEKVTRSRIYD..S.RY.WKEECFALSA................................-ELLVDRGME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLLLKM.LQIQPEKD..........IVI.EFIR......................................................QEDSK..YIRALGAL....Y...L.....RMTFS........................YVEV....YK.YLE.....PL..LNDYR.KLRWINKQG...................-----....KFELIHMDEFVD.KLL.......REERF...CD..V..QLPRLQKRAFLEE--tn...................................................................
A0A0B2V767_TOXCA/180-345               .............................................vt--VKGTNPQYLVEKIIRTRIYD..S.KY.WKEECFALTA................................-ELVVDKGME-..LRYVGG..............-IYA.GNV.............................................KP.TPFLCLSLKL.LQIQPEKD..........IIV.EFIR......................................................QEDYK..YIRALGAM....Y...L.....RLTFS........................SIEV....YK.YLE.....PL..YNDYR.KLRYMNKEG...................-----....RFELIYMDEFID.NLL.......RQERY...CD..I..QLPRLQSRQALEE--ig...................................................................
S9XEH7_SCHCR/14-177                    .............................................dv--VHQMLPTFLVGKILRERIVE..S.FY.WKEQCFGLNA................................-ASLIDRAVR-..LEYIGG..............-QFG.NQ-.............................................RP.TEFICLLYKL.LQVAPEKE..........IVL.EYLS......................................................IPEFK..YIRALAAF....Y...I.....RLTWP........................DPDV....YQ.ALE.....PL..LNDYR.KLRVRDHNG...................-----....-FYVSHMDEFID.DLL.......NEETV...CD..V..TLPPLMSRYQLEEL-d....................................................................
W4ZVL3_WHEAT/3-166                     ............................................iqt---SGKPIDMLMEKVLCMNILS..S.DY.FK-ELYRMKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKIL....WT.WYE.....PY..LKDDE.---------...................EFSPG...sNGRMTTMGVYVR.DLI.......LGQYY...FD..S..ILPRVPVPVV-----rqvt.................................................................
E9IDC1_SOLIN/82-265                    ..............................................l-PLWGNERTMNLNPLILTNIQS..S.HY.FKVNLYELKT................................YHEVIDEIYYK..VSHLEP..............WEKG.SRKtagqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.FTLRLTRK..........QLN.GLIN......................................................HPDSP..YIRALGFM....Y...I.....RYTQP........................PADL....FS.WYS.....DY..LEDEE.---------...................ELDVKa..gGGQTMKMGDILK.QFL.......TKLEW...FS..T..LFPRIPVPIQKD---le...................................................................
A0A0N0P7I3_LEPSE/4-150                 .............................................sl---KGRAPIAAFDPPTRHRILN..S.HI.MT-RCTNKPL................................-LWVLEELCN-..LRSLGG..............-LTG.PLH.............................................SV.DYFICLVARL.LQICPAPA..........VVR.VMLE......................................................QEVHK..YMRAAALV....L...I.....RLIGS........................VDFQ....KE.ALR.....IG..WDDYR.KLCLYGKAP...................-----....------------.---.......-----...--..-..---------------aqewkestadaaaptataegh................................................
A0A0V1CJ22_TRIBR/10-175                ..............................................a-SLKGTNPQYLIEKVTRSRIYD..S.RY.WKEECFALSA................................-ELLVDRGME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLLLKM.LQIQPEKD..........IVI.EFIR......................................................QEDSK..YIRALGAL....Y...L.....RMTFS........................YVEV....YK.YLE.....PL..LNDYR.KLRWINKQG...................-----....KFELIHMDEFVD.KLL.......REERF...CD..V..QLPRLQKRAFLEE--tn...................................................................
A0A010R8A1_9PEZI/24-191                ............................................lap---NGENPATIMEKAVRERIID..S.YF.YKEQCFAVNE................................-ADIVDRVVEH..VTFIGG..............-TSG.VTQ.............................................KP.TPFLCLAFKL.LQLAPSDE..........VLE.TYLGf....................................................gGDKFK..YLRALACF....Y...V.....RMTRK........................AKDV....YL.LLE.....PF..LEDRR.KLRRKGRAG...................-----....-TSLTFMDDFVD.DLL.......TKTRV...CA..T..SFRELPKRVDLVD--lg...................................................................
A0A0N0DS04_9TRYP/4-156                 ..........................................nlkgr------AAIAAFDPPTRYRILN..S.HT.MT-RCTNKPL................................-LWVLEELCN-..LRSLGG..............-LAG.PLH.............................................AA.DHFICLVARL.LQICPAPA..........IVR.VMLE......................................................QEVHK..YMRAAALV....L...I.....RLIGS........................ASFQ....KE.ALR.....IG..WDDYR.KLCLYGSDP...................-----....------------.---.......-----...--..-..---------------aqewaestttadadtatghantlsssl..........................................
A0A166SWN1_9HOMO/10-173                ..............................................l-SIHGVNPQSLVETVIRNRIYE..S.GF.WKEHCFALTA................................-ESIIDKSIE-..LRCIGG..............-VYG.NQR.............................................-P.TEFLCLLLKL.LQIQPEKE..........ILV.EYLQ......................................................ADEFK..YLRAVAAF....Y...V.....RLTFR........................AVDV....YE.ILE.....PL..LKDYR.KIRYRDMAG...................-----....-YTLTYMDEFVN.QLL.......TEERV...CD..I..ILPRMAKRQTLEEN-g....................................................................
A0A067MDA3_9HOMO/10-173                ..............................................l-SIHGTNPQFLIEKVIRSRIYE..L.PF.WKEHCFTLTA................................-ESLIDKAIE-..LNSIGG..............-VYG.N-Q.............................................KP.TQFKCLLLKL.LQIQPEKE..........ILV.EYLQ......................................................AEEFK..YLRALVAM....Y...I.....RMTFR........................AVEV....FQ.LLE.....PL..PIDFR.KLRERSMAG...................-----....-YTLTYMDEFVY.ALL.......TEERI...CD..T..ILPRITKRGVLEET-e....................................................................
C9S9P5_VERA1/26-193                    ............................................lap---NGENPAKIMEKAVIGRIVD..A.QY.FQYQCFALNE................................-AGIVDRVVND..VKFIGG..............-TYG.SAQ.............................................KP.TPFLCLAFKL.LQLAPSDA..........VLE.MYLSf....................................................gGDKFK..YLRALACF....Y...I.....RMTRR........................AKDV....YA.ILE.....RY..LVDRR.KLRRKGRQG...................-----....-TSLTFVDEFVD.DLL.......TKTRV...CA..T..SFRELPRRTDLVD--lg...................................................................
W9YWJ5_9EURO/19-185                    .............................................pl--IRGQNPALLFETPMRDRITD..S.LY.WKEQCFGLNA................................-ATLCDRAVE-..LTYIGG..............-TYG.VAM.............................................KP.TPFICLAFKL.LTLVPDKE..........IIL.EYLKn....................................................gGEEWK..YLRALAAF....Y...V.....RLTFD........................PADI....YK.TLE.....PL..LEDYR.KLRLRRRET...................-----....-YELIHVDEFVD.NLL.......TKERV...CG..T..SLWKLPGRQLLEDL-d....................................................................
A0A0C3JVJ5_PISTI/10-173                ..............................................l-AIHGQNPQFLVETVIRNRIWE..S.VY.WKEHCFALTA................................-ESLIDKAIE-..LRYIGG..............-VYG.NQ-.............................................HP.TEFLSLLLKL.LQIQPEKE..........ILI.EYLQ......................................................ADEFK..YMRALAAM....Y...I.....RMTFR........................AVEV....YE.ILE.....PL..MKDYR.KLRYRDMAG...................-----....-YSLIFFDEFIY.QLL.......SEERV...CD..I..ILPRLPKRQILEE--sg...................................................................
B6QEC1_TALMQ/21-208                    ..............................................l--VRGVNPVTLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAIE-..LTSIGG..............-TYG.LSQ.............................................KP.TPFLCLAFKM.LQLAPEKD..........IVL.EYLNftdpgsgddenp..............................edaeingevvkgRGDFK..YLRALAAF....Y...I.....RLTFE........................AAEI....YK.YLE.....PL..LLDYR.KLKRRMREN...................-----....-YVLTNMDQFID.DLL.......TKDRV...CA..T..SLWKLPSRQMLEDL-d....................................................................
F4PZZ0_DICFS/118-283                   ...............................................KTIHGTHSRNLIEKILRIKIQS..H.PY.WKEKCMGLNE................................-ETLVDRAMA-..LTSFGG..............-TWG.GMK.............................................QP.THFICLMLKM.LQIQPDKD..........III.EFIT......................................................NQDFK..YVRILGAF....Y...L.....RLVGK........................PVDI....YN.YLE.....PL..YNDYR.SVRMKNDLG...................-----....QFNKIHVDEFVQ.ELL.......TGNYA...CE..I..VLPNLPSRRTLEQQ-g....................................................................
A0A0N0PD08_PAPMA/10-175                ...............................................KSIRGTNPQYLVEKIIRSRIYD..C.KY.WKEECFALTA................................-ELLVDKAME-..LRYVGG..............-VHG.GFI.............................................YP.TPFLCLVLKM.LQIQPEKD..........IVV.EFIK......................................................NEEFK..YVRALGAF....Y...M.....RLTGT........................SVDC....YK.YLE.....PL..YNDNR.KLRRQNRQG...................-----....QFEIVHMDEFID.ELQ.......REERL...CD..V..ILPRIQKRHILEEN-n....................................................................
H3FY63_PRIPA/61-245                    ..............................................l-PVWGNQKTMNLNGLVLENVLQ..C.TY.YKQVLAECST................................YQQIVDEIYMH..VRHLEP..............WEKG.TRKvqgmtgmcg...........................gvrgvgaggVI.SSAFCLLYKL.FNIRITRK..........QLV.SMIN......................................................SNQSA..YLRGMGFM....Y...I.....RFCQP........................PSDL....WN.WLE.....PY..LDDED.---------...................TVDPRs..gGGDELTFGQIAR.MML.......TKLDW...YG..T..LFPRIPVPIQKDID-e....................................................................
A0A0M9VVN1_9HYPO/25-192                ............................................lap---NGLNPANIMEKAVKDRIVD..S.YF.YKEQCFALNE................................-ADIVDRVVEH..VSFIGG..............-THG.AAQ.............................................RP.SPFLCLAFKL.LELGPSDD..........IVR.EYLGh....................................................gGDEFK..YLRALACF....Y...V.....RLTRQ........................AKDV....YT.MLE.....PY..LEDRR.KLRRRGRAG...................-----....-TRLSYVDEFVD.ELL.......VGDRV...CA..T..SLWKMPKREVLEDL-e....................................................................
A0A165Q648_9APHY/10-173                ..............................................e-AIHGQNPQYLVETVIRNRIYE..S.PY.WKEHCFALTA................................-ESLIDKAIE-..LKCIGG..............-VYG.N-Q.............................................KP.TEFLCLLLKL.LQIQPQKE..........ILL.EYLQ......................................................ADEFK..YLRALSIM....Y...I.....RMTFR........................SVEV....YE.ILE.....PL..LKDYR.KLRYRGMNG...................-----....-YSLTYIDEFVD.NLL.......VEERV...CD..I..ILPRLTKRDVLEDN-g....................................................................
D8SIA1_SELML/5-138                     ...........................................vqtc----GKPIQTLVEHVVNVNILS..S.EY.FK-ELYRLKT................................FHEVVDEIYNH..VAHVVP..............WMTG.NSR.............................................GP.SPAFCLLCKF.FTMKLTDE..........QVQ.EFLN......................................................HADSP..YVCALFSFvapvF...L.....RYYGD........................PSTL...fWQ.WFK.....PY..IEDDE.---------...................-----....------------.---.......-----...--..-..---------------myvnpikl.............................................................
Q8SUF7_ENCCU/2-164                     ...........................................qykg-----------INRMTREKILG..S.EE.FK-RMRSFTH................................-ADVIQSICS-..LDSIGG..............LIRG.T--.............................................-P.HKFLCLVQKM.GATSLSED..........AVA.VDLAnlkplepk......................................plgspaemFHGNV..YFIAASLF....Y...L.....RLSKR........................FHKY....RP.LIG.....LF..LADFR.KIPVVDGQN...................-----....NRTFMYLDVLAD.DLL.......NKSRI...FN..V..HLSR-----------ad...................................................................
I1HL97_BRADI/3-166                     .............................................iq--TSGKPINMLMEKVLCMNILS..S.DY.FK-ELYRMKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKVL....WT.WYE.....PY..LKDDE.---------...................EFSPG...sNGHMTTMGVYVR.DLI.......LGQYY...FD..S..ILPRVPVPVI-----rqvt.................................................................
S9YKY6_CAMFR/13-80                     ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRK.............................................TA.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------gqtgmcg..............................................................
G3WWZ2_SARHA/30-174                    ............................................svq----------------------..-.--.----------................................-------VVQ-..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
A0A0C9M8H9_9FUNG/20-185                ..............................................l--VRGQNPLTLIDAPLRDRITE..S.YY.WKEQCFGLNA................................-ATLLDRAVE-..LSYVGG..............-TYG.VAQ.............................................KP.TAFLCLLFKM.LQLVPGKD..........IVG.EYIAr....................................................gGEEWK..YLRALAAL....Y...V.....RLTGE........................ARDV....YT.TLE.....PY..LADAR.KIKRRTREG...................-----....-FKLSFVDEFVD.DLL.......TKDRV...CG..I..SLWKMPARTLLEDT-d....................................................................
M3XUF9_MUSPF/49-233                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
R4X9K4_TAPDE/21-184                    ..............................................t-TVHGVNPAFLIEKITRERILD..S.LY.FKDQCFGLTA................................-STVLDRVVG-..LTYIGG..............-IYS.-IG.............................................RP.TEFICLVFKM.LQLAPEKD..........IIL.HYLH......................................................DDEFK..YLRALAAL....Y...V.....RLVFS........................PKDV....YL.TLE.....PL..LTDYR.KLKVRGQNG...................-----....-FRLDYMDNFID.QLL.......TEPRV...FD..I..ALPNLMSRPLLEDL-d....................................................................
E2BCA0_HARSA/10-175                    ...............................................KSIRGTNPQYLVEKIIRSRIYD..S.KY.WKEECFALTA................................-ELLVDKAME-..LRYIGG..............-VYG.GNV.............................................KP.TPFLCLILKM.LQIQPEKD..........IIV.EFIK......................................................NEEFK..YVRALGAL....Y...M.....RLTGS........................SLDC....YK.YLE.....PL..FNDNR.KLRMQNKQG...................-----....VYELIHMDEFID.NLL.......REERS...CD..V..ILPRIQKRHVLEEN-n....................................................................
E4XHG4_OIKDI/82-282                    ..............................................l-PVHGNERTMNLNHMVLANITE..S.AY.FRCDLLQIKT................................YDEMIDEIYYK..VTHLEP..............WEKG.SRKhftgsatgaergmayss...........ipgvqnyvgvrgvgqggIV.STPFCCLYKL.WTIKLTRK..........QVE.LMCD......................................................HVDSP..FIRGLGFL....Y...L.....RFSLP........................PQNL....LE.FLQ.....PY..FNDQE.---------...................EVDPKa..gGGDPMTMGALIL.AML.......EENHW...YG..T..MLPRIPAKHLQEI--rr...................................................................
H3B6U1_LATCH/36-219                    ..............................................l-PLWGSEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VAHIEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....PF..LDDEE.---------...................ELDVKa..gGGCIMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKN---ld...................................................................
A0A016ST41_9BILA/62-272                ..............................................l-PIWGNQQTMNLNGLVLENVKE..S.YY.YKNHLVEIDS................................AQQLLDEVFYK..VKHLEP..............WEKG.TRKvqgmtgmcg...........................gvrgvgaggVV.SSAFCLLYRF.FKVRLTRK..........QLI.SMIN......................................................SRVSP..YIRGLGFM....Y...I.....RYTQP........................PADL....WE.WFE.....PY..LVGCL.--SSIGKGNygfplstidahpffkddeeEIDPRs..gGGDIMTFGQVVR.IML.......TKLDW...YG..T..LFPRIPVPIQKEID-e....................................................................
A0A0D8Y6S7_DICVI/41-225                ..............................................l-SCWGNQQTMNLNGLVLENVKE..S.YY.YKNHLVEIDS................................AQQLLDEVFYK..VKHLEP..............WEKG.TRKvqgmtgmcg...........................gvrgvgaggVV.SSAFCLLYRF.FKVRLTRK..........QLI.SMIN......................................................SRVSP..YIRGLGFM....Y...I.....RYTQP........................PADL....WE.WFE.....PY..LDDEE.---------...................EIDPRs..gGGDVMTFGQVVR.IML.......TKLDW...YG..T..LFPRIPVPIQKDID-e....................................................................
A0A0D2F1Q1_9EURO/19-185                .............................................pl--IRGQNPALLLETAMRDRITD..S.LY.WKEQCFGLNA................................-ATLCDRAIE-..LTYIGG..............-TYG.VAM.............................................KP.SPFICLAFKL.LTLVPDKE..........IIL.EYLTy....................................................gGEEWK..YLRALAAF....Y...V.....RLTFD........................AADI....YK.TLE.....PF..LEDSR.KLRQRRKES...................-----....-YVLIYMDEFVD.NLL.......TKDRV...CG..T..SLWKLPARQLLEDL-d....................................................................
A0A0L7LKK1_9NEOP/22-89                 ..............................................l-PVWGNEQSMNLNPLILANIQG..S.SY.FKVHLFKLKT................................YHEVVDEIYYQ..VKHLEP..............WERG.SRK.............................................TA.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------gqtgmcg..............................................................
G4U7T3_NEUT9/24-191                    ............................................lap---NGLNPATIMEKAVRERIID..S.YF.YKEQCFGVNE................................-ADIVDRVVEH..VDFIGG..............-VYG.TVQ.............................................KP.SPFLCLAFKL.LQLAPSDD..........ILN.EYLQf....................................................gGEKFK..YLRALALF....Y...I.....RLTRK........................DQDV....YK.TLE.....PF..LEDRR.KLRRKGRNG...................-----....-TSLTYMDVFVD.DLL.......TKDRV...CA..T..SLWKMRKRDILEDL-d....................................................................
PRP38_YEAST/15-219                     ...............................................KQLNNQSVSLVIPRLTRDKIHN..S.MY.YKVNLSNESLrg............................ntMVELLKVMIGA..FGTIKGqng.......hlhmMVLG.GIE.............................................--.--FKCILMKL.IEIRPNFQ..........QLN.FLLNvk.................................................nenGFDSK..YIIALLLV....Y...A.....RLQYYylngn.............nkndddENDL....IK.LFKvq.lyKY..SQHYF.KLKSFPLQVdc...............faHSYNE....ELCIIHIDELVD.WLA.......TQDHI...WG..I..PLGKCQWNK------iynsde...............................................................
I1F795_AMPQE/2-83                      .............................................lc----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................---SK..YVRALGAL....Y...L.....RIVGT........................SVEC....YK.YLE.....PL..YNEYR.KIKYKNRQG...................-----....KFELSHVDEFVD.SLL.......REDRV...CD..V..ILPRIQKRHILEET-e....................................................................
A0A096MBN3_POEFO/10-175                ..............................................n-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LKFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRLLGAM....Y...M.....RLTGT........................AVDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HAERV...CD..I..ILRMLQKRQVLEEA-e....................................................................
W6KQG9_9TRYP/3-189                     .............................................fn--LKGRQAVASLDPATRYRITR..S.QA.MS-QCANKPL................................-LWVLEELTS-..VVAVGG..............-LSG.SLH.............................................KV.EYFLCLLTRL.LQIGPSPD..........IVL.AMLR......................................................QELHK..YVKVAALF....I...I.....RFIGN........................DIMV....QE.AVK.....LG..LDDYR.KIRVYGSDE...................-----....------------.---.......-----...--..-..---------------tpvtlfvtpgvkrprdmdesnhelpvgnqentdvmesrepphyfilkmdelterlfqlnq.........
M0U4G2_MUSAM/3-166                     ..........................................iqtsg-----RPIDTLLEKVLSMNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKTL....WT.WFE.....PY..IKDGE.---------...................EISPG...sNGRLTTMGIYVR.DLL.......LGQYY...FD..T..LFPRIPIPVMR----qiv..................................................................
A0A0G4IHW0_PLABS/154-314               ............................................cda--------HFNFNNILATNILS..S.EY.FK-DLFQYRR................................FHEVLNEVRNK..VTHLEA..............LTIG.QTR.............................................LP.STAFCLLYKL.LTMKLTVR..........QMG.AMLS......................................................DTKPP..FMRGIALL....Y...L.....RFVHP........................PKKL....WA.WFA.....PL..LDDTT.---------...................EFSPSg..pSAPTCTLGEFAK.RLL.......LDLNY...PG..T..ILPRIPIPVHRE---ykk..................................................................
A0A0N5CN93_THECL/1-176                 ...............................................---------MNLNALVLENIIQ..C.TY.YKNYLSDTTG................................FQQLTEEIYYN..VKHLEP..............WERG.TRKtqgmtgmcg...........................gvrgvgaggVV.STAFCLLYKL.FTIRLTRK..........QLV.SMIN......................................................NRDSP..YIRGIGFM....Y...I.....RFCQP........................PQDL....WA.WME.....PY..LDDEE.---------...................QIDPRs..gTGDMMAMAQVVK.MML.......TKLDW...YG..T..LFPRIPVPIQRID--eh...................................................................
A0A0V0XEX3_TRIPS/10-175                ..............................................a-SLKGTNPQYLIEKVTRSRIYD..S.RY.WKEECFALSA................................-ELLVDRGME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLLLKM.LQIQPEKD..........IVI.EFIR......................................................QEDSK..YIRALGAL....Y...L.....RMTFS........................YVEV....YK.YLE.....PL..LNDYR.KLRWINKQG...................-----....KFELIHMDEFVD.KLL.......REERF...CD..V..QLPRLQKRALLEET-n....................................................................
A0A026WC55_CERBI/10-175                ...............................................KSIRGTNPQYLVEKIIRSRIYD..S.KY.WKEECFALTA................................-ELLVDKAME-..LRFIGG..............-VYG.GNV.............................................KP.TPFLCLILKM.LQIQPEKD..........IIV.EFIK......................................................NEEFK..YVRALGAL....Y...M.....RLTGS........................SLDC....YK.YLE.....PL..FNDNR.KLRLQNKQG...................-----....AFELIHMDEFID.NLL.......KDERS...CD..V..ILPRIQKRHVLEEN-n....................................................................
A0A0E0PTE4_ORYRU/4-157                 ........................................qssgrpi--------DVLMEKVLSVNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.SSAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAVGFL....Y...L.....RYVAE........................PKTL....WS.WYE.....PY..IKDDE.---------...................EFSPG...sNGKMTTMGVYVR.DLL.......L----...--..-..---------------gqcplvtqaplw.........................................................
A0A074SWX5_HAMHA/10-175                ..............................................q-QVHGCNPQTLVSRIIRRKIYE..S.VF.WKEQCFALTA................................-ETVLEPCVG-..LTYVGG..............-TYG.GKR.............................................QP.APFLCLVLKL.LQIQPEPE..........IIL.EFIK......................................................QEQFK..YLRAVGAF....Y...L.....RLVGR........................ACEV....YT.HLE.....PL..LADYR.KLRLRLADG...................-----....KFTIVCMDEFVD.DCL.......RKTNF...LD..V..DLPVLPKREVLENE-g....................................................................
A0A078JU74_BRANA/10-175                ...............................................KNIRGTNPQNLVEKIVRTKIYN..H.TF.WKEQCFGLTA................................-ETLVDKAME-..LDHVGG..............-TFG.GNR.............................................KP.TPFLCLILKM.LQIQPEKE..........IVV.EFIK......................................................NDDYK..YVRILGAF....Y...L.....RLTGS........................DVDV....YR.YLE.....PL..YNDYR.KVRQKLSDG...................-----....RFSLTHVDEVIE.ELL.......TKDYS...CD..I..AMPRLKKRWTLEQN-g....................................................................
K7HSD9_CAEJA/1-166                     ..............................................k-TVKGTNPQFLVEKIIRQRIYD..S.MY.WKEHCFALTA................................-ELVVDKGMD-..LRYIGG..............-IYA.GNI.............................................KP.TPFLCLALKM.LQIQPDKD..........IVL.EFIQ......................................................QEEFK..YIRALGAM....Y...L.....RLTFE........................STEI....YK.YLE.....PL..YNDFR.KLRFMNKMG...................-----....RFEAIYMDDFID.NLL.......REDRY...CD..I..QLPRLQKRWALEE--vd...................................................................
R9ACJ1_WALI9/10-173                    ..............................................s-SIHGRNPQHLIENVIRQRVYE..S.AF.WKEQCFALTA................................-ETIIDKAVE-..MQSIGG..............-VYG.NAR.............................................-P.LPFMCLLLKL.LQLQPERE..........IIF.EYLQ......................................................AEEFK..YLRALAAM....Y...T.....RLCFK........................SFEV....FD.ILE.....PL..LQDYR.KLRLRNNSG...................-----....-YHITHMDQFID.ELL.......TEERV...CD..I..ILPRLTRRDVLEE--ve...................................................................
G1XLI7_ARTOA/22-185                    .............................................pt--IHSMNPLLLMEKIIRERIID..S.MY.WKEQAWGLNA................................-ATLLDRAVE-..LQFIGG..............-QY-.ANQ.............................................KP.TPFICLILKM.LQLNPERE..........ILL.EYVQ......................................................DEDFK..YLRVLAAF....Y...I.....RLAWP........................AAEI....YK.TLE.....PL..MADYR.KIRLRTQSG...................-----....-YKLTFVDEFID.ELL.......TKERV...CD..I..ALPRMPTRAQLEDM-d....................................................................
C8VB07_EMENI/21-212                    ..............................................l--VRGLNPAMLFEKAVRDRITE..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LTFIGG..............-TYG.VSE.............................................KA.SPFLCLAFKL.LQINPDRD..........IIM.EYLNfsdpenetdgaded..........................ttaedraqrsvvkhRGDFK..YLRALAAF....Y...V.....RLTWE........................PVEI....YK.TLE.....PL..LLDYR.KLKRRVRDS...................-----....-FVLTYMDQFVD.DLL.......TKDRM...CG..T..SLWKLPSRQQLEDL-d....................................................................
B8BCS7_ORYSI/10-175                    ...............................................KSIHGTNPQNLVEKIVRSKIYQ..S.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHTGG..............-TYG.GNR.............................................KP.TPFLCLALKM.LQIQPDKD..........IVV.EFIK......................................................NEDYK..YVRVLGAF....Y...L.....RLTAT........................VADV....YQ.YLE.....PL..YNDYR.KIRHKLSDG...................-----....KFTLTHVDEFID.DLL.......TKDYS...CD..T..ALPRIQKRWVLET--sg...................................................................
A0A091UVU1_NIPNI/10-175                ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LKYVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HEERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A068RMB9_9FUNG/9-173                 ..............................................l-ETWGNETTMNMNAILYQNILA..S.PY.FK-SLYEKKT................................FHEIVDEIYNE..VTNLAP..............FIKG.TT-.............................................-V.STAFCCLFKF.WTLRLTVK..........QLE.NLID......................................................HRDSP..YIRAIGFL....Y...L.....RYVCA........................PAEL....WE.WLS.....YY..LEDEE.EI-------...................--ELSg.gpRPQKSTIGKLCR.MLL.......TEQKF...QG..T..MLPRIPVPIAR----dldk.................................................................
F4K754_ARATH/4-105                     .............................................iq--SNGRAYESLLEKVLSMNILS..S.DY.FK-ELYGLKT................................YHEVIDEIYNQ..VNHVEP..............WMGG.NCR.............................................GP.STAYCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HTDSP..YIRAIF--....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------tttikv...............................................................
F7H0L0_MACMU/47-189                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.---------...................-----....------------.---.......-----...--..-..---------------fyt..................................................................
A0A0D9S6K8_CHLSB/47-231                ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
A0A095ADL6_SCHHA/19-203                ..............................................l-KLWGNPQTMNLNTMIYTNIAQ..S.PY.FKANLVELKT................................YHEVIDEIYYK..VEHLEP..............WERG.SRRiggqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.FTLKLTRK..........QLK.GLLD......................................................HPDSP..YIRALGFM....Y...I.....RYCIP........................PEDF....WW.WYS.....PY..LSDSE.---------...................ELDVKa..gGGCIMTIGNMLE.HWL.......TKLDW...FS..T..LFPRIPVPVQKK---lee..................................................................
F2SN07_TRIRC/21-222                    ..............................................l--IRGVNPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LTYIGG..............-TYG.VGQ.............................................KP.TPFLCLAFKL.LQLAPEKE..........VIL.EYLNfhdpeadeedlkvrgdstd................adggagdaqdradaailkaTGDFK..YLRALAAF....Y...I.....RLTFE........................PVEI....YK.TLE.....PL..LTDYR.KLKRRTKEG...................-----....-FLLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKIPTRTILEDL-d....................................................................
G5C765_HETGA/10-78                     ..............................................h-SIHGTNPQHLVEMIIRTQIYE..S.KY.WKEECFGLMA................................-ELVVDKAME-..LRFMGG..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------gchprllgprrsagpstqk..................................................
W5EZF1_WHEAT/1-99                      ...............................................----------------------..-.--.----------................................-----------..------..............----.---.............................................--.---------M.LQIQPDKE..........IVV.EFIK......................................................NEDYK..YVRVLGAF....Y...L.....RLTGT........................VADV....YQ.YLE.....PL..YNDYR.KIRQKLSDG...................-----....KFTLTHVDEFID.ELL.......TKDYS...CD..T..ALPRIQKRWILEA--sg...................................................................
A0A135LL62_PENPA/21-204                ..............................................l--VRGVNPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LTCIGG..............-TYG.VSE.............................................KP.TPFLCLAFKL.LQLGPDRD..........VIL.ELLNftdpgsgdea..................................enpddalvkdRGDFK..YLRALAAF....Y...V.....RLTFE........................PVDV....YK.TLE.....PL..LLDYR.KLKRRVRDS...................-----....-FTLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKLPPRSQLEDL-d....................................................................
A0A0L7L5T5_9NEOP/10-175                ...............................................KSIRGTNPQYLIEKIIRARIYD..S.KF.WKEECFALTA................................-ELLVDKAME-..LRYVGG..............-VHG.GFI.............................................YP.TPFLCLVLKM.LQIQPEKD..........IVV.EFIK......................................................NEEFK..YVRALGAF....Y...M.....RLTGT........................SVDC....YK.YLE.....PL..YNDNR.KLRRQNREG...................-----....QFEIVHVDEFID.ELL.......REERL...CD..I..ILPRIQKRFVLEEN-n....................................................................
A0A024WI92_PLAFA/173-335               ............................................lem----TNTTTYNVNTLLRNNILS..S.EY.FK-SLIPIKT................................FKEVVDEIHSY..ADHVEP..............YCIG.SNR.............................................AP.STLFCCLYKF.FTMQLSEK..........QLK.SLIE......................................................NKDSC..YIRACGFL....Y...L.....RYVHS........................PANL....WM.WFE.....PY..LLEED.---------...................EFSISc..dKRRKVTIGEYVQ.SLL.......SDDKY...FN..T..VLPRLPIKIK-----nvy..................................................................
A0A164QQA9_9HOMO/10-173                ..............................................i-QIHGQNPQYLIETVIRNRIYD..S.NY.WKEHCFALTA................................-ETLIDKAIE-..VKCIGG..............-VYG.N-Q.............................................KP.TEFICLLQKL.LQIQPEKE..........ILV.EYLQ......................................................ADEFK..YLRALAAM....Y...I.....RMTFN........................AVEV....YD.LLE.....PL..LKDFR.KLRQRSVAG...................-----....-YSLTYMDEFAD.ALL.......REERV...CD..I..ILPRIAKRSVLEE--lg...................................................................
F0VCL2_NEOCL/132-293                   ............................................emt-----DSTTYNVNALLRSNILA..S.EY.FK-SLHELKT................................VPEVVDEIAQY..AQHAEP..............YCSG.SSR.............................................AP.STLFCCLYKL.FTMKLTTK..........QVE.QLLD......................................................YSDSP..YVRCAGFL....Y...L.....RYVHP........................PEKL....WK.WYE.....AY..FLDDE.---------...................EFAASa..dAKRTTTVGEYVE.SLI.......MEDKY...FN..T..VLPRLPVKVK-----nly..................................................................
A0A093I1A2_STRCA/1-115                 ...............................................----------------------..-.--.----------................................-----------..------..............--YG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HEERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
PR38B_MOUSE/48-232                     ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
B9PT26_TOXGV/142-303                   ............................................emt-----DSTTYNVNALLRSNILS..S.EY.FK-SLHELKT................................VPEVVDEITQY..AQHAEP..............YCSG.SSR.............................................AP.STLFCCLYKL.FTMKLTTK..........QLE.QLLD......................................................YSDSP..YVRCTGFL....Y...L.....RYVHP........................PEKL....WK.WYE.....QY..FLDDE.-VFAASSD-...................-----....TKRTTTMGEYVE.SLI.......MEDKY...FN..T..VLPRLPVKVK-----nly..................................................................
A0A0E0PTE5_ORYRU/4-166                 ........................................qssgrpi--------DVLMEKVLSVNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.SSAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAVGFL....Y...L.....RYVAE........................PKTL....WS.WYE.....PY..IKDDE.---------...................EFSPG...sNGKMTTMGVYVR.DLL.......LGQYY...FD..S..LLPRVPLPI------lrqvt................................................................
M0Z3R7_HORVD/3-165                     ...........................................lqts----GRPIEVLMEKVLSMNIVS..S.DY.FK-ELYKIKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKL.FTMKLTVN..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYAAD........................PKTL....WT.WYE.....PY..IQDDE.---------...................EFSPG...sNGKMTTMGVYVR.DVI.......LGQYY...FD..S..LLPRVPL--------lilrqv...............................................................
J4W4G8_BEAB2/24-191                    ............................................lap---NGLNPANIMEKAVKDRITD..S.YF.YKEQCFALNE................................-ADIVDRVVEH..VRFIGG..............-TSG.TAQ.............................................KP.SPFLCLAFKL.LELSPSDA..........VLA.EYLAy....................................................gGEHFK..YLRALACF....Y...L.....RLTRQ........................AKDV....YE.TLE.....PF..LADRR.KLRRKGRER...................-----....-TTLTYMDEFVD.DLL.......SKDRV...CA..T..SLWKMPKREILEDL-e....................................................................
D2V594_NAEGR/1-165                     ..............................................t--VHSTNSQNLIEQITRNKIFN..S.IY.YKEECFGLNA................................-ATVIDKAEN-..LDSIGG..............-TFG.GLR.............................................KP.TNFLSLLMKM.LQIEVDLE..........STV.AYIH......................................................NGEFK..YLTALGAL....Y...L.....RLVGN........................AVDV....YE.QLE.....PL..YSDYR.KLRLRLIDG...................-----....SCKILHMDEFIE.MLL.......TSDSF...CD..V..KLPFLLSRKVLEK--ng...................................................................
H0V990_CAVPO/21-205                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
M3VYN3_FELCA/10-175                    ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A0L9TZB1_PHAAN/10-175                ...............................................KSIRGTNPQNLVEKILRSKIYQ..N.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHLGG..............-TYG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKE..........IVI.EFIK......................................................NEDYK..YVRILGAF....Y...L.....RLTGS........................DIDV....YR.YLE.....PL..YNDYR.KLRRKLTDG...................-----....QFSLTHVDEVID.ELL.......TKDYS...CD..I..ALPRVKKRWTLES--ln...................................................................
PR38A_XENTR/10-175                     ..............................................h-SVHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LKYVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRTLGAL....Y...M.....RLTGT........................ATDC....YK.YLE.....PL..YNDYR.KVKVQNRNG...................-----....EFELMHVDEFID.QLL.......HEERV...CD..V..ILPRLQKRFVLEET-e....................................................................
A0A139IKE7_9PEZI/19-186                .............................................vl--IRGDNPLKLFEKPVRDRIVD..S.YY.WKEQCFGLNA................................-ATLLDRAVE-..LTFIGG..............-TYG.VAQ.............................................KP.TPFLCLAFKL.LQLTPERE..........IIT.FYLEk....................................................gGEEYK..YLRALAAF....Y...I.....RIAWE.......................kDEEV....YT.TLE.....PY..LADSR.KLKRRTREG...................-----....-WALTHVDEFID.DLL.......TKSRV...CA..T..TLPKINPRLWLEDE-d....................................................................
A0A024W6R0_PLAFA/11-175                ............................................knf----GSNPQYLISNIIRSKIYD..S.PY.WKEKCFALTS................................-ESIIDQAIN-..LKYVGG..............-TYG.GNR.............................................KP.TRFLCLILKL.LQIQPDKD..........IIY.EYIK......................................................NEDFV..YLRALGIF....Y...L.....RLIGK........................SLEV....YN.HLE.....PI..LFDYR.KIRMRLQNG...................-----....TFEKIYMDVFVD.NCL.......ILNNF...LD..V..DFPTLTKRQVLEEN-n....................................................................
H0V4L8_CAVPO/10-175                    ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A015N4G5_9GLOM/7-171                 ..............................................l-ETWGSETTMNLNNILYQNIQA..S.PY.FK-HLYELKT................................YHEVIDEIFNH..VESLEP..............FLKG.TTA.............................................--.STAFCLLYKL.WTLRLTVK..........QVN.GLIE......................................................HTDSP..HIRALGFL....Y...L.....RYVCK........................PIHL....WE.WFE.....EY..LDDEE.E--------...................-VQIQg.gpRPVIITIGKMCR.QLL.......TEQKW...LG..T..ILPRIPVPIAREIE-q....................................................................
A0A0D9XBE9_9ORYZ/10-175                ...............................................KSIHGTNPQNLVEKIVRSKIYQ..S.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHTGG..............-TYG.GNR.............................................KP.TPFLCLTLKM.LQIQPDKD..........IVV.EFIK......................................................NEDYK..YVRVLGAF....Y...L.....RLTGT........................VADV....YQ.YLE.....PL..YNDYR.KIRHKLSDG...................-----....KFTLTHVDEFID.DLL.......TKDYC...CD..T..ALPRIQKRWVLEA--sg...................................................................
A0A094KVV9_ANTCR/1-113                 ..............................................g----------------------..-.--.----------................................-----------..------..............----.-NI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HEERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A0C9MMM3_9FUNG/440-622               ..............................................a-SIHGRHPLHLIEKITRERIQN..S.LY.WKEKCYGLSA................................-ATLMDRAFE-..LEYIGG..............-MYG.NHQ.............................................-P.TEFLCLTLKL.LTLLPEKD..........III.ELIKqedvkcayv...................................isalseqrltDDLTR..YLRALGAF....Y...L.....RLTGK........................SKEI....YQ.YLE.....PL..LNDYR.KLRVRAGDG...................-----....-YSLTHMDSFID.DLL.......HKDRV...CD..I..ILPRLTSRYVLEQN-d....................................................................
W4ZSU7_WHEAT/50-203                    ............................................gri----GANPQMLVENTVRSGIYR..S.SY.WRERCFGLTA................................-ETLVGRAVE-..LDHVGG..............-TFG.RNG.............................................-P.TPFLCLALKM.LQMQPDRE..........TVV.GFIS......................................................NEEHR..YLRALGAF....Y...L.....RLTGT........................GADV....RR.YLE.....PL..SNDHR.EIRERISDE...................-----....EFTLTDVGYFID.KLL.......TQDSC...CD..T..ALPRI----------.....................................................................
H2ZEL4_CIOSA/4-188                     .............................................lt--CWGNPRTMNLNHLVLTNVQN..S.PY.FKVRLFELKT................................YHEVVDEIYYK..VDHLEP..............WERG.TRKtagqtgmcg...........................gvrgvgaggVV.STSFCILFKL.FTLKLTRK..........QVN.GLLN......................................................HTDSP..FIRGLGVM....Y...I.....RYTQA........................PKDL....WN.WYE.....PY..LEDEE.---------...................EIDVKa..gGGCVMTIGMMIR.TVL.......TKLDW...FS..T..LFPRIPVPIQKEID-e....................................................................
A0A075A663_9TREM/10-175                ..............................................h-TVHGTNPQYLVEKIIRSRIYE..S.KY.WKEHCFALTA................................-ELLVDKAVE-..LRYVGG..............-VYS.GNV.............................................KP.TPFLCLALKM.LQIQPDKD..........IVI.EFIK......................................................QEPYK..YARALGAF....Y...L.....RLVGE........................SVEI....YK.YLE.....TL..YNDFR.RLKFQDRAG...................-----....NFSLIYMDDFID.KLL.......TEERV...CD..V..ILPRLQKRSVLEE--an...................................................................
Q4UCH1_THEAN/10-175                    .............................................hl--IHGTNPQFLFSKILRDKVYN..S.FY.WKESCFGLTA................................-ESLIDKAVQ-..IKYVGG..............-TFG.GNR.............................................QP.SPFICLVLKM.LQIQPEME..........IVH.EYIK......................................................NEDYK..YLRALGIY....Y...M.....RLVGT........................AVEV....YR.TLE.....PF..LADYR.KLRFRNIDG...................-----....SYVIKYMDEFVD.DCL.......TNSTY...LD..V..DLPPLSKRMNLEA--tk...................................................................
M0X6G7_HORVD/3-166                     ............................................iqt---SGKPIDMLMEKVLCMNILS..S.DY.FK-ELYRMKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKIL....WT.WYE.....PY..LKDDE.---------...................EFSPG...sNGRMTTMGVFVR.DLI.......LGQYY...FD..S..ILPRVPVPVV-----rqvt.................................................................
B4F7Y9_MAIZE/3-166                     ...........................................iqss----GRSIEGLMEKVLSVNILS..S.DY.FK-ELFKYKT................................YHEVVDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.SSAFCLLYKL.FTMKLTVK..........QMH.GLLK......................................................HQDSP..YIRAIGFL....Y...L.....RYVAE........................PKTL....WT.WYE.....PY..IKDDE.---------...................EFAPG...sNRKVTTMGVYVR.DLL.......LGQYY...FD..S..LLPRVPLPI------lrqvt................................................................
I3JLV3_ORENI/10-175                    ..............................................n-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LKFVGG..............-VFG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRLLGAM....Y...M.....RLTGT........................AVDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFEVMHVDEFID.GLL.......QSERM...CD..V..ILPRLQKRQVLEEA-e....................................................................
G0PED8_CAEBE/1-148                     ...............................................----------------------..-.--.----------................................--TLVEQIFYQ..VKHLEP..............WEKG.TRRlqgmtgmcg...........................gvrgvgaggVV.SSAYCLLFRL.FNLRISRK..........QLI.SMLN......................................................SRQSV..YIRGIGFM....Y...I.....RYTQP........................PADL....WY.WLE.....PY..LDDDS.---------...................EIDPRs..gGGDLMSFGQMVR.TMI.......NKLDW...YG..T..LFPRIPVPIQKEID-e....................................................................
V4AYJ2_LOTGI/4-188                     ..............................................l-AVWGNEKTMNLNNLILTNIQS..S.PY.FKINLFNLKT................................YHEVIDEIYYK..VSHLEP..............WEKG.SRKtagqtgmcg...........................gvrgvgaggIV.SSAYCLLYKL.YTLKLTRK..........QLN.GLLT......................................................HSDSP..YIRGLGFM....Y...I.....RYTQP........................PADL....WE.WYE.....PY..FDDDE.---------...................EVDVKa..gGGHVMLIGEMIR.QWL.......VKLEW...YS..T..LFPRIPVPIQKDI--ds...................................................................
U6MUF7_9EIME/120-282                   ............................................vqm----TDSTTYNVNQLLRGNIMS..S.EY.FK-SLHQFKS................................FNEVVDELAAF..ADHAEP..............YCSG.STR.............................................AP.STLFCCLYKL.FTLKLTEK..........QMH.MLLN......................................................HRESP..YVRCTGFL....Y...L.....RYVHP........................PDQL....WK.WYE.....PY..FLDDE.---------...................QFTPGa..dPNRVISMGEYVQ.SLL.......TEDKY...FS..T..VLPRLPVLVK-----nvy..................................................................
A0A0J8U8G6_COCIT/28-216                ..............................................l--VRGVNPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LGYIGG..............-TYG.ANQ.............................................KP.TPFLCLAFKL.LQLAPERE..........VVL.EYLNfhdpaeddddng.............................dedggdgaavlksVGDFK..YLRALAAF....Y...I.....RLTFE........................PVEV....YN.VLE.....PL..LSDYR.KLKRRTKDG...................-----....-FVLTYMDQFVD.DLL.......NKDRV...CG..T..SLWKLPARRILEDL-d....................................................................
A0A0F0ILI8_ASPPU/21-209                ..............................................l--VRGVNPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LTSIGG..............-TYG.VSE.............................................KP.TPFLCLAFKM.LQLNPDRD..........IVL.EYLNftdpvndeegeq.............................tateqaengvvkqQGDFK..YLRALAAF....Y...V.....RLTFD........................AVDV....YK.TLE.....PL..LLDYR.KLKRRVRDS...................-----....-VVLTYVDQFVD.DLL.......TKDRV...CG..T..SLWKLPSRQQLEDL-d....................................................................
A0A091SL58_9AVES/25-209                ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKTI--dq...................................................................
G1NUQ8_MYOLU/10-176                    ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................----V....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
B4JL98_DROGR/29-213                    ..............................................l-PLWGNETSMNLNPLILANIQS..S.SY.FKVHLFKLKT................................YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.YTLRLTRK..........QVN.GLLN......................................................HTDSA..YIRALGFM....Y...L.....RYTQP........................PGDL....YD.WYE.....DY..LQDEE.---------...................EIDVKa..gGGQVVTIGQMVY.QFM.......TKLDW...FS..T..LFPRIPVPIQKQIE-k....................................................................
S8D204_9LAMI/10-175                    ...............................................KSIRGTNPQNLVEKILRSKIYQ..N.TF.WKEQCFGLTA................................-ETLVDKAME-..IDHLGG..............-TFG.GNR.............................................KP.TPFMCLVMKM.LQIQPDKE..........IVV.EFIK......................................................NPEYK..YVRALGAF....Y...L.....RLTGT........................DVDV....YR.YLE.....PL..YNDYR.KLRIKANDG...................-----....KFALTHVDEFID.DLL.......TKDYS...CD..I..ALPRIKKRWTLEN--lg...................................................................
A0A0B2V767_TOXCA/10-175                .............................................vt--VKGTNPQYLVEKIIRTRIYD..S.KY.WKEECFALTA................................-ELVVDKGME-..LRYVGG..............-IYA.GNV.............................................KP.TPFLCLSLKL.LQIQPEKD..........IIV.EFIR......................................................QEDYK..YIRALGAM....Y...L.....RLTFS........................SIEV....YK.YLE.....PL..YNDYR.KLRYMNKEG...................-----....RFELIYMDEFID.NLL.......RQERY...CD..I..QLPRLQSLTKM----anrt.................................................................
K7GEC3_PELSI/50-234                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
A0A0L0GAZ2_9EUKA/4-171                 .............................................me--TWGNKTTMNINDILYRNILA..S.RY.FSQDLAKLTT................................FEEIVPEIYEQ..VTDLEP..............FMPG.IGN.............................................KA.TSAFCLLYKL.FTLKMTEQ..........QVV.ALLD......................................................NEDSV..YVRGIGFL....W...L.....RYCCP........................PKEL....WS.WMG.....HY..INDTE.PIKPGWSQN...................-----....-SPETTIGSFIR.RLL.......TEQKY...YN..T..IMPRIPVPVARE---lqk..................................................................
Q2H4I5_CHAGB/24-112                    ............................................lap---NGLNPATIMEKAVRERIVD..S.YF.YKEQCFGVNE................................-ADIVDRVVEH..VDHIGG..............-VAG.IVQ.............................................KP.TPFLCLAFKL.LQLAPADD..........ILD.EY--......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------prlwrre..............................................................
Q9VYE9_DROME/24-208                    ..............................................l-PFWGNESSMNLNALILANIQS..S.SY.FKVHLFKLKT................................YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.YTLRLTRK..........QIN.GLLN......................................................HTDSA..YIRALGFM....Y...L.....RYTQP........................PGDL....YD.WYE.....DY..LQDEE.---------...................EIDVKa..gGGQVLTIGQMVY.QFM.......TKLDW...FS..T..LFPRIPVPIQKQIE-k....................................................................
D8QIS6_SCHCM/10-173                    ...............................................KQIHGQNPQFLVETVIRNRIWE..S.SY.WKEHCFALTA................................-ESLIDKAIS-..LRAIGG..............-VYG.NQR.............................................-P.TEFLCLLLKL.LQIQPEKE..........ILV.EYLQ......................................................ADEFK..YLRALAAM....Y...I.....RMTFR........................AVDV....YE.LLE.....PL..LKDYR.KIRYRDMGG...................-----....-YRLTFIDEFVD.SLL.......TEERV...CD..I..ILPRLQKREILEEN-g....................................................................
M7BDA2_CHEMY/30-111                    ..............................................y----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................--ESK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
U6LVE5_9EIME/1-146                     ...............................................---------------------E..S.FF.WKNDCFAATA................................-ESLVEIAIKN..LFYVGG..............-TFG.GIR.............................................TP.APFLCLVLKL.LQLQPDKM..........IVL.EYIK......................................................QEDFK..YLRAVGAF....Y...F.....RLVAP........................SDEV....YV.HLE.....PL..LTDYR.KLRLRKNDG...................-----....TFILTYMDVFID.DCL.......RKHNL...FD..V..DLPPLTKRNV-----fvqqn................................................................
A0A094HRM8_9PEZI/22-189                ............................................lap---NGLNPATIFEKPVRERIID..C.YF.WKDQCFALNE................................-ADIVSRVVEH..VHFISG..............-TYG.DSQ.............................................RP.SPFLCLAFKL.LQLGPGDD..........ILK.EYLGy....................................................gGERFK..YLRALACF....Y...V.....RLTRP........................AKEV....YE.TLE.....PF..LEDGR.KLRRRGRQG...................-----....-TSLTFVDQFVD.ELL.......TKERI...CA..T..SLWKMPKREVLEDL-e....................................................................
N4U2P3_FUSC1/26-192                    .............................................ap---NGLNPATIMEKAVKDRIVD..S.YF.YKEQCFALNE................................-ADIVDRVVEH..VNFIGG..............-TYG.VTQ.............................................KP.SPFLCLAFKL.LELSPSDA..........VLM.EYLKy....................................................gGEAFK..YLRALACF....Y...F.....RLTRQ........................AKDV....YE.MLE.....PF..LEDRR.KLRRRGRAG...................-----....-VVLTFMDEFVD.ELL.......TKERV...CG..T..SLWKMPKREVLEDL-e....................................................................
Q4CZI2_TRYCC/9-176                     .............................................wn--LKGRSAVAALDPSTRHRIMQ..S.HA.MASSFHKPLL................................-ATLEVLITP-..-QYVGG..............-LTG.PLQ.............................................KP.EPFICHVTRL.LQITPDPS..........IVL.AMLH......................................................QDVHK..YLRVAALF....I...I.....RLIGN........................EAMM....RE.AMR.....VG..WEDYR.KIRVYGYVE...................-----....------------.---.......-----...--..-..---------------dlegtidskennapdeeegfvrapaygimcvdeitdrlfnv............................
R7SBP5_TREMS/8-160                     ..............................................l-SIHGSNPQYLIEKVIRARIYD..S.LY.WKEHCFALNA................................-ESIIDKAIT-..LHAIGG..............-TYD.-RQ.............................................TP.TPFICLTLKL.LQLQPEKE..........ILM.EYLL......................................................AEEFK..YLRALAAL....Y...I.....RLTFR........................SMDV....YE.ILE.....PL..MKDYR.KLRIRHPGG...................-----....-YSLTYFDQFID.DLL.......KEERV...CD..I..ILPR-----------.....................................................................
B4KQL3_DROMO/10-175                    ...............................................KNVHGTNPQYLIEKIIRSRIYD..S.KY.WKEQCFALTA................................-ELLVDKAME-..LRFIGG..............-VYG.GNI.............................................KP.TQFLCLTLKM.LQIQPEKD..........IVV.EFIK......................................................NEEFK..YVRALGAF....Y...L.....RLTGA........................AIDC....YK.YLE.....PL..YIDNR.KLRRQNRAG...................-----....QFEIVYMDEYID.ELL.......RNDRV...CD..I..ILPRIQKRSILEEN-n....................................................................
G1PFY0_MYOLU/28-212                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
G0QNU7_ICHMG/10-175                    ..............................................n-SIRGQNPQSLIEAVIRQKIYQ..N.RY.WKESLTGLTA................................-ESIIDEAIK-..LQYIAG..............-TYG.GSR.............................................KP.SKFLMLSLKL.LQISPSKE..........IVI.EYIR......................................................QEEYK..YLTALGCF....H...L.....RLVGQ........................PEHV....YN.YLE.....PL..YQDYR.KLRFRNLNG...................-----....SFCIFYMDEFVE.SLI.......NQEVY...ID..T..LLPHIIKRHILEE--tg...................................................................
A0A0B7MXN5_9FUNG/10-170                ..............................................l-ETWGNETTMNLNAIIYQNILS..S.PY.FR-SLYNKKT................................FHEIVDEIYNE..APFVKG..............----.-T-.............................................QP.STAFCCLFKM.WTLRLTIK..........QIE.NMID......................................................HVDSP..YIRAIGFL....Y...L.....RYVCA........................PAQL....WD.WFQ.....YY..LEDEE.EITITS---...................----G...vNPTKITIGKLCR.MLI.......TEQKF...QG..T..MLPRIPVPIAR----dlek.................................................................
A0A072NZS4_9EURO/19-185                .............................................pl--IRGQNPALLLETAMRDRITD..S.LY.WKEQCFGLNA................................-ATLCDRAVE-..LTYIGG..............-TYG.VAM.............................................KP.SPFICLAFKL.LTLVPDKE..........IIL.EYLNt....................................................gGEEWK..YLRALAAF....Y...A.....RLTFD........................PVDI....YK.TLE.....PF..LEDSR.KLRQRRKES...................-----....-YVLIHMDEFVD.NLL.......TKDRV...CG..T..TLWKLSARQLLEDL-d....................................................................
A0A090N2S3_OSTTA/10-175                ..............................................k-SVRGTDPQNLMERITRDKVYA..M.TY.WKEKCFGVSA................................-EALVDLAVD-..LRSVGG..............-IYG.GNN.............................................RA.TEFLCLTLKL.LQIQPEKE..........IVL.EFIK......................................................NEDHK..YVRLLGAF....Y...L.....RLVGK........................PTDV....YR.YLE.....PL..LNDYR.KVRYRTRDG...................-----....KYALTHVDEFVN.NLL.......TKDMF...CD..V..TLPRVPHRQVLEA--ag...................................................................
A0A0C2XB17_9HOMO/10-173                ..............................................k-AIHGANPQSLVEHVIRLRIWE..S.TY.WKEECFALTA................................-VSLIDKAIK-..LNAIGG..............-VYD.NTK.............................................-P.TQFISLLLKL.LQIQPEKE..........ILV.EYLL......................................................VEEFK..YLRALAAM....Y...I.....RMTFR........................AAEV....YE.LLE.....PL..LNDYR.KLRMLSMSG...................-----....-FSLTYMDEFID.KLL.......HEERV...CD..I..ILPRLPKRETLEET-e....................................................................
C5DED7_LACTC/14-227                    ...............................................KQLNHQSTSLVIPQLARTRIHN..S.MY.YKINLDPASLrg............................dtMVQLSKTMMRD..FGTCRDnar........rmaLVCG.GVE.............................................--.--FKCLLMKL.VHLRPQWG..........QIV.TILQkgn...............................................erssKFDNK..YLVVLVLV....Y...L.....RIQYYflpdtsdeekvtgvlnlnkrgsvsSGTL....RG.LFR.....IY..LSDYR.KVKSINLETdy...............wyNSASK....VPKTLHIDEVVD.WLC.......TQDQI...WG..I..PLGRCQW-CNI----fket.................................................................
M3XER9_FELCA/48-232                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
A0A091GE25_9AVES/48-232                ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKTI--dq...................................................................
A0A084W0J8_ANOSI/10-175                ...............................................KNVHGTNPQYLIEKIIRSRIYD..S.KY.WKEQCFALTA................................-ELLVDKAME-..LRFVGG..............-VFG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IVV.EFIK......................................................NEEFK..YVRALGAF....Y...L.....RLTGS........................SLDC....YK.YLE.....PL..YNDNR.KLRKQNRMG...................-----....AYELTHMDEFID.ELL.......REERV...CD..I..ILPRIQKRHVLEEN-n....................................................................
G5AUI5_HETGA/10-175                    ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A0V0UWK7_9BILA/545-728               ..............................................l-NFWGNKETMNLNHLVLENIVS..S.PY.YKNTLLPLKT................................HFEVIDEIYYN..VEHLEP..............WEKG.TRKttgqtgmcg...........................gvrgvgaggVV.SSAFCLLYKL.FTLKLTRK..........QLT.AILN......................................................HPDSC..YIRGLGFM....Y...I.....RFCLH........................PATF....WS.WYE.....PY..FDDSE.---------...................EIDPKa..gGGDLMTIGEMVK.SLL.......TKLDW...YS..T..LFPRIPVPIQKEI--d....................................................................
A0A024GSS3_9STRA/10-174                ..............................................q-SIHGIHAQHLIEKIMRNRIYS..S.LY.WKEECFGLTC................................-ETLVDKAIA-..LDHFGG..............-TFG.GNQ.............................................KP.TPFLCLLLKM.LQLQPDLE..........VVQ.EFIQ......................................................NEEYK..YVTVLGMV....Y...L.....RLVGK........................SADI....YT.LLE.....PL..YCDYR.KIRKRNVIG...................-----....-WEITHVDEIVD.ALL.......HEEYY...ID..L..TLPHLIDRVL-----edale................................................................
E9DBR1_COCPS/21-209                    ..............................................l--VRGVNPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LGYIGG..............-TYG.ANQ.............................................KP.TPFLCLAFKL.LQLAPERE..........VVL.EYLNfhdpaeddddng.............................deddgdgaavlksVGDFK..YLRALAAF....Y...I.....RLTFE........................PVEV....YN.VLE.....PL..LSDYR.KLKRRTKDG...................-----....-FVLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKLPARRILEDL-d....................................................................
A0A090M5Y6_OSTTA/20-189                ...........................................aats------GKSHGVEEVLRQNIAH..S.EY.FR-KLRRADDlgr.........................paydFMALVDEIYEL..VDHCEP..............WMCG.NAR.............................................GA.STGFCILFQF.CEMELSDG..........NVW.HLLR......................................................HGDSP..FIRALGFL....Y...V.....RYVKN........................GREL....LK.WCE.....EF..FGDEE.---------...................KFKPS...pDGKEVTMGAFVR.DLL.......LEQRY...FE..T..ILPRIPEVARRE---ive..................................................................
F1Q7F0_DANRE/25-209                    ..............................................l-PLWGNEKTMNLNPMILTNVLS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VNHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HSDSP..YIRALGFM....Y...I.....RYTQP........................PPDL....VD.WYD.....EF..LDDEE.---------...................ELDVKa..gGGCVMTVGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKAI--dq...................................................................
B4J994_DROGR/10-175                    ...............................................KNVHGTNPQYLIEKIIRSRIYD..S.KY.WKEQCFALTA................................-ELLVDKAME-..LRFVGG..............-VYG.GNI.............................................RP.TQFLCLTLKM.LQIQPEKD..........IVV.EFIK......................................................NEEFK..YVRALGAF....Y...L.....RLTGA........................AIDC....YK.YLE.....PL..YIDNR.KLRRQNRAG...................-----....QFEIVYMDEYID.ELL.......RNDRV...CD..I..ILPRIQKRAILEEN-n....................................................................
S2JQG7_MUCC1/11-174                    ..............................................a-SIHGRHPLHLIEKIIRERIQN..S.LY.WKEKCYGLSA................................-ATLMDRAFE-..LEYIGG..............-MYG.NHQ.............................................-P.TEFLCLTLKL.LTLLPEKD..........III.ELIK......................................................QEDVK..YLRALGAF....Y...L.....RLTGK........................SKEI....YQ.YLE.....PL..LNDYR.KLRVRAGDG...................-----....-YSLTHMDSFID.DLL.......HKDRV...CD..I..ILPRLTSRYVLEQN-d....................................................................
A0A0V0RLN2_9BILA/598-781               ..............................................l-NFWGNKETMNLNHLVLENIVS..S.PY.YKNTLLPLKT................................HFEVIDEIYYN..VEHLEP..............WEKG.TRKttgqtgmcg...........................gvrgvgaggVV.SSAFCLLYKL.FTLKLTRK..........QLT.AILN......................................................HPDSC..YIRGLGFM....Y...I.....RFCLH........................PATF....WS.WYE.....PY..FDDSE.---------...................EIDPKa..gGGDLMTIGEMVK.SLL.......TKLDW...YS..T..LFPRIPVPIQKEI--d....................................................................
A0A0V0ZYC7_9BILA/427-610               ..............................................l-NFWGNKETMNLNHLVLENIVS..S.PY.YKNTLLPLKT................................HFEVIDEIYYN..VEHLEP..............WEKG.TRKttgqtgmcg...........................gvrgvgaggVV.SSAFCLLYKL.FTLKLTRK..........QLT.ALLN......................................................HPDSC..YIRGLGFM....Y...I.....RFCLH........................PATF....WS.WYE.....PY..FDDSE.---------...................EIDPKa..gGGDLMTIGEMVK.SLL.......TKLDW...YS..T..LFPRIPVPIQKEI--d....................................................................
G5A621_PHYSP/9-173                     ..............................................q-SVHGVNPQTLVEKIMRNRVYA..S.VY.WKEQCFGLTA................................-ETLVDKAVE-..LTEFGG..............-TFG.GNQ.............................................QP.THFLCLLLKM.LQLQPELE..........VVR.QFIE......................................................NDDYK..YVTVLGAV....Y...L.....RLVGK........................PREV....YE.LLE.....PL..LSDYR.KIRKRNVIG...................-----....-WEITHVDEIAD.ALL.......NEEYY...VD..L..ALPRLVDRELLER--ne...................................................................
T1JA16_STRMM/13-197                    ..............................................l-PLWGNDKSMNLNSLILTNIQS..S.HY.FKVNLFDLKT................................YHEVIDEIYYK..VTHLEP..............WEKG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAFCLLYKL.FTLKLTRK..........QVN.GLIT......................................................HCDSA..YIRALGFM....Y...I.....RYTQP........................PQDL....WD.WFE.....SY..LDDDE.---------...................ELDVKa..gGGCMMSIGEMLR.HYL.......TKLEW...YS..T..LFPRIPVPIQKEIE-k....................................................................
A0A094I083_9PEZI/22-189                ............................................lap---NGLNPATIFEKPVRERIID..C.YF.WKDQCFALNE................................-ADIVSRVVEH..VHFISG..............-TYG.DSQ.............................................RP.SPFLCLAFKL.LQLGPGDD..........ILK.EYLGy....................................................gGERFK..YLRALACF....Y...V.....RLTRP........................AKEV....YE.TLE.....PF..LEDGR.KLRRRGRQG...................-----....-TSLTFVDQFVD.ELL.......TKERI...CA..T..SLWKMPKREVLEDL-e....................................................................
G9N2S0_HYPVG/26-193                    ............................................lap---NGLNPATIMEKAVKDRIVD..S.YF.YKEQCFALNE................................-ADIIDRVVEH..VNFIGG..............-THG.ASQ.............................................KP.SPFLCLAFKL.LELAPSDA..........ILD.EYLSy....................................................gGEHFK..YLRALACF....Y...V.....RLTRQ........................PKDV....YQ.TLE.....PF..LEDRR.KLRRKARTG...................-----....-TSLTYVDEFVD.DLL.......TKDRV...CA..T..SLWKMPKRETLEDL-e....................................................................
M9PHQ4_DROME/24-177                    ..............................................l-PFWGNESSMNLNALILANIQS..S.SY.FKVHLFKLKT................................YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.YTLRLTRK..........QIN.GLLN......................................................HTDSA..YIRALGFM....Y...L.....RYTQP........................PGDL....YD.WYE.....DY..LQDEE.EIDVK----...................-----....------------.---.......-----...--..-..---------------agggqvsql............................................................
B4R4A9_DROSI/197-381                   ..............................................l-PFWGNESSMNLNALILANIQS..S.SY.FKVHLFKLKT................................YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.YTLRLTRK..........QIN.GLLN......................................................HTDSA..YIRALGFM....Y...L.....RYTQP........................PSDL....YD.WYE.....DY..LRDEE.---------...................EIDVKa..gGGQVLTIGQMVY.QFM.......TKLDW...FS..T..LFPRIPVPIQKQIE-k....................................................................
A0A0V0ZZ04_9BILA/35-218                ..............................................l-NFWGNKETMNLNHLVLENIVS..S.PY.YKNTLLPLKT................................HFEVIDEIYYN..VEHLEP..............WEKG.TRKttgqtgmcg...........................gvrgvgaggVV.SSAFCLLYKL.FTLKLTRK..........QLT.ALLN......................................................HPDSC..YIRGLGFM....Y...I.....RFCLH........................PATF....WS.WYE.....PY..FDDSE.---------...................EIDPKa..gGGDLMTIGEMVK.SLL.......TKLDW...YS..T..LFPRIPVPIQKEI--d....................................................................
Q8RWB1_ARATH/4-168                     .............................................iq--SNGRAYESLLEKVLSMNILS..S.DY.FK-ELYGLKT................................YHEVIDEIYNQ..VNHVEP..............WMGG.NCR.............................................GP.STAYCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HTDSP..YIRAVGFL....Y...L.....RYVAD........................AKTL....WT.WYE.....PY..IKDDE.---------...................EFSPG...sNGRMTTMGVYVR.DLL.......LGLYY...FD..T..LFPRIPVPVMR----qivs.................................................................
Q0U5G5_PHANO/25-223                    .............................................al--IRGQNPALLFEKGVRERITE..S.YY.WKEQCFGLNA................................-ATLCDRAAD-..LKFIGG..............-TTG.ITG.............................................KP.TPFLCLAFKM.LQLVPEKA..........IVL.EYLNfggdeeeedeeggvkke....................eeedgdekpqdpnaagkLGQFK..YLRCLAAF....Y...I.....RLAWE........................PVEI....YK.TLE.....PL..LTDYR.KIKRRLKDA...................-----....-FTLTYVDQFID.DLL.......TKDRM...CA..T..SLWKLPSRANLEDL-d....................................................................
A0A067H243_CITSI/1-124                 ..............................................m----------------------..-.--.----------................................----------E..LDHLGG..............-TFG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKD..........IVV.EFIK......................................................NDDYK..YVRVLGAF....Y...L.....RLTGT........................DIDI....YR.YLE.....PL..YNDYR.KLRQKSGDG...................-----....RFILTHVDEVID.ELL.......TKDYS...CD..I..ALPRIKKRWNLET--vg...................................................................
L5LXA6_MYODS/1-171                     ...............................................--------------MILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrevltggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
W2THV3_NECAM/65-249                    ..............................................l-PVWGNQQTMNLNGLVLENVKE..S.YY.YKNHLVEIDS................................AQQLLDEVFYK..VKHLEP..............WEKG.TRKvqgmtgmcg...........................gvrgvgaggVV.SSAFCLLYRF.FKVRLTRK..........QLI.SMIN......................................................SRVSP..YIRGLGFM....Y...I.....RYTQP........................PTDL....WE.WFE.....PY..LDDEE.---------...................EIDPRs..gGGDVMTFGQVVR.IML.......TKLDW...YG..T..LFPRIPVPIQKEID-e....................................................................
G8C0B1_TETPH/14-216                    ...............................................KQLNNQSVSLVIPRLTRDKIHN..S.MY.YKVNLTDNSLrg............................ntVLQLSKVIVRD..LGTLLNgss........qqlNVIG.GVE.............................................--.--FKCILMKL.VEMRPTWE..........QLL.SLLNidndfn..........................................svgtvgEFDNK..YITALVLT....Y...I.....RIQYHfins................dhqlFNKC....KK.LFK.....LY..MNDYR.KLKSIAFGTnc...............wsMSQAI....DVGIGHIDELVE.WLA.......TKNDI...WG..L..PLAMCSW-CNLD---eas..................................................................
A0A0H5S0N7_BRUMA/37-84                 ..............................................l-PLWGNTQTMNLNALVLENIIQ..C.IY.YKNYLAETIG................................FQQLTEEIYY-..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------set..................................................................
I0YZI6_COCSC/10-175                    ..............................................r-SVHGTNPQNLVEKILRMKIYS..S.MY.WKEHCFALTA................................-ESLVDKAVD-..LKYVGG..............-TFG.GQR.............................................AP.TQFMCLMLKL.LQLQPEKE..........IIV.EFIK......................................................NEDYK..YVRILGAF....Y...L.....RLVGR........................PLEV....YQ.YLE.....PL..YNDYR.KVRLRNADG...................-----....NFALTHMDEIID.QML.......YSEYL...FD..V..AMPRIPNRVTME---rls..................................................................
M5ELW3_MALS4/10-174                    ..............................................l-AIHGTNPQFLVERVIRTRIYD..S.TY.WKQDCFALNA................................-ASLVDKAVE-..LTYVGG..............-TYG.ALR.............................................-P.SPFLCLVCKL.LQLQPDRD..........IVL.EYLA......................................................AEDLK..YLRALAAM....Y...I.....RLTFP........................SLEV....YE.LLE.....PL..LNDYH.KLRWRDMTG...................-----....QYSLSYMDEFID.QLL.......TEERV...CD..L..ILPRLTKRAVLERK-e....................................................................
B8C9N6_THAPS/41-204                    .........................................placpd-------DTFNIHPMLLQNIAK..S.PY.FQKCCEKLGD................................WNTLVDEIYYE..VKHMEP..............WTAG.ASK.............................................SP.STAFCLLLRL.FTLRCTEK..........QMS.LMLE......................................................HVDSP..YIRCIGFL....Y...L.....RYAAE........................PSTL....WS.WYE.....QY..LYDEE.PVQIRQG--...................-----....-KADTTVGEYIR.SLL.......EDLEY...YG..T..RLPRLPLTL------erqfk................................................................
A0A0D7B6C2_9HOMO/10-173                ..............................................f-SIHGQNPQFLVETVIRNRIYD..C.NY.WKEHCFALTA................................-ESIIDKAIE-..LKYIGG..............-VYS.-NQ.............................................RP.TDFICLLLKL.LQIQPDKE..........ILI.EYLQ......................................................AEDFK..YLRALAAM....Y...I.....RMTFR........................GVEV....YE.LLE.....PL..LKDYR.KLRLRDMSG...................-----....-YSLTFIDEFAD.ALL.......NEGRV...CD..L..QLPRLPKRDVLEEN-g....................................................................
M3ZTE6_XIPMA/10-175                    ..............................................n-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LKFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRLLGAM....Y...M.....RLTGT........................AVDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HAERV...CD..I..ILPRLQKRQVLEEA-e....................................................................
V6U1Q1_GIAIN/1-137                     ...............................................-----------MEHTTRRAILN..S.PL.YLMEFKHLGV................................IGLLKDVLLT-..-RNIDL..............-KYG.--R.............................................EP.SRFLCALVRL.YMLHPDRS..........IVN.EMLS......................................................VRNFA..YANAFAAI....H...V.....RCYWP........................SLDI....HK.ALT.....PL..MSNYT.KIHVSGLES...................-FG--....LQGHIPLDVLIE.ALL.......-----...--..-..---------------wqsta................................................................
A0A151VGZ8_HYPMA/10-173                ..............................................l-AIHGQNPQFLVETVIRNRIYE..S.NY.WKEHCFALTA................................-ESLIDKAIE-..MRYIGG..............-VYG.NQR.............................................-P.TQFLCLVLKL.LQIQPEKE..........ILV.EYLR......................................................ADEFK..YLRALAAF....Y...I.....RMTFR........................AVDV....YE.LLE.....PL..LKDYG.KLRLRDMSG...................-----....-YSLTYMDEFVY.SLL.......TEERV...CD..I..ILPRLAKRQVLEEN-g....................................................................
T0QUG7_9STRA/50-213                    ..............................................l-PVHGNATTYNLNKMLFDNIMQ..S.VY.FG-QLYALKT................................YHEVVDEIYYR..VDHAEP..............LSPG.TAR.............................................IP.SSCFCLLLKF.CTMRLTQN..........QMQ.GLLK......................................................HVDSP..YIRCVGFL....Y...L.....RYTMD........................PEEL....WS.WFE.....PY..LDDAE.---------...................EFNASa..nDKIVTTTGAWLR.TLL.......EEINY...FG..T..ILPRIPKKI------ldgi.................................................................
Q7RC31_PLAYO/10-175                    ...........................................iksf----GSNPQFLISNIIRNKIYD..S.PY.WKEKCFALTS................................-ESIIDQAVN-..LKYVGG..............-TYG.GNR.............................................KP.TRFLCLVLKL.LQLQPDKD..........IIY.EFIK......................................................NEEFI..YLRALGIF....Y...L.....RLIGK........................GIDI....YK.NIE.....PI..LFDYR.KIRIRLQDG...................-----....SFQKIYMDVFAD.NCL.......VFSNF...LD..V..DFPPLTKRVVLEEN-h....................................................................
A0A151Z730_9MYCE/13-176                ...............................................KSVHGVNPKNLIEKIVRMKIQS..H.NY.WKEKCIGLNE................................-ESLVDRAMD-..LDSFGG..............-SFG.GSK.............................................QP.THFLCLMLKM.LQIQPEKD..........IVL.EFIR......................................................NEDFK..YVRLIGAF....Y...M.....RLVGK........................PKDI....YT.CLE.....PL..YNDYR.TVRKRVDTG...................-----....-YERIHIDEFIK.ELL.......TGNYS...CD..I..ALPHLPSRSTLE---ss...................................................................
A0A0D1YVV0_9EURO/19-185                .............................................pl--IRGQNPALLLETAMRDRITD..S.LY.WKEQCFGLNA................................-ATLCDRAVE-..LTHIGG..............-TYG.VAM.............................................KP.TPFICLAFKL.LTLVPDKE..........IIL.EYLNs....................................................gGDEWK..YLRALAAF....Y...A.....RLTFD........................PADI....YK.TLE.....PL..LEDSR.KLRQRRREE...................-----....-YVLIHMDEFVD.NLL.......TKDRV...CG..T..SLWKMPARQLLEDL-d....................................................................
A0A136JAV4_9PEZI/1-163                 ..............................................l------NPATIMEKAVRERIID..S.YF.WKEQCFGVNE................................-ADIVDRVLEH..VNFVGG..............-TYG.DAQ.............................................KP.TPFLCLAFKL.LQLGPNDE..........IID.EYLKf....................................................gGEKFK..YLRALAAF....Y...V.....RLTRK........................AEVV....YR.TLE.....PF..LEDRR.KLRRKGREG...................-----....-TSLTYVDQFVD.DLL.......VKDRV...CA..T..SLWQMPKREVLEDL-d....................................................................
K0SK04_THAOC/10-174                    ..............................................a-AVHGTNPQNLVEYITRQKIYD..S.LY.WKEECFGLSA................................-SDVATKAVE-..LKALGG..............-SYG.GNS.............................................KP.TRFLCLILKM.LQIQPEEG..........IVE.QFLE......................................................NEDFK..YVRALGAF....Y...L.....RLTGR........................PSEI....FE.LIE.....PL..FNDHR.KLRYRTPTG...................-----....-WVITYMDQLAD.ELL.......HQDRY...CG..I..ALPHLPKRDVLE---tag..................................................................
M5G439_DACPD/10-173                    ..............................................t-SVHGTNPQHLIETVIRSRIYE..S.LY.WKEHCFALTA................................-ETLIDKAIE-..LNCIGG..............-MYG.NQR.............................................-P.THFMCLLLKL.LQIQPEKE..........ILI.EYLL......................................................VEEFK..YLRALAAL....Y...I.....RLVFR........................PAEV....YE.LLE.....PL..LKDYR.KIRLRNMSG...................-----....-YVLTYMDEYID.ELL.......REERV...CD..I..ILPRMTKRDILEE--ve...................................................................
A0A0D2I6Q8_9EURO/20-185                ..............................................l--VRGQNPALLLETAMRDRITD..S.LY.WKEQCFGLNA................................-ATLCDRAVE-..LTYIGG..............-TYG.VAM.............................................KP.TPFICLAFKL.LTLVPDRE..........IVL.EYLQn....................................................gGEEWK..YLRALAAF....Y...V.....RLTFE........................PADV....YK.TLE.....PF..LEDSR.KLRQRRKES...................-----....-YVLIHMDEFVD.NLL.......TKDRV...CG..T..SLWKLPARQLLEDL-e....................................................................
A0A0N0U780_9HYME/67-183                ...........................................yvrg----------------------..-.--.----------................................-----------..------..............--VG.AGG.............................................IV.STAYCLLYKL.FTLRLTRK..........QLN.GLIN......................................................HLDSP..YIRALGFM....Y...I.....RYTQP........................PADL....FN.WYS.....DY..LEDED.---------...................ELDVKa..gGGQVMKMGDILK.QFL.......TKLEW...FS..T..LFPRIPVPIQKEL--eh...................................................................
A0A0G2FQ87_9PEZI/23-190                ............................................ltp---NGLNPANVMEKAVRERIVD..S.YF.FKEQCFGVNE................................-ADIVNRVVDH..VYFIGG..............-TYG.STQ.............................................KP.TPFLCIAFKL.LQLAPGDD..........ILK.EYLEy....................................................gGEKFK..YLRALAAF....Y...I.....RLTRR........................AKDV....YL.MLE.....PY..LEDKR.KLRRKGRAG...................-----....-TSLTYIDEFVD.DLL.......VKERV...CG..T..SLLKMPSRDLLEDL-d....................................................................
A0A0D2VLI7_GOSRA/2-93                  ..........................................kitmi----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.NYYG......................................................EINFR..YVRVLGAF....Y...L.....RLTGI........................DSDI....YR.YLE.....PL..YNDYR.KVRRKSPDG...................-----....NFMLTHVDEVID.ELL.......TRDYS...CD..I..ALPRIKKRWTLES--lg...................................................................
M4EH49_BRARP/4-168                     ..............................................i-QTNGRAYESLLEKVLSMNIVS..S.DY.FK-ELYGLKT................................YHEVIDEIYNQ..VSHVEP..............WMGG.NCR.............................................GP.STAYCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HTDSP..YIRAVGFL....Y...L.....RYVAD........................AKTL....WT.WYE.....PY..IKDDE.---------...................EFAPG...sNGRTTTMGVYVR.DLL.......LGLYY...FD..T..LFPRIPVPVMR----qivs.................................................................
F4RZW6_MELLP/10-173                    ..............................................l-SIHGTNPQFLIDKVVRSRIYD..S.QY.WKETCFALTA................................-ESIIDCAIS-..LKYVGG..............-TYA.NVR.............................................-P.TEFMCLALKL.LQLQPEKE..........IIL.EYLR......................................................AEEFK..YLRALAAF....Y...V.....RLTFT........................PLNV....YQ.TLE.....PL..LTDFR.KLRFRHMNG...................-----....SYSLVTFDDFVD.SLL.......VEERV...FE..I..VLPRLTMRK------vwkrl................................................................
U5FGX6_POPTR/3-167                     ..............................................i-QTNGKPIDSLLEKVLCMNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STSFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HKDSP..YIRAVGFL....Y...L.....RYAGD........................PKTL....WN.WFE.....PY..IKDDE.---------...................EFSPG...tSGRKTTMGVYVR.DLL.......LGQYY...FD..T..LFPRIPVPVMRQ---its..................................................................
A0A0Q3RIA5_AMAAE/10-175                ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LKYVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HEERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
K0KUA6_WICCF/15-175                    ............................................sth---KGQNSILLIEKIIRERIFD..S.LY.WKQYCFNVNA................................-ALILDRCVE-..IRCVGG..............--LE.TSG.............................................KP.MGFICLLVKL.IQLMPQRE..........IIE.FYLN......................................................QGKFK..YLKVLAMV....F...I.....RLVYR........................DGGL....--.-LK.....KQ..LNDYR.KVRLYEHGE...................-----....-YKLSYVDEIAD.KLL.......NDEMF...IG..L..NLPYMKTNGDD----esdd.................................................................
I1H1P3_BRADI/3-165                     ........................................iqssgrp-------IEVLMEKVLSMNIVS..S.DY.FK-ELYKIKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKL.FTMKLTMN..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYVAE........................PKTL....WT.WYE.....PY..IQDDE.---------...................EFSPG...sNGKMTTMGVYVR.DVL.......LGQYY...FD..S..LLPRVPL--------lilrqv...............................................................
S7NM55_MYOBR/1-94                      .............................................me----------------------..-.--.----------................................-----------..LRFMGG..............-IYG.GNL.............................................RP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVFMLGAL....Y...M.....RLTGT........................AIDY....YK.FLE.....PL..YNDYR.KIKSQNQNE...................-----....EFELIQV-----.---.......-----...--..-..---------------d....................................................................
U5GDA8_POPTR/33-124                    ............................................ysm----------------------..-.--.----------................................---------E-..LDHLGG..............-TYG.GNR.............................................KP.TPFMCLITKV.LQIQPEKD..........IVV.EFIK......................................................YEDYK..YVRVLGAF....Y...L.....RLTGT........................DIDV....YR.YLE.....PL..YNDYR.KLRQKLTDG...................-----....------------.---.......-----...--..-..---------------nysc.................................................................
A0A0L7QPS5_9HYME/37-221                ..............................................l-PLWGNERTMNLNPLILTNIQS..S.HY.FKVNLYELKT................................YHEVIDEIYYK..VSHLEP..............WEKG.SRKtagqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.FTLRLTRK..........QLN.GLIN......................................................HPDSP..YIRALGFM....Y...I.....RYTQP........................PADL....FS.WYS.....DY..LEDEE.---------...................ELDVKa..gGGQVMKMGDILK.QFL.......TKLEW...FS..T..LFPRIPVPIQKEL--eh...................................................................
H2N7E1_PONAB/19-176                    ..................................kylvekdhsnaks--------------------MS..S.KY.WKEECFGLTA................................-ELVVDKL-E-..LRFVGGv...........ygWAII.KTQ.............................................--.HPFLCLTL-M.LQIQPE-D..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
F0ULM3_AJEC8/21-214                    ..............................................l--IRGVNPATLFEKAVRDRITE..S.YY.WKEQCFGLNA................................-ATLCDRAAE-..LSYIGG..............-TYG.LAQ.............................................KP.TPFLCLAFKL.LQLAPEKE..........IVL.EYLNfhdpenghvegsemn........................gleeeqggasgvvkaVGDFK..YLRALAAF....Y...I.....RLTFD........................AADI....YK.SLE.....PL..LTDYR.KLKRRMKDG...................-----....-FVLTYIDQFVD.DLL.......TKDRV...CG..T..SLWKLPSRHQLEDL-d....................................................................
A0A0N4ZGG7_PARTI/6-171                 ..............................................k-TIRGTRSTFLIEKIIRTRINE..S.LY.WKEECFGLSA................................-ETVIDKGAD-..LRYVGG..............-IYA.GNT.............................................KP.TPFLCLMLKL.LELAPEKE..........IIV.EYIE......................................................QEDFK..YIRALGAM....Y...I.....RLTFP........................SVEV....YK.YLE.....PI..YSDYR.KLRYMNRMG...................-----....RFELMYMDEFID.RLL.......NEELF...CD..I..HLPKLQGRQLLEQN-d....................................................................
M0T4J1_MUSAM/3-166                     ..........................................iqtsg-----KPIDSLLEKVLSMNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKTL....WT.WYE.....PY..IKDDE.---------...................EFSPG...sNGRLTTMGVYVR.DLL.......LGQYY...FD..T..LFPRVPVPVVR----qiv..................................................................
H3CJ03_TETNG/10-177                    ..............................................n-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LKFVGG..............-VFG.GNI.............................................KP.TPFICLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRLLGAM....Y...M.....RLTGT........................AVDC....YK.YLE.....PL..YNDYR.KVKTQNRNG...................---DS....EFELMHVDEFID.QLL.......HSERI...CD..I..ILPRLQKRHVLEET-e....................................................................
Q18942_CAEEL/10-175                    ..............................................k-TVKGTNPQFLVEKIIRQRIYD..S.MY.WKEHCFALTA................................-ELVVDKGMD-..LRYIGG..............-IYA.GNI.............................................KP.TPFLCLALKM.LQIQPDKD..........IVL.EFIQ......................................................QEEFK..YIRALGAM....Y...L.....RLTFD........................STEI....YK.YLE.....PL..YNDFR.KLRYMNKMG...................-----....RFEAIYMDDFID.NLL.......REDRY...CD..I..QLPRLQKRWALEE--vd...................................................................
F7GLJ8_MONDO/12-196                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
A0A096MRX0_PAPAN/10-175                ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A024TH67_9STRA/55-219                ..............................................l-PIHGNQSTYNFNTLLYDNVMN..S.DY.FR-KLYELTT................................YHEVVDEIYYR..VDHAEP..............WAAG.TSR.............................................IP.STCFCLLMKF.CTMRLTIN..........QMQ.GLLK......................................................HVDSP..YIRCVGFL....Y...L.....RYTCD........................PELL....WE.WYE.....PY..LGDDE.---------...................EFNASs..nDAIRTTMGAWIR.SLL.......EDINY...FN..T..ILPRIPKKIQ-----dgik.................................................................
A0A0P1ARE8_9STRA/37-201                ..............................................l-SIHGNDTTYNLNTLLHQNILQ..S.AY.FH-ELYKFKT................................YHEVVDEIYYR..VDHAEP..............WSPG.TAR.............................................IP.SSCFCLLHKF.CLMRLTRK..........QMQ.GLLR......................................................HKDSP..YIRVVGFL....Y...L.....RFTCD........................PDEL....WT.WFE.....PY..LEDSE.---------...................EFNASa..nPSIKTTIGEWLI.RLL.......EENNY...FG..T..ILPRIPKKIE-----dgik.................................................................
A0A0K0J8G0_BRUMA/10-175                .............................................vt--VKGTNPQYLVEKIIRTRIYD..S.KY.WKEECFALTA................................-ELLVDKGME-..LRYIGG..............-IYA.GNV.............................................KP.TPFLCLCLKM.LQIQPEKD..........IAV.EFIR......................................................QEEYK..YIRALGAM....Y...I.....RLTFT........................SIEV....YK.YLE.....PL..YNDYR.KLRMMNNEG...................-----....RFEIVHMDEFID.SLL.......RDERY...CD..I..HLPRIQKRITLEE--vg...................................................................
F4PGM1_DICFS/1-133                     ............................................mrg----------------------..-.--.----------................................VNEVIDEIYNK..VEYLCP..............YIPG.T-K.............................................TP.SSAYCLLYKL.YTLKLTEE..........HME.TLIF......................................................HGDSP..YIRAIGFL....F...L.....RYAHP........................PASL....WD.WFN.....EC..LDDQE.---------...................LIAIS...pKSKPITMELFLL.GLL.......KEQKF...AE..T..ILPRIPVKVMKEL--eq...................................................................
A0A094CWW4_9PEZI/22-189                ............................................lap---NGLNPATIFEKPVRERIID..C.YF.WKDQCFALNE................................-ADIVSRVVEH..VQFVAG..............-TYG.DSQ.............................................RP.SPFLCLAFKL.LQLGPGDD..........ILK.EYLEy....................................................gGEKFK..YLRALACF....Y...V.....RLTRP........................AKEV....YE.TLE.....PF..LEDAR.KLRRRGRQG...................-----....-TSLTFMDQFVD.ELL.......TKERV...CA..T..SLWKMPKREVLEDL-e....................................................................
A0A093GLK3_PICPB/50-234                ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKTI--dq...................................................................
W5DV57_WHEAT/3-53                      .............................................iq--TSGKPIDMLMEKVLCMNILS..S.DY.FK-ELYQMKT................................YHEVIDEIYNQ..VDHVEP..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------.....................................................................
K6VGZ7_9APIC/165-327                   ............................................lem----TNTTTYNVNTLLRNNILS..S.EY.FR-SLVPMKT................................FKEVVDEIHLY..ADHVEP..............YCIG.STR.............................................AP.STLFCCLYKL.FTMHLSEK..........QMK.VLIE......................................................SRDSC..YIRACGFL....Y...L.....RYVHS........................PANL....WM.WFE.....PY..LLDED.-LFVTSAD-...................-----....KRKKQTIGEYIQ.CLL.......ADDKY...FN..T..VLPRMPIKIK-----nty..................................................................
E9GQD3_DAPPU/32-216                    ..............................................l-PIWGNERTMNLNPLILTNIQT..S.HY.FKTNLSELKT................................YHEVVDEIYYK..VQHLEP..............WEKG.SRKtsgqtgmcg...........................gvrgvgaggIV.STPYCLLYKL.FTLKLTRK..........QLI.GLIT......................................................HCDSP..YIRGLGFM....H...I.....RYTQP........................PADL....FG.WFQ.....PY..LEDEE.---------...................EIDPKa..gGGHPMTIGTMVR.QLL.......TKLDW...YD..S..LFPRIPVPIQINI--dr...................................................................
J4DQ33_THEOR/129-289                   ............................................lpm----TNSMTYNMNDLLRNNILT..S.EY.YK-SL-SVKT................................FYDVVNELVQF..GSHCEP..............YCST.STR.............................................AP.STMFCCLYKF.FTLKLTEK..........QMV.TLLD......................................................HNKSP..YPRCCGFL....Y...L.....RYVLP........................PDKL....WS.WYE.....PY..FLDEE.---------...................EFTVSs..dGNKKTTVGEFAE.SLI.......MDDKY...YN..T..VLPRLPVRVK-----nl...................................................................
A0A0N4TPH1_BRUPA/47-231                ..............................................l-PLWGNTQTMNLNALVLENIIQ..C.TY.YKNYLAETTG................................FQQLTEEIYYS..VKHLEP..............WERG.TRKtqgmtgmcg...........................gvrgvgaggVV.STAFCLLYKL.FTIRLSRK..........QLV.SMIN......................................................NSDSP..YIRGIGFM....Y...I.....RFCQP........................PQDL....WA.WME.....PY..LDDEE.---------...................QIDPRs..gGGDVMVMAQVVK.MML.......TKLDW...YG..T..LFPRIPVPIQKEI--el...................................................................
S9XCT7_CAMFR/1-124                     .............................................me----------------------..-.--.----------................................-----------..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IVV.EFIR......................................................NEDFK..YVCMLGAL....Y...M.....RLTGT........................AVDY....YK.YLE.....PL..YSNYR.KIKSQNRNG...................-----....EFELVRVDEFID.ELL.......HSERV...CD..I..ILPQLQKRYVLEEA-e....................................................................
A0A0C3QJB6_9HOMO/10-173                ..............................................v-QIHGANPQFLVEKIIRTRIWE..S.NY.WKEHCFALTA................................-ETLIDKAIE-..LKYIGG..............-VYG.NQR.............................................-P.TEFISLLLKL.LQIQPEKE..........ILV.EYLL......................................................VDEFK..YLRALAAM....Y...I.....RMTFR........................PVEV....FE.LLE.....PL..LKDFR.KLRVRSMAG...................-----....-YTLTYMDEFVD.QLL.......TEERV...CD..I..ILPRLTKREVLEET-e....................................................................
A0A017SNM0_9EURO/21-202                ..............................................l--VRGVNPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAIE-..LSSIGG..............-TYG.VSE.............................................KP.TAFLCLAFKM.LQLNPTRD..........IVL.EYLNfsdpgsdde....................................dqdnevlqnRGDFK..YLRALAAF....Y...V.....RLTFD........................AVDV....YK.TLE.....PL..LLDYR.KIKRRVRDS...................-----....-FVLTYMDQFVD.DLL.......TKERM...CG..T..SLWKLPSRQQLEDL-e....................................................................
I1BHD0_RHIO9/11-174                    .............................................tg--IHGRHPLHLVEKIIRERIQE..S.IY.WKEKCYGLTA................................-ATLTERAVD-..VDYIGG..............-MYG.NLQ.............................................-P.TEFICLLLKL.LQLLPEKE..........III.EFVK......................................................QEDFK..YLRALGAF....Y...L.....RLTGK........................SKEI....YQ.YLE.....PL..LNDYR.KLRARGKEG...................-----....-FSLTYMDVFVD.DLL.......TKDRV...CD..I..ILPRIMARHVLEQN-d....................................................................
F6UK93_HORSE/47-231                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
A0A165T9L8_9HOMO/10-173                ..............................................q-AIHGQNPQYLVETVIRNRIYE..S.PY.WKEECFALTA................................-ETLIDKAIE-..LKFIGG..............-VYG.N-Q.............................................KP.TQFLCLLLKL.LQIQPEKE..........ILV.EYLQ......................................................ADEFK..YLRALAAL....Y...V.....RMTFR........................SAEV....YG.ILE.....PL..LKDYR.KLRYRNMGG...................-----....-YHLTYMDEFVY.SLL.......REERV...CD..I..ILPRLAKRSVLEE--tg...................................................................
T1EDF2_HELRO/10-175                    ..............................................a-TVKGTNPQYLIEKIIRTRIYE..S.KF.WKEECFALSA................................-ELLVDKAME-..LKYLGG..............-VYA.GNV.............................................KV.SPFLCLILKM.LQIQPEKD..........IIV.EFIT......................................................QPDFK..YVRALGAL....Y...M.....RLTGT........................SLDC....YK.YLE.....PL..YLDYR.KLKRMDRNG...................-----....LFDLVHMDEYVD.DLL.......REERI...LD..I..ILPRIQKRHVLEE--mn...................................................................
H1VMK2_COLHI/24-191                    ............................................lap---NGENPATIMEKAVRERIVD..S.YF.YKEQCFAVNE................................-ADIVDRVVEH..VTFVGG..............-TYG.VTQ.............................................KP.TPFLCLAFKL.LQLAPSDD..........VLE.AYLGl....................................................gGEKFK..YLRALACF....Y...V.....RMTRK........................ARDV....YL.LLE.....PF..LEDRR.KLRRKGRQG...................-----....-TSLTYMDDFVD.DLL.......TKTRV...CA..T..SFRELPKRSDLVD--ld...................................................................
A0A0D0BI99_9AGAR/10-173                ..............................................k-AIHGQNPQYLVETVIRNRIYE..S.TY.WKEHCFALTA................................-ESLIDKALD-..LKFIGG..............-VYG.NQR.............................................-P.TEFLCLLLKL.LQIQPEKE..........IMI.EYLR......................................................AEEFK..YLRALAVM....Y...I.....RMTFR........................AVEV....YE.LLE.....PL..LKDYR.KLRMRNMAG...................-----....-YTLTFIDEFVD.ALL.......TEERV...CD..I..ILPRLIKRQVLEEN-n....................................................................
A0A067CBH5_SAPPC/9-173                 ..............................................t-HVHGVNPQHLVEKILRNRIYD..C.MY.WKEHCFGLTE................................-ETLVEKAIE-..LSYIAG..............-HFG.GNQ.............................................QP.SPFLCLLLKM.LQMQPDMD..........VVM.TFIE......................................................NGDYK..YVTALGAM....Y...L.....RLTGK........................PVEI....YP.VLE.....NL..LSDYR.KVRFRKTMG...................-----....-WDVLHMDEVAD.LLL.......REEYF...CN..I..ALPRLVDRFQLET--mn...................................................................
G1LRX0_AILME/10-175                    ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A0L0BU41_LUCCU/26-210                ..............................................l-PLWGNESTMNLNPLILANIQS..S.SY.FKVHLFKLKT................................YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.YTLRLTRK..........QVN.GLIN......................................................HTDSP..YIRALGFM....Y...L.....RYTQP........................PADL....YD.WYE.....DY..LQDEE.---------...................EIDVKa..gGGQTITMGQMVY.QFL.......TKLDW...FS..T..LFPRIPVPIQKQIE-k....................................................................
Q17D08_AEDAE/10-175                    ...............................................KNVHGTNPQYLIEKIIRSRIYD..S.KY.WKEQCFALTA................................-ELLVDKAMD-..IRYLGG..............-VFG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IVV.EFIK......................................................NEEFK..YVRALGAF....Y...L.....RLTGS........................SLDC....YK.YLE.....PL..YNDNR.KLRRQNRLG...................-----....HYELVHMDEFID.ELL.......REERA...CD..I..ILPRIQKRHVLEEN-n....................................................................
A0A0D3C5H0_BRAOL/10-175                ...............................................KNIRGTNPQNLVEKIVRTKIQN..H.TF.WKEQCFGLTA................................-ETLVDKAME-..LDHVGG..............-TFG.GNR.............................................KP.TPFLCLVLKM.LQIQPEKE..........IVV.EFIK......................................................NDDYK..YVRVLGAF....Y...L.....RLTGS........................DVDV....YR.YLE.....PL..YNDYR.KVRQKLADG...................-----....RFSLTHVDEVIE.ELL.......TKDYS...CD..I..AMPRLKKRCTLEQN-g....................................................................
A0A0L8GDQ2_OCTBM/1-80                  ...............................................----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................---FR..YVRALGAM....Y...M.....RLVGT........................SLDC....FK.YLE.....PL..YNDYR.KLRRQNKSG...................-----....EFEIVHMDEFID.ELL.......REERI...YD..I..ILPRIQKRNVLEDT-n....................................................................
D7LFT1_ARALL/10-175                    ...............................................KNIRGTNPQNLVEKIVRTKIYQ..H.TF.WKEQCFGLTA................................-ETLVDKAME-..LDHLGG..............-TFG.GSR.............................................KP.TPFLCLILKM.LQIQPEKE..........IVV.EFIK......................................................NDDYK..YVRILGAF....Y...L.....RLTGT........................DVDV....YR.YLE.....PL..YNDYR.KVRQKLADG...................-----....RFSLTHVDEVIE.ELL.......TKDYS...CD..I..AMPRLKKRWTLEQN-g....................................................................
C4R8X3_KOMPG/19-184                    ..............................................e-KIHGVNPVFLIDKILREKILD..S.LF.WKKHCFLLDI................................-LELQDLASE-..VEIIGT..............YDTN.QNS.............................................RA.TDYICLLLKM.LQLQPKDE..........IVI.YMLT......................................................QPYFK..YVTALAAL....Y...I.....RLVFP........................SVRV....YQ.LLE.....PL..LNDYR.KLRIRKHGN...................-----....-ADLTYVDQLVD.ELL.......TEEKF...CG..L..TLPRLVNRLRLEDD-g....................................................................
A0A0V0TYM9_9BILA/59-224                ..............................................a-SLKGTNPQYLIEKVTRSRIYD..S.RY.WKEECFALSA................................-ELLVDRGME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLLLKM.LQIQPEKD..........IVI.EFIR......................................................QEDSK..YIRALGAL....Y...L.....RMTFS........................YVEV....YK.YLE.....PL..LNDYR.KLRWINKQG...................-----....KFELIHMDEFVD.KLL.......REERF...CD..V..QLPRLQKRAFLEE--tn...................................................................
E1ZNW2_CHLVA/10-175                    ..............................................a-AIHGTNPQNLIEYISRQKIYD..S.IY.WKQECFGLSA................................-ERLVDKAVE-..ITEVGG..............-MQG.EPQ.............................................KP.THFICLILKM.LQIQPDKD..........IVV.EFIK......................................................NDDFK..YLRLLGAF....Y...M.....RLVGR........................PLDV....YQ.YLE.....PL..YNDYR.KVRIRNFQG...................-----....RQELGHVDELID.AML.......HKDRL...FG..I..ALPRLPARTTLE---gag..................................................................
G3PQV2_GASAC/24-208                    ..............................................l-PLWGNEKTMNLNPMILTNVLS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHAEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QLM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PADL....ID.WYD.....GF..LDDEE.---------...................ELDVKa..gGGCVMTVGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKL---idq..................................................................
A0A0S7E150_9EURO/21-209                ..............................................l--VRGVNPSTLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LTSIGG..............-TYG.VAE.............................................KP.TPFLCLAFKL.LQLNPERE..........IIL.EYLNytdpgsdeetea.............................taeeqarngvlgqRGDFK..YLRALAAF....Y...V.....RLTFD........................PVDV....YK.TLE.....PL..LLDYR.KLKRRVRDT...................-----....-FVLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKLPARQQLEDL-d....................................................................
K9FM30_PEND2/21-204                    ..............................................l--IRGVNPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LTSIGG..............-TYG.VSE.............................................KP.TPFLCLAFKL.LQLGPDRD..........VIL.ELLNytdpgsgdea..................................enpddalvkdRGDFK..YLRALAAF....Y...V.....RLTFD........................PVDV....YK.TLE.....PL..LLDYR.KLKRRVRDN...................-----....-FTLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKLPPRSQLEDL-d....................................................................
A0A067DBD0_CITSI/1-27                  ...............................................----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..----IGFL....Y...L.....RYAAD........................PKTL....WN.WFE.....QY..LKDEE.---------...................-----....------------.---.......-----...--..-..---------------.....................................................................
D8LU65_ECTSI/4-146                     ..............................................r----------------------..-.RY.WKEHCFGLTA................................-ETLVDKAMM-..LTHLGG..............-TFG.GNQ.............................................QP.TKFLCLVLKM.LQIQPEKE..........III.EFIK......................................................NEDYK..YVRVLGAF....Y...L.....RLVGT........................PADI....YQ.YLE.....PL..YNDYR.KIRLRLTQG...................-----....-WELRTIDQQIE.ELL.......HSDIS...CS..I..ALPRLPKRVALEDS-k....................................................................
H2PZJ2_PANTR/47-231                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
K2R9I0_MACPH/20-208                    .............................................al--IRGQNPALLFEKAVRDRITE..S.YY.WKEQCFGLNA................................-ATLCDRAAE-..LTYIGG..............-TYG.GMG.............................................KA.TPFLCLAFKL.LQLVPEKE..........IIL.AYLNwpedeergsgdd..............................gededesrvpgtKGEFK..YLRALAAF....Y...I.....RLAWE........................PVEI....YK.TLE.....PL..LADYR.KLKRRMRDG...................-----....-FVLTFVDQFVD.DLL.......TKDRV...CA..T..SLWKLPPRTLLEDL-d....................................................................
A0A067GPW5_CITSI/2-84                  .............................................ti----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................--TSK..YVRVLGAF....Y...L.....RLTGT........................DIDI....YR.YLE.....PL..YNDYR.KLRQKSGDG...................-----....RFILTHVDEVID.ELL.......TKDYS...CD..I..ALPRIKKRWNLET--vg...................................................................
A0A0C3BMH8_9HOMO/10-173                ..............................................l-SIHGVNPQSLVETVIRNRIYE..S.GY.WKEHCFALTA................................-ESIIDKALE-..LRCIGG..............-VYG.NQR.............................................-P.TEFLCLLLKL.LQIQPEKE..........ILV.EYLQ......................................................ADEFK..YLRALAAM....Y...I.....RLTFR........................AVDV....YE.MLE.....PL..LKDYR.KLRNRDMGG...................-----....-YSLTFMDEFVD.QLL.......TEERV...CD..I..ILPRLAKRQVLEEN-g....................................................................
A0A0C2DPA8_9BILA/1-62                  ...............................................----------------------..-.--.----------................................-----------..------..............----.---.............................................--.---------M.LQIQPEKD..........III.EFIQ......................................................QEQSK..YARALGAM....Y...L.....RLTFT........................SVEI....YK.YLE.....PL..FNDYR.KLRYMNKQG...................-----....------------.---.......-----...--..-..---------------s....................................................................
A0A0V1M198_9BILA/10-97                 ..............................................a-SLKGTNPQYLIEKVTRSRIYD..S.RY.WKEECFALSA................................-ELLVDRGME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLLLKM.LQIQPEKD..........IVI.EFIR......................................................QEDSK..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------.....................................................................
H3G9C3_PHYRM/9-173                     ..............................................l-SVHGVNPQTLVEKIMRNRIYA..S.IY.WKEQCFGLTA................................-ETLVDKAVE-..LSDFGG..............-TFG.GNQ.............................................QP.TPFLCLLLKM.LQLQSEIE..........VVK.QFVE......................................................NEDYK..YVTVLGAV....Y...L.....RLVGK........................PADV....YT.LLE.....PL..LSDYR.KIRKRNVIG...................-----....-WEITHVDEIAD.ALL.......TEEYY...ID..L..TLPRLVDRGLLEK--ne...................................................................
X0BDR0_FUSOX/26-192                    .............................................ap---NGLNPATIMEKAVKDRIVD..S.YF.YKEQCFALNE................................-ADIVDRVVEH..VNFIGG..............-TYG.VTQ.............................................KP.SPFLCLAFKL.LELSPSDA..........VLM.EYLKy....................................................gGEAFK..YLRALACF....Y...F.....RLTRQ........................AKDV....YE.MLE.....PF..LEDRR.KLRRRGRAG...................-----....-VVLTFMDEFVD.ELL.......TKERV...CG..T..SLWKMPKREVLEDL-e....................................................................
A0A091CPG3_FUKDA/10-175                ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0CFN0_PARTE/86-247                    ..............................................i-PIRGENAISNMNSLVRQNILT..C.PY.YK-ELLQIRD................................INDIVTETDKI..VTSVGT..............WAG-.-PG.............................................VP.SSFFCILHKL.MSMNLNVK..........QLQ.ILCD......................................................WKLNP..YVRCLGLL....Y...L.....RYSLD........................PNFL....WG.WMK.....RY..ILDEQ.---------...................EFKPS....KDENITIGDFCE.RLL.......TDLNY...YN..T..RLPRIPQQIDT----iiqa.................................................................
V4NLP3_EUTSA/4-168                     ..............................................i-QTNGRAYESLLEKVLSMNILS..S.DY.FK-ELYGLKT................................YHEVIDEIYNQ..VNHVEP..............WMGG.NCR.............................................GP.STAYCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HTDSP..YIRAVGFL....Y...L.....RYVAD........................AKTL....WT.WYE.....PY..IKDDE.---------...................EFAPG...sNGRMTTMGVYVR.DLL.......LGLYY...FD..T..LFPRIPVPVMR----qivs.................................................................
A0A0M9VNM6_9BASI/10-174                ..............................................l-SIHGTNPQFLVERVIRTRIYD..S.TY.WKQDCFALTA................................-ATLVDKAAE-..LTYVGG..............-TYG.MLR.............................................-P.SPFLCLVCKL.LQIQPEKS..........VIE.EYLA......................................................ADDLK..YLRAVAAM....Y...V.....RLTYP........................SMDV....YE.TLE.....PM..LNDYR.KLRWRDMTG...................-----....QYSLSHMDEFID.QLL.......TEERV...CD..L..ILPRLTKRTVLEAN-e....................................................................
L9KRH9_TUPCH/54-238                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
K4BPW0_SOLLC/5-167                     .......................................ktsgrpid---------QLLEKVLCMNILS..S.DY.FR-DLLRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYLGD........................FKTL....WG.WYE.....PY..LKDDE.---------...................EFSPG...sSGQMTTMGVYVR.DLF.......LGQYY...FD..T..LLPRIPVPVV-----rtav.................................................................
A0A061DDF0_BABBI/167-343               ............................................lpm----TNSSTYNLNTLLLSNILN..S.EY.YK-SLSAINS................................YVDVMNELIQY..ADHAEP..............YCST.ATR.............................................AP.STLFCCLHKL.FTLRLTER..........QMT.ALVD......................................................CPKSP..YPRCCGFL....Y...L.....RFVLPsdqvrsl..........ngavmswPPQL....WD.WFE.....PY..LMDDE.---------...................SFVVSa..hPTRKTTIGEFCE.RLL.......VDDKY...FN..T..VLPRLPMRFK-----nrh..................................................................
E4UUK9_ARTGP/21-208                    ..............................................l--IRGVNPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LSYIGG..............-TYG.---.............................................--.---------L.LQLAPEKE..........VIL.EYLDfhdpeadeedsnakgdnsg................aegnvedaqdradaailkaTGDFK..YLRALAAF....Y...V.....RLTFE........................PVEI....YK.TLE.....PL..LTDYR.KLKRRTKEG...................-----....-FLLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKIPARTMLEDL-d....................................................................
A0A0P7UWJ7_9TELE/10-175                ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LKYVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRLLGAM....Y...M.....RLTGS........................SVDC....YK.YLE.....PL..YNDYR.KIKTQNRNG...................-----....EFELMHVDEFID.ELL.......HGERV...CD..V..ILPRLQKRQVLEEA-e....................................................................
A0A177E1V1_ALTAL/23-227                .............................................al--IRGQNPALLFEKGVRERITE..S.YY.WKEQCFGLNA................................-ATLCDRAAD-..LKFIGG..............-TTG.ITG.............................................KP.TPFLCLAFKM.LQLVPDKE..........IIL.EYLNfrddeedegqdaevkkeeng..............htsededatkkaldlnaagkLGDFK..YLRCLAAF....Y...I.....RLAWE........................PVEI....YQ.TLE.....PL..LTDYR.KIKRRLKDA...................-----....-FTLTHVDQFID.DLL.......TKDRI...CA..T..SLWKLPSRANLEDL-d....................................................................
C1ML42_MICPC/10-175                    ..............................................r-SINGLNPQAIIEKITRTKIYE..S.PF.WKERCFGVSA................................-ATLVDLAMN-..LRAFGG..............-VYG.SSS.............................................KA.TDFLCLTLKM.LQIQPDKE..........VIL.EFIK......................................................NEDCK..YVRILGAF....Y...L.....RLVGK........................SFEV....YQ.LLE.....PL..LLDYR.KIRHQTSQG...................-----....NFELMHVDEFVS.ALL.......TRDNF...CD..I..SLPRLTHRQLLET--sg...................................................................
A0A0L8HZH2_OCTBM/7-191                 ..............................................l-SIWGNEKTMNLNTLILTNIQS..S.PY.FKVNLYELKT................................YHEVIDEIYYK..VSHLEP..............WEKG.SRKtagqtgmcg...........................gvrgvgaggIV.SSAFCLLYKL.FTLRLTKK..........QVN.GLIS......................................................HQDSP..YIRALGFM....Y...I.....RFTQP........................PQEL....WD.WFE.....PY..LDDEE.---------...................EIDVKa..gGGHSMTIGEMLR.HWL.......TKLEW...YS..T..LFPRIPVPTQKD---lde..................................................................
A0A166WPY7_9PEZI/24-191                ............................................lap---NGENPATIMEKAVRERIID..S.YF.YKEQCFAVNE................................-ADIVDRVVEH..VSFIGG..............-TYG.VTQ.............................................KP.TPFLCLAFKL.LQLAPSDD..........VLE.TYLKi....................................................gGEKFK..YLRALACF....Y...I.....RMTRK........................ARDV....YL.LLE.....PF..LEDRR.KLRRKGRQG...................-----....-TSLTYMDDFVD.DLL.......TKTRV...CA..T..SFRELPKRSDLVD--ld...................................................................
F7AMT8_CALJA/47-190                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.---------...................-----....------------.---.......-----...--..-..---------------hftl.................................................................
A0A162YZJ2_MUCCL/1-163                 ..............................................s--IHGRHPLHLIEKIIRERIQN..S.LY.WKEKCYGLSA................................-ATLMDRAFE-..LEYIGG..............-MYG.NHQ.............................................-P.TEFLCLTLKL.LTLLPEKD..........III.ELIK......................................................QEEVK..YLRALGAF....Y...L.....RLTGK........................SKEI....YQ.YLE.....PL..LNDYR.KLRVRAGDG...................-----....-YSLTHMDSFID.DLL.......HKDRV...CD..I..ILPRLTSRYVLEQN-d....................................................................
E7QER7_YEASZ/15-219                    ...............................................KQLNNQSVSLVIPRLTRDKIHN..S.MY.YKVNLSNESLrg............................ntMVELLKVMIGA..FGTIKGqng.......hlhmMVLG.GIE.............................................--.--FKCILMKL.IEIRPNFQ..........QLN.FLLNvk.................................................nenGFDSK..YIIALLLV....Y...A.....RLQYYylngn.............nkndddENDL....IK.LFKvq.lyKY..SQHYF.KLKSFPLQVdc...............faHSYNE....ELCIIHIDELVD.WLA.......TQDHI...WG..I..PLGKCQWNK------iynsde...............................................................
W4IT64_PLAFP/11-175                    ............................................knf----GSNPQYLISNIIRSKIYD..S.PY.WKEKCFALTS................................-ESIIDQAIN-..LKYVGG..............-TYG.GNR.............................................KP.TRFLCLILKL.LQIQPDKD..........IIY.EYIK......................................................NEDFV..YLRALGIF....Y...L.....RLIGK........................SLEV....YN.HLE.....PI..LFDYR.KIRMRLQNG...................-----....TFEKIYMDVFVD.NCL.......ILNNF...LD..V..DFPTLTKRQVLEEN-n....................................................................
E2B9R7_HARSA/37-220                    ..............................................l-PLWGNERTMNLNPLILTNIQS..S.HY.FKVNLYELKT................................YHEVIDEIYYK..VSHLEP..............WEKG.SRKtagqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.FTLRLTRK..........QLN.GLIN......................................................HPDSP..YIRALGFM....Y...I.....RYTQP........................PADL....FS.WYS.....DY..LDDEE.---------...................ELDVKa..gGGQTMKMGDILK.QFL.......TKLEW...FS..T..LFPRIPVPIQKD---le...................................................................
A0A0R3S653_9BILA/10-175                .............................................vt--VKGTNPQYLVEKIIRTRIYD..S.KY.WKEECFALTA................................-ELLVDKGME-..LRYIGG..............-IYA.GNV.............................................KP.TPFLCLCLKM.LQIQPEKD..........IAV.EFIR......................................................QEEYK..YIRALGAM....Y...I.....RLTFT........................SIEV....YK.YLE.....PL..YNDYR.KLRIMNNDG...................-----....RFEIVHMDEFID.SLL.......REERY...CD..I..HLPRIQKRITLEE--vg...................................................................
A0A183NJV6_9TREM/6-148                 ...................................ryiefifyfvlc----------------------..-.--.--------KA................................-ELLVDKAVE-..LRYVGG..............-VYS.GSV.............................................KP.TPFLCLTLKM.LQIQPDKD..........IVI.EFIK......................................................--QEP..YKLVCGAF....Y...L.....RLVGD........................SVEI....YK.YLE.....TL..YNDFR.RLKFQDKMG...................-----....NFSLIYMDDFID.QLL.......TEERV...CD..V..ILPRLQKREVLEE--ln...................................................................
S9VCB1_9TRYP/46-244                    .............................................wn--LQGRSAFAVLDPTTRHRIAH..A.HN.MT-RCRDQPL................................-LWVLEELIT-..IESVGG..............-LSG.PLF.............................................RV.EYFLCLVARV.LQAAPDPA..........VVL.ALLR......................................................QDVHK..YLRVAALF....M...I.....RLIGN........................VAMQ....KE.AVR.....VG..WDDYR.KIRVYGDEG...................EVD--....------------.---.......-----...--..-..---------------yvfdatlrgrkhpreaaegeqppvnieeakpahyfilcmdeltdrlfrvdsdgekrsqffgvplpplmf
A0A0B2S496_GLYSO/4-166                 .......................................qtcgrpid---------SLLEKVLCMNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAVGFL....Y...L.....RYCAD........................PKTL....WN.WFE.....SY..VKDDE.---------...................EFSPG...sNGRMTTMGVYVR.DLL.......LGQYY...FD..T..LFPRIPVPV------lrqvv................................................................
A0A091J8Z8_9AVES/22-206                ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHIEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKTI--dq...................................................................
A0A0W8CIY7_PHYNI/9-173                 ..............................................q-SVHGVNPQTLVEKIMRNRIYA..S.IY.WKEQCFGLTA................................-ETLVDKAVE-..LQEFGG..............-TFG.GNQ.............................................QP.THFLCLLLKM.LQLQPELE..........VVK.QFIE......................................................NEDYK..YVTVLGAV....Y...L.....RLVGK........................PLEV....YT.LLE.....PL..LSDYR.KIRKRNVIG...................-----....-WEITHVDEIAD.ALL.......HEEYY...ID..L..ALPRLADRELLEKN-e....................................................................
A0A0C9UAC3_9HOMO/10-173                ..............................................q-SIHGQNPQSLIEYVIRTRIYE..S.QY.WKEHCFALTA................................-ETIIDKAIE-..LKYIGG..............-VYG.NNK.............................................-P.TEFICLILKL.LQIQPEKE..........ILV.EYLL......................................................VDEFK..YLRALAAM....Y...I.....RMTFR........................AVDV....YD.LLE.....PL..LKDFR.KLRLRSMAG...................-----....-YIPTFMDEFVD.QLL.......TEDRV...CD..I..ILPRLPKRETLED--lg...................................................................
A0A177WV65_BATDE/5-132                 ..............................................i-EIWGNKETMNIHNILYLNIMS..S.RY.FK-SLYEKKT................................YHEVIDEIYYN..VSSLEP..............FFKG.TNA.............................................--.TSAFCLLYKL.FTLKLTEK..........QLE.GLLD......................................................HPDSP..HIRALGFL....Y...L.....RYAGQ........................PSQI....WD.WFE.....PY..LDDTE.EL-------...................-----....------------.---.......-----...--..-..---------------pvrggph..............................................................
A0A0D7AAP4_9AGAR/10-183                ..............................................q-AIHGQNPQYLVETVIRNRIYE..S.SY.WKEHCFALTVcvgs.......................yhgypAESIIDKAIE-..LRAIGG..............-VYG.NQR.............................................-P.TEFLCLLLKL.LQIQPEKE..........ILV.EYLQ......................................................ADEFK..YLRALSAM....Y...V.....RMTFR........................AVDV....YE.LLE.....PL..MKDYK.KLRVRNTAG...................-----....-YSLTYFDEFVD.NLL.......NEERV...CD..I..ILPRIPRRQILEEN-g....................................................................
B3SEX8_TRIAD/10-175                    .............................................vt--VKGTNPQYLVEKITRSRIYE..C.KY.WKEKCFAVTA................................-ELLVDRAME-..LDHIGG..............-TFG.GNI.............................................KP.TPFLCLILKM.LQIQPEKD..........IIV.EFIK......................................................NEDYK..YVRALGAI....Y...M.....RLVGT........................SNDC....YN.YLE.....PL..YNDFR.KLKRKQRSG...................-----....QFQVIHMDEFVE.ELL.......TEDRA...CD..T..ILPRIQKRYILEQ--tn...................................................................
N6TV19_DENPD/10-175                    ...............................................KSIHGTNPQYLVEKIIRSRIYD..S.KY.WKEECFALTA................................-ELLVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IVV.EFIK......................................................NEEFK..YVRALGAF....Y...M.....RLTGS........................SLDS....YK.YLE.....PL..YNDNR.KLRRQNRQA...................-----....QFELVHVDEFID.ELL.......REERV...CD..V..ILPRLQKRHILEEN-n....................................................................
A0A0N5AD73_9BILA/46-230                ..............................................l-PLWGNTQTMNLNALVLENIIQ..C.TY.YKNYLAEATG................................FQQLTEEIYYN..VKHLEP..............WERG.TRKtqgmtgmcg...........................gvrgvgaggVV.STAFCLLYKL.FTIRLTRK..........QLV.SMIN......................................................NRDSP..YIRGIGFM....F...I.....RFCQP........................PIDL....WA.WME.....PY..LDDEE.---------...................QIDPRs..gGGDIMTMGQVVK.MML.......TKLDW...YG..T..LFPRIPVPIQKEIE-q....................................................................
A0A158Q7H4_9BILA/47-231                ..............................................l-PLWGNTQTMNLNALVLENIIQ..C.TY.YKNYLSETTG................................FQQLTEEIYYS..VKHLEP..............WERG.TRKtqgmtgmcg...........................gvrgvgaggVV.STAFCLLYKL.FTIRLSRK..........QLV.SMIN......................................................NSDSP..YIRGIGFM....Y...I.....RFCQP........................PQDL....WA.WME.....PY..LDDEE.---------...................QIDPRs..gGGDVMVMAQVVK.MML.......TKLDW...YG..T..LFPRIPVPIQKEI--el...................................................................
A0A093ZLY5_9PEZI/22-189                ............................................lap---NGLNPATIFEKPVRERIID..C.YF.WKDQCFALNE................................-ADIVSRVVEH..VQFVAG..............-TYG.DSQ.............................................RP.SPFLCLAFKL.LQLGPGDD..........ILK.EYLGy....................................................gGEKFK..YLRALACF....Y...V.....RLTRP........................AKEI....YE.TLE.....PF..LEDAR.KLRRRGRQG...................-----....-TSLTFMDQFVD.ELL.......TKERV...CA..T..SLWKMPKREVLEDL-e....................................................................
M7YZV4_TRIUA/100-177                   ............................................mey----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................---SY..FLQQIGFL....Y...L.....RYAAD........................PKTL....WT.WYE.....PY..IQDDE.---------...................EFSPG...sNGKMTTMGVYVR.DVI.......LGQYY...FD..S..LLPRVPL--------lilrqv...............................................................
S9X1J3_CAMFR/10-175                    ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A137P1R7_CONC2/12-176                ..............................................q-TIRGLDPQSLIENIIRQRIYE..S.LY.WKEFCFGLNA................................-ESLIDRAVD-..LNCIGG..............-QFA.-NT.............................................KP.ENFLCLLLKL.LQLQPQWD..........IIL.TYLK......................................................AKDFK..YLRILAAF....Y...I.....RLVGK........................PKQI....YE.LLE.....PL..LEDYE.KLRIRLPNG...................-----....EYTLTHVDEFVD.QLL.......TEERV...CD..T..ILPRIPKRHILEEN-d....................................................................
A0A022QWG5_ERYGU/5-166                 ...........................................kssg-----RSIDQLLEKVLCMNILS..S.EY.FR-DLLRLKT................................YHEVIDEIYVT..VTHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKTL....WS.WYE.....PY..LKDDE.---------...................EFSPG...sNGRTATMGAYVI.DLL.......LGQYY...FD..T..LFPRIPVPVM-----rtv..................................................................
E6X8B2_CELAD/97-274                    .............................................ka----------------------..-.--.YKEVLYHSFI................................-NKMEDDIITD..VQFHHY..............NIDN.FKT.............................................IL.NNSLGKYYKY.VVMGFDHK..........QVA.KTLAkipnndlllidwninstpe................nnyvfqdfgrsfykglesiTENFK..KYKALHFL....Y...P.....NYTNH........................AKET....VD.YFE.....KY..CQDNN.----FE---...................-YQIK...tNPQEYTIEKGVA.YLS.......VSDRV...LG..I..FLEQCRKQ-------nlep.................................................................
A0A0V0VH30_9BILA/62-227                ..............................................a-SLKGTNPQYLIEKVTRSRIYD..S.RY.WKEECFALSA................................-ELLVDRGME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLLLKM.LQIQPEKD..........IVI.EFIR......................................................QEDSK..YIRALGAL....Y...L.....RMTFS........................YVEV....YK.YLE.....PL..LNDYR.KLRWINKQG...................-----....KFELIHMDEFVD.KLL.......REERF...CD..V..QLPRLQKRAFLEE--tn...................................................................
A0A094L0J4_ANTCR/21-205                ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKTI--dq...................................................................
A0A091TJ42_PHALP/12-196                ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKTI--dq...................................................................
A0A094FSS4_9PEZI/22-189                ............................................lap---NGLNPATIFEKPVRERIID..C.YF.WKDQCFALNE................................-ADIVSRVVEH..VHFVAG..............-TYG.DSQ.............................................RP.SPFLCLAFKL.LQLGPGDD..........ILN.EYLGy....................................................gGERFK..YLRALACF....Y...V.....RLTRP........................AKEV....YE.TLE.....PF..LEDGR.KLRRRGRQG...................-----....-TTLTFVDQFVD.ELL.......TKERI...CA..T..SLWKMPKREVLEDL-e....................................................................
A0A0L0DEE5_THETB/10-174                ..............................................v-NVHGMDPQHLIDELTRSRVFR..T.RY.YVSECVALDA................................-RSLLDKAIC-..LKYAGG..............-TYG.SHG.............................................RP.TPFICLLLKM.LQVQPAIE..........AVQ.AMIA......................................................NSEFK..YLRLLAAM....Y...L.....RLVAS........................PTII....YA.ALE.....PV..LDDYR.SLRVRQTGG...................-----....-MVRMHMDELIE.RLL.......VATEL...FG..V..ILPRMPPRIVLEEN-g....................................................................
A0A135TLH6_9PEZI/24-191                ............................................lap---NGENPATIMEKAVRERIID..S.YF.YKEQCFAVNE................................-ADIVDRVVEH..VTFIGG..............-TSG.VTQ.............................................KP.TPFLCLAFKL.LQLAPSDE..........VLE.TYLGf....................................................gGDKFK..YLRALACF....Y...V.....RMTRK........................AKDV....YL.LLE.....PF..LEDRR.KLRRKGRAG...................-----....-TSLTFMDDFVD.DLL.......TKTRV...CA..T..SFRELPKRVDLVD--lg...................................................................
V4T5N8_9ROSI/10-175                    ...............................................KSIRGTNPQNLVEKIVRSKIYQ..N.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHLGG..............-TFG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKD..........IVV.EFIK......................................................NDDYK..YVRVLGAF....Y...L.....RLTGT........................DIDI....YR.YLE.....PL..YNDYR.KLRQKSGDG...................-----....RFILTHVDEVID.ELL.......TKDYS...CD..I..ALPRIKKRWNLE---tvg..................................................................
A0A151X9C1_9HYME/10-175                ...............................................KSIRGTNPQYLIEKIIRSRIYD..S.KY.WKEECFALTA................................-ELLVDKAME-..LRFLGG..............-VYG.GNV.............................................KP.TPFLCLILKM.LQIQPEKD..........IIV.EFIK......................................................NEEFK..YVRALGAL....Y...M.....RLTGS........................SLDC....YK.YLE.....PL..FNDNR.KLRIQNKQG...................-----....VFELVHMDEFID.ILL.......RDERC...CD..V..ILPRIQKRHVLEEN-n....................................................................
U3JST2_FICAL/1-134                     ............................................laa----------------------..-.--.----------................................-ELVVDKAME-..LKYVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HEERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
D3B1N8_POLPA/3-164                     ............................................lev----HGNKSMNLDQILLTNIQS..S.QY.FK-SLYNLKT................................YHEVLSEINNH..VEYLCP..............YIP-.NTK.............................................TP.SSAYCLLFKL.YTMKMTEN..........QMN.GIVT......................................................-HDSP..FVRAVGFL....Y...L.....RYCFP........................PANL....WS.WWG.....EA..LGDQE.TIKVTPRS-...................-----....--DPITVEELLI.QLV.......REQRF...AD..T..ILPRIPVKVMKEL--ed...................................................................
G3TI91_LOXAF/47-231                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
A0A0D2LM13_9CHLO/1-166                 ..............................................m-EIYGNASTFNLENVLRQNITA..C.EY.YRRDCTALAD................................WQSVIDEIYNA..VEDVEP..............WIGG.NAR.............................................GP.SSAFCLLHRL.FTLRMSIE..........EVS.ATLN......................................................HADSP..FIRAIGFL....Y...L.....RYVCD........................PRNL....WN.WFE.....GY..VEDKE.---------...................EFKPS...rWAPAVTIGDFVR.DLL.......LDQYY...FE..T..IFPRIPKKPR-----dreer................................................................
A0A0W0G801_9AGAR/10-191                ..............................................k-AIHGQNPQFLVETVIRNRIYE..S.SY.WKEHCFALTGkshtipsa...............rpennvmhtAESLIDKAIE-..LKCIGG..............-VYG.NQR.............................................-P.TEFLCLLLKL.LQIQPEKE..........ILI.EYLQ......................................................ADEFK..YLRALAAM....Y...I.....RMTFG........................AAEV....YQ.ILE.....PL..LKDYR.KLRLRNMTG...................-----....-YILTFMDEFVD.SLL.......TEERV...CD..I..ILPRLIKRQVLEEN-g....................................................................
W7J6P1_PLAFA/173-335                   ............................................lem----TNTTTYNVNTLLRNNILS..S.EY.FK-SLIPIKT................................FKEVVDEIHSY..ADHVEP..............YCIG.SNR.............................................AP.STLFCCLYKF.FTMQLSEK..........QLK.SLIE......................................................NKDSC..YIRACGFL....Y...L.....RYVHS........................PANL....WM.WFE.....PY..LLEED.---------...................EFSISc..dKRRKVTIGEYVQ.SLL.......SDDKY...FN..T..VLPRLPIKIK-----nvy..................................................................
G3VXQ4_SARHA/1-133                     .............................................sa----------------------..-.--.----------................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A093YW19_9PEZI/22-189                ............................................lap---NGLNPATIFEKPVRERIID..C.YF.WKDQCFALNE................................-ADIVSRVVEH..VQFVAG..............-TYG.DSQ.............................................RP.SPFLCLAFKL.LQLGPSDD..........ILK.EYLGy....................................................gGERFK..YLRALACF....Y...V.....RLTRP........................AKEV....YE.TLE.....PF..LEDGR.KLRRRGRQG...................-----....-TSLTFVDQFVD.ELL.......TKERI...CA..T..SLWKMPKREVLEDL-e....................................................................
A0A0K9QJA2_SPIOL/1-148                 ..............................................m------------------NILS..S.DY.FR-DLYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAVGFL....Y...L.....RYAAD........................PKTL....WS.WFE.....PY..IQDDE.---------...................EFSPG...sSGRMTTMGVYVR.DLL.......LGQYY...FD..T..LFPRVPVPVVR----qivs.................................................................
A0A0M3ILB4_ASCLU/165-201               ..............................................l----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....--QLVYMDEFID.NLL.......RQERY...CD..I..QLPRLQSRQALEE--vg...................................................................
D8TND3_VOLCA/10-177                    ...............................................KTVHGTNPQNLVEYIVRQKIYQ..T.VF.WKEKCFALTA................................-ETMLEVAVN-..LKSVGG..............-TVG.GQR.............................................KP.SDFLCLLLKM.LQIQPDKE..........IVI.EYIK......................................................NEDFK..YVRLLGAF....Y...M.....RLVGK........................PLEV....YQ.YLE.....PL..YNDYR.KATVRLQAV...................---EG....HFMLTHVDEVVD.DML.......RKDFL...FD..I..ALPRVPARLTLEK--lt...................................................................
B9SR85_RICCO/3-167                     ..........................................iqtsg-----KPIDSLLEKVLCMNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HKDSP..YIRAIGFL....Y...L.....RYAAD........................AKTL....WN.WCE.....PY..IKDDE.---------...................EFSPG...sNGRNTTMGVYVR.DLL.......LGQYY...FD..T..LFPRIPVPVMR----qivs.................................................................
U5HBW6_USTV1/10-174                    ..............................................l-SIHGTNPQYLIEKVIRARIYD..S.LY.WKEHCFALDA................................-ATVIDEALK-..LQYLGG..............-TYA.NTR.............................................-P.TEFMCLTLKL.LQLQPERE..........IIL.EYLR......................................................AEEFK..YLRALAAF....Y...V.....RLTFD........................PVNV....YE.VLE.....PL..FDDYR.KLRTRGMDG...................-----....AYSITTIDEFCD.QLL.......SEERV...CE..I..QLPRLTQRRVLEET-e....................................................................
M5XQR0_PRUPE/1-124                     ..............................................m----------------------..-.--.----------................................----------E..LDHIGG..............-TFG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKE..........IVI.EFIK......................................................NDDYK..YVRILGAF....Y...L.....RLTGT........................DTDV....YQ.YLE.....PL..YNDYR.KLRRKLADG...................-----....NYALTHVDEVID.ELL.......TKDYS...CD..I..AMPRIKKRWTLEA--tg...................................................................
D8SIA0_SELML/5-72                      .......................................ehvllvnv----------------------..-.--.----------................................--LVVDEISNR..VDHLEG..............----.NFR.............................................GP.SPAFCLLFKL.FTMKLTDE..........QIQ.GLLN......................................................HADSP..YVRAVRLL....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------lf...................................................................
A0A091HKR1_CALAN/10-175                ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LKYVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HEERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
E2LWB8_MONPE/48-120                    .......................................arpeshgk----------------------..-.--.--------RT................................AESLIDKAIE-..LKCIGG..............-VYG.NQR.............................................-P.TEFLCLLLKL.LQIQPEKE..........ILI.EYLQ......................................................ADEFKcdYIV-----....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------lssfv................................................................
M4DKE9_BRARP/10-175                    ...............................................KNIRGTNPQNLVETIVRKKIHD..H.TF.WKEQCFGLTA................................-ETLVDKAME-..LDHVGG..............-TFG.GNR.............................................KP.TPFLCLVLKM.LQIQPEKE..........IVV.EFIK......................................................NDDYK..YVRVLGAF....Y...L.....RLTGS........................DADV....YR.YLE.....PL..YNDYR.KVRQKLADG...................-----....RFSLTHVDEVIE.ELL.......TKDYS...CD..I..AMPRLKKRCTLEQN-g....................................................................
S8A531_DACHA/22-185                    .............................................pt--IHSMNPLLLMEKIIRERIID..S.MY.WKEQAWGLNA................................-ATLLDRAVD-..LQYIGG..............-QY-.ANQ.............................................KP.TAFICLVLKM.LQLNPERE..........ILL.EYLQ......................................................DEDFK..YLRALAAF....Y...I.....RLAWP........................AAEV....YK.TLE.....PL..MADYR.KLRLRTQAG...................-----....-FKLTFVDEFID.DLL.......TKERV...CD..I..ALPRMPTRAQLEDM-d....................................................................
G1QM59_NOMLE/48-232                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
G7KFW5_MEDTR/3-166                     .........................................iqtsgr------PIESLLEKVLCMNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAVGFL....Y...L.....RYYAD........................PKTL....WS.WFE.....PY..AKDDE.---------...................EFSPG...sNGRMTTMGVYIR.DLL.......LGQYY...FD..T..LFPRIPVPVM-----rqvv.................................................................
R0K0D1_SETT2/23-218                    .............................................sl--IRGQNPALLFEKGVRERITE..S.YY.WKEQCFGLNA................................-ATLCDRAAE-..LKFIGG..............-TTG.ITG.............................................KP.TPFLCLAFKL.LQLVPDKA..........IIL.EYLNfrddededkqdadeq.......................ddedaakdtdlnaagkLGCFK..YLRCLAAF....Y...I.....RLAWE........................PVEI....YK.TLE.....PL..LTDYR.KIKRRLKDT...................-----....-FTLTHVDQFID.DLL.......TRDRI...CA..T..SLWKLPSRAILEDL-d....................................................................
A0A0L0H982_SPIPN/13-177                ............................................let---VGNKDTMNLHNILYQNIIS..S.PY.FK-SLYEKKT................................YHEVIDEIYNQ..VSSLEP..............FFKG.THA.............................................--.STAFCLLYKL.WTLKLTVK..........QVQ.GLIT......................................................HTDSA..HIRALGFL....Y...L.....RYVCK........................PADL....WG.WYE.....PY..LDDDE.ELQVEAGAK...................-----....-PRMMSMGRFLR.ELL.......TDNKW...IG..T..MLPRIPVPIARDI--ek...................................................................
A0A164N7J1_9CRUS/10-175                ..............................................i-SVKGTNPQYLVEKIIRTRIYD..S.KY.WKEECFALTA................................-ELMVDKAME-..LRYIGG..............-IFG.GNV.............................................KP.TPFLSLTLKM.LQIQPEKD..........IVV.EFIK......................................................NEDFK..YVRALGAF....Y...M.....RLVGT........................SVEI....FK.YLE.....PL..YNDYR.KIRFQNKEG...................-----....NFELLYMDDFID.SLL.......REERF...CD..V..ILPRLQKRQVLEEA-n....................................................................
Q4XAT0_PLACH/10-175                    ............................................ikt---FGSNPQYLISNIIRNKIYD..S.PY.WKEKCFALTS................................-ESIIDQAVS-..LKYVGG..............-TYG.GNR.............................................KP.TRFLCLVLKL.LQLQPDKD..........IIY.EFIK......................................................NEEFI..YLRALGIF....Y...L.....RLVGK........................GIEI....YK.NIE.....PI..LFDYR.KIRLRLQDG...................-----....SFQKIYMDVFAD.NCL.......VFNNF...LD..V..DFPALTKRIVLEEN-n....................................................................
A1DES8_NEOFI/21-209                    ..............................................l--VRGVNPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LTSIGG..............-TYG.VAE.............................................KP.TPFLCLAFKL.LQLNPERE..........IIL.EYLNytdpgsdeetea.............................taeeqarngvlgqRGDFK..YLRALAAF....Y...V.....RLTFD........................PVDV....YK.TLE.....PL..LLDYR.KLKRRVRDT...................-----....-FVLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKLPARQQLEDL-d....................................................................
B3MDH3_DROAN/10-175                    ...............................................KNVHGTNPQYLIEKIIRSRIYD..S.KY.WKEQCFALTA................................-ELLVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TQFLCLTLKM.LQIQPEKD..........IVV.EFIK......................................................NEEFK..YVRALGAF....Y...L.....RLTGA........................ALDC....YK.YLE.....PL..YIDNR.KLRRQNRAG...................-----....QFEIVYMDEYID.ELL.......RNDRV...CD..I..ILPRIQKRTILEEN-n....................................................................
C1FDQ5_MICCC/10-174                    ..............................................r-NVRGTNPQNLLEAITRKKVYE..T.LY.WKEKCFAVSA................................-ESLVDLAMD-..LKTCGG..............LCAG.-KH.............................................KA.SEFLCLTLKL.LQIQPETE..........IVL.EFIT......................................................NENHK..YIRLLGAF....Y...L.....RLVGK........................PVDV....YR.YLE.....PL..LYDYR.RIRYKNSRG...................-----....VCEVKHVDELVN.DLL.......CKDNF...CD..V..VLPRIPRRPALE---ga...................................................................
A0A0E0KZ63_ORYPU/3-166                 ............................................iqt---SGKPIDLLMEKVLCMNIMS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKIL....WT.WYE.....PY..LKDDE.---------...................EFSPG...sNGRMTTMGVYVR.DLI.......LGQYY...FD..S..LLPRVPLPV------irqvt................................................................
A0A024UKU5_9STRA/9-173                 ..............................................i-SIHGVNPQHLVEKILRNRIYD..C.MY.WKEQCFGLTA................................-ETLVDKAIE-..LTHIGG..............-HFG.GNQ.............................................QP.TPFLCLILKM.LQIQPDLE..........IVV.EFIK......................................................NGDYK..YVTILGAF....Y...L.....RLVGK........................PTEV....YP.MLE.....EL..LADYR.KIRKRNTLG...................-----....-WEMLHVDEVAD.ILL.......KEEYF...CD..I..ALPHLVDRYQLET--tn...................................................................
A0A150V0C9_9PEZI/20-184                ..............................................l--IRGDNPLKLLDAPVRDRIIA..S.YY.WKEQCFGLNA................................-ASLLDRAVE-..LTYIGG..............-TYG.AAQ.............................................KP.TPFLCLLFKL.LQLTPEKE..........IIL.FYLQ......................................................QEEWK..YLRALAAF....Y...I.....RLTWE.......................kDEEV....YE.VLE.....PY..LADGR.KLRRRKREG...................-----....-WEGTFVDVFVD.DLL.......EKGRV...CG..T..TLPKINPRSWLEE--eg...................................................................
U1GVC6_ENDPU/20-185                    ..............................................l--IRGANPITLIETAVRDRITE..S.LY.WKEQCFGLNA................................-ATLLDRAVD-..LSYIGG..............-TYG.VGM.............................................RP.TPFLCLAFKL.LTLTPEKE..........IVL.EYLNm....................................................gGEEWK..YLRALAAF....Y...V.....RLTFE........................PVDI....YT.TLE.....PF..LTDAR.KLRRRRKEG...................-----....-YVLVHMDEFID.ELL.......TKDRS...CA..T..SLWKLPGRQQLEDL-d....................................................................
A0A161YQ56_DAUCA/10-174                ...............................................KNIKGTNPQNLIEKILRNKIYQ..N.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHLGG..............-THG.GNR.............................................RP.TPFMCLVTKM.LQIQPEKD..........IVV.EFIK......................................................NEDYK..YVRVLGAF....Y...L.....RLTGT........................DIDV....YR.YLE.....PL..YNDYR.KLRRQLADG...................-----....TFALTHMDEVID.ELL.......TKDYS...CD..I..ALPRMKKRWTIE---si...................................................................
W4GR42_9STRA/57-221                    ..............................................l-PIHGNQTTYNFNTLLYDNVMN..S.DY.FR-KLYELAT................................YHEVVDEIYYR..VDHAEP..............WAAG.TSR.............................................IP.STCFCLLMKF.CTMRLTVN..........QMQ.GLLK......................................................HVDSP..FIRCVGFL....Y...L.....RYTCD........................PELL....WE.WYE.....PF..LDDEE.---------...................EFNASs..nDAILTTMGAWIR.SLL.......EDLNY...FN..T..ILPRIPKKIQ-----dgik.................................................................
A0A183W1H1_TRIRE/10-170                ..............................................h-TVHGTNPQYLIEKIVRSRIYE..S.QF.WKEHS-----................................-ELLVDKAVE-..LRYVGG..............-VYS.GNV.............................................KP.TPFLCLTLKM.LQIQPDKD..........IVI.EFIK......................................................QEPYK..YARALGAF....Y...L.....RLVGE........................SVEI....YK.YLE.....TL..YNDFR.RLKFQDKMG...................-----....NFSLIYMDDFID.QLL.......TEERV...CD..V..ILPRLQKREVLEE--ln...................................................................
Q4N1F1_THEPA/128-239                   ............................................ipm----TNSVTYNMNDLLRSNILS..S.EY.YK-SL-SVKN................................FYQVFDELVQF..ATHSEP..............YCST.ATR.............................................AP.STIFCCLYRF.LVLKLTEK..........QMN.FLLE......................................................NVKSP..YARCCGFL....Y...L.....RYVLP........................PDKL....WN.CI-.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------s....................................................................
PR38A_BOVIN/10-175                     ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
L0B1D3_THEEQ/121-233                   ............................................iqm----TNSTTYNLNNLLRNNILA..S.EY.YK-SLFSMQT................................FQDVVNELIQY..GTHAEP..............YCST.ATR.............................................AP.STLFCCLYKF.FTMKLTEK..........QMY.SLLD......................................................NSKSP..YPRCCGLL....Y...L.....RYVLP........................PDKL....WN.C--.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------qc...................................................................
A0A0Q9WI28_DROVI/1-69                  ...............................................----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..-------M....Y...L.....RYTQP........................PGDL....YD.WYE.....DY..LQDEE.---------...................EIDVKa..gGGQVLTIGQMVY.QFM.......TKLDW...FS..T..LFPRIPVPIQKQIE-k....................................................................
A0A0W4ZH86_PNECA/15-179                ..............................................q-SIHSMNPINLIEKIIRERIAE..C.RY.YKEMCFGLTA................................-ATICDRAVK-..MKYIGG..............-QY-.LNQ.............................................RP.SEFLCLTFKL.LQLQPEKE..........IIL.EYLS......................................................ANDFK..YLQALAAF....Y...I.....RLTFP........................AKEC....YM.ILE.....PF..LNDYR.KLRIRYSTG...................-----....LYGLSYIDEFVD.QLL.......NEERV...CD..I..ALPRLPTRFILEE--me...................................................................
A0A0J8FEL6_BETVU/10-175                ...............................................KSIRGTNPQNLVEKIVRSKIYQ..N.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHVGG..............-TYG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKD..........IVV.EFIK......................................................NEDYK..YVRILGAF....Y...L.....RLTGT........................DSDV....YL.YLE.....PL..YNDYR.KLRMRKQDG...................-----....QFLLTHVDEFID.ELL.......TKDYS...CD..I..AMPRIKKRWNLEN--vg...................................................................
D8TKN7_VOLCA/1-167                     .............................................me--LYGSSTTYNLENVLRQNILG..S.DY.YRQTCTSLNN................................WSDIVDEIYEN..VDHVEP..............WMSG.NAR.............................................GA.SSAFCLLHRL.FTLKLNPK..........QIK.DMLD......................................................HRDSP..YIRAVGFL....Y...L.....RYVAD........................PKTL....WS.WCG.....PY..VKDQE.---------...................MLAPSg..pEQKEVTMGDYVR.DLL.......LSQYY...FE..T..IFPRIPKPVQD----vine.................................................................
A0A068Y424_ECHMU/1-99                  ...............................................----------------------..-.--.----------................................-----------..------..............----.---.............................................--.---------M.LQIQPDKD..........IVI.EFIK......................................................QEDYK..YARALGAF....Y...L.....RLVGE........................SVEI....YK.YLE.....AL..YNDFR.KLKQQDTTG...................-----....KFSIVRMDEFID.QLL.......NEERV...CD..V..ILPRLQKRSVLEDN-n....................................................................
I1LB75_SOYBN/10-175                    ...............................................KSIRGTNPQNLVEKILRSKIYQ..N.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHLGG..............-TYG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKE..........III.EFIK......................................................NEDYK..YVRILGAF....Y...L.....RITGS........................DIDV....YR.YLE.....PL..YNDYR.KLRRKLADG...................-----....QFALTHVDEVID.ELL.......TKDYS...CD..I..AMPRVKKRWTLES--lg...................................................................
A0A0C7MMX2_9SACH/14-227                ...............................................KQLNHQSTSLVVPSITRARIHN..S.MY.YKANLDAASLrg............................nsMLQLSTTMLKE..LGTCRGass........rmsIVCG.GVE.............................................--.--FKCLLMKL.VHIRPTWA..........QLL.VILQkgh...............................................ekhsRFDNK..YLVVLVLT....Y...L.....RLQYYflprpsetshlkgirdfnkdqnvtAENL....KN.LLL.....LY..IRDYR.KVKCMALDAdc...............wvQGGPQ....KVEIRHIDEIVD.WLC.......TESQI...WA..L..PLGQCQW-CD-----iyaen................................................................
A0A151S0K7_CAJCA/3-165                 .......................................iqtcgkpi--------DSLLEKVLCMNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAVGFL....Y...L.....RYCAD........................PKTL....WN.WFE.....PY..IKDDE.---------...................EFSPG...sNGRMTTMGVYVR.DLL.......LGQYY...FD..T..LFPRIPVPV------lrqv.................................................................
A5DTV1_LODEL/38-215                    ............................................dkr---TTTNKAHLVDTIIRHRILD..S.IF.YKQHLYLANE................................-ATILQVITKH..VHYIGG..............--VD.SMG.............................................RP.SPFIQCLFRL.LELNPSKE..........IVH.VYLHq...................................................leFNEFK..YLLALSLL....F...V.....RLTYP........................SEEV....YS.IFD.....EF..AQDYR.KLRYKMKVP...................DFDENklaiFYKIGYMDEFLD.DLL.......TKERV...VD..L..LLPRLTLRNTLVE--qa...................................................................
A8IJK3_CHLRE/10-175                    ...............................................KTVHGTNPQNLVEYIVRQKIYQ..T.TY.WKEKCFALTA................................-ESLLEVAVQ-..LKSVGG..............-TFG.GQR.............................................KP.SDFLCLLLKM.LQIQPDKE..........III.EYIK......................................................NEDFK..YVRLLGAF....Y...M.....RLVGK........................PLEV....YQ.YLE.....PL..YNDYR.KVRLQTLEG...................-----....AYALTHVDEVVD.DML.......RKDFL...FD..I..ALPRVPSRYTLEK--lg...................................................................
L2GTU9_VAVCU/4-152                     ............................................yrl-----------FSNPIKEKIFK..S.PY.FK-EIRTYDL................................-NQTITEAQQ-..LSSIGS..............LVYG.S--.............................................-P.HQFICLLQKL.ESLNIGDS..........IIL.EKYHe...................................................alKGDNS..SFVMFFVF....Y...I.....RMTVR.......................mKGDF....EE.IRR.....NL..CSDES.LINIIDENN...................-----....EHYTITIKEMLN.MLK.......NDRYV...LG..I..FM-------------knv..................................................................
I1NJ40_SOYBN/10-175                    ...............................................KSIRGTNPQNLVEKILRSKIYQ..N.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHLGG..............-TYG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKE..........IVI.EFIK......................................................NEDYK..YVRILGAF....Y...L.....RITGS........................DIDV....YR.YLE.....PL..YNDYR.KLRRKLADG...................-----....QFTLTHVDEVID.ELL.......TKDYS...CD..I..ALPRVKKRWTLES--lg...................................................................
A0A0V0VH23_9BILA/62-227                ..............................................a-SLKGTNPQYLIEKVTRSRIYD..S.RY.WKEECFALSA................................-ELLVDRGME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLLLKM.LQIQPEKD..........IVI.EFIR......................................................QEDSK..YIRALGAL....Y...L.....RMTFS........................YVEV....YK.YLE.....PL..LNDYR.KLRWINKQG...................-----....KFELIHMDEFVD.KLL.......REERF...CD..V..QLPRLQKRAFLEE--tn...................................................................
A0A0N5C737_STREA/6-171                 ..............................................k-TIRGTRSTFLIEKIIRTRINE..S.LY.WKEECFGLSA................................-ETVIDKGAE-..LRYVGG..............-IYA.GNT.............................................RP.TPFLCLTLKL.LELAPEKD..........III.EYIQ......................................................QEEFK..YIRALGAM....Y...I.....RLTFP........................SVDV....YR.YLE.....PI..YNDYR.KLRYMNRMG...................-----....RFELMYMDQFID.RLL.......NEELF...CD..V..HLPKLQGRQLLEQN-d....................................................................
A0A101MS26_9EURO/21-204                ..............................................l--VRGVTPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LTSIGG..............-TYG.VSE.............................................KP.TPFLCLAFKL.LQLGPDRD..........VIL.ELLNytdpgsgdea..................................enpddalvkeRGDFK..YLRALAAF....Y...V.....RLTFE........................PVDV....YK.TLE.....PL..LLDYR.KLKRRVRDT...................-----....-FTLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKLPPRSQLEDL-d....................................................................
W1NQE5_AMBTC/3-166                     ..........................................iqtsg-----KPIDSLLEKVLCMNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYAAE........................PKTL....WG.WFE.....PY..VKDEE.---------...................EFSPG...sNGRMTTMGVYVR.DLL.......LGQYY...FD..T..LFPRTPVPIMR----qiv..................................................................
M7U0A7_BOTF1/21-188                    ............................................lap---NGLNPATILEKPVRERIVD..C.YF.WKDQCFALNE................................-ADIVSRVVSH..VTFIAG..............-TYG.DSQ.............................................RP.SPFLCLAFKL.LQLGPGDD..........ILK.EYMGy....................................................gGEKFK..YLRALALF....Y...W.....RMTRQ........................AKDV....YT.MLE.....GY..LEDRR.KLRRKTRTG...................-----....-TTLTFMDQFVD.DLL.......TKDRV...CG..T..TLWKMPKREILEDL-e....................................................................
B4ME55_DROVI/10-175                    ...............................................KNVHGTNPQYLIEKIIRSRIYD..S.KY.WKEQCFALTA................................-ELLVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TQFLCLTLKM.LQIQPEKD..........IVV.EFIK......................................................NEEFK..YVRALGAF....Y...L.....RLTGA........................AIDC....YK.YLE.....PL..YIDNR.KLRRQNRAG...................-----....QFEIVYMDEYID.ELL.......RNDRV...CD..I..ILPRIQKRSILEEN-n....................................................................
A0A0V1A017_9BILA/546-729               ..............................................l-NFWGNKETMNLNHLVLENIVS..S.PY.YKNTLLPLKT................................HFEVIDEIYYN..VEHLEP..............WEKG.TRKttgqtgmcg...........................gvrgvgaggVV.SSAFCLLYKL.FTLKLTRK..........QLT.ALLN......................................................HPDSC..YIRGLGFM....Y...I.....RFCLH........................PATF....WS.WYE.....PY..FDDSE.---------...................EIDPKa..gGGDLMTIGEMVK.SLL.......TKLDW...YS..T..LFPRIPVPIQKEI--d....................................................................
D8T1B4_SELML/10-168                    ...............................................KSVHGTNPQNLVEKILREKIHQ..S.SF.WKEQCFALTA................................-ETLVDKAME-..LDHIGG..............-TYG.GNR.............................................KA.TPFMCLTLKM.LQIQPEKE..........IVV.EFIK......................................................NQDYK..YVRVLGAF....Y...L.....RLVGK........................ATDV....YQ.YLE.....PL..YNDYR.KIRQRSADG...................-----....SFFLSHVDEFID.QLL.......TTDYC...CD..I..TLPRVPKR-------.....................................................................
A5DGC7_PICGU/7-183                     ..........................................dkrhv-----LNGAKLVEHIVRHRIHD..S.LF.YKQHLYLTNE................................-QTILPVIVDN..VTYIGG..............--TD.ANG.............................................RP.SPFICCLLRL.LEVEPEER..........ILA.MYETq...................................................lgYNRFK..YLTCLVMI....Y...Y.....RLTKT........................GAEI....YK.RLE.....PY..YKDYR.KVRLQLKVP...................EFENGs.arHYKVYTIDQWAD.DLL.......QHERV...VD..I..ILPRILPRHILM---qrg..................................................................
A0A023B5L5_GRENI/10-174                ..............................................r-SVHGTNPQFLINQITRNRIYD..S.AY.WKEYCFGLNA................................-VTLLDKAAG-..LKYVGS..............-VYG.GNN.............................................KA.CPFLCLLLKL.LQIGPSDS..........VVD.EYME......................................................QTDFK..YLQALSAV....Y...L.....RLTGS........................PERI....YR.KLE.....EL..YTDNR.LLRLRLNNG...................-----....SFKLFHVDEFID.ELL.......HSNVC...IN..I..DLPPLPNRNLLEQ--n....................................................................
U6KXF4_EIMTE/120-282                   ............................................vqm----TDSTTYNVNQLLRGNIMS..S.EY.FK-SLHQFKS................................FNEVVDELAAF..ADHAEP..............YCSG.STR.............................................AP.STLFCCLYKL.FTLKLTEK..........QMH.MLLN......................................................HRESP..YVRCTGFL....Y...L.....RYVHP........................ADQL....WK.WYE.....PY..FLDDE.---------...................QFTPGa..dPNRVISMGEYVQ.SLL.......TEDKY...FS..T..VLPRLPVLVK-----nvy..................................................................
A0A183KSQ5_9TREM/26-210                ..............................................l-KLWGNPQTMNLNTMIYTNIAQ..S.PY.FKANLVELKT................................YHEVIDEIYYK..VEHLEP..............WERG.SRRiggqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.FTLKLTRK..........QLK.GLLD......................................................HPDSP..YIRALGFM....Y...I.....RYCIP........................PEDF....WW.WYS.....PY..LSDSE.---------...................ELDVKa..gGGCIMTIGNMLE.HWL.......TKLDW...FS..T..LFPRIPVPVQKK---lee..................................................................
E0VES7_PEDHC/10-175                    ..............................................k-SVRGSNPQYLIEKIIRARIYD..S.KY.WKEECFALSA................................-ELLVDKAME-..LKYVGG..............-VFG.GNI.............................................KP.TPFLCLILKM.LQIQPEKD..........IIV.EFIK......................................................NEEFK..YVRALGAF....Y...M.....RLVGN........................PLEC....YK.YLE.....PL..LIDCR.KLRKQNRQG...................-----....HFELLHMDEFVD.DLL.......REERM...FD..I..ILPRIQKRHVLEEN-n....................................................................
A0A091WGY7_OPIHO/1-113                 ..............................................g----------------------..-.--.----------................................-----------..------..............----.-NI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HEERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
J9NZD6_CANLF/48-232                    ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKNID-q....................................................................
A0A067K178_JATCU/3-166                 ..........................................iqtsg-----KPIDSLLEKVLCMNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HKDSP..YIRAIGFL....Y...L.....RYAAD........................PKTL....WN.WFE.....PY..IKDDE.---------...................EFSPG...sNGRKATMGVYVR.DLL.......LGQYY...FD..T..LFPRIPVPVMR----qig..................................................................
A0A0M0K198_9EUKA/55-233                ...........................................savg--------NMNLNSMLVENIRS..D.DY.FK-GLAELKT................................FEDVVDQIYYD..CKFVTP..............WVPG.THKsqkasgmcs...........................glrgvsnagTP.STGYMLLFKL.YTLQITTH..........QIR.RMLN......................................................HTDSP..YIRALGFL....Y...L.....RHACD........................PKEL....WT.WCK.....PF..VADPE.ELYVEGA--...................-----....DGPVSTIGRWLR.GLL.......TEQEY...HG..T..MLPRLPVPVA-----rdvl.................................................................
A0A087XEK0_POEFO/10-175                ..............................................n-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LKFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRLLGAM....Y...M.....RLTGT........................AVDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HAERV...CD..I..ILPRLQKRQVLEEA-e....................................................................
A0A151GPH8_9HYPO/23-190                ............................................lap---NGLNPATIMEKAVMDRIVD..S.YF.YKEQCFALNE................................-ADIVDRVVEH..VSFIGG..............-TLG.ASQ.............................................KP.SPFLCLAFKL.LELGPSDA..........VLG.EYLTf....................................................gGDAFK..YLRALACF....Y...V.....RLTRQ........................AKDV....YE.TLE.....PY..LDDRR.KLRRRGRAG...................-----....-TRLTFVDEFVD.ELL.......TSDRV...CA..T..SLWKMPKRETLEDL-e....................................................................
V9ES07_PHYPR/9-173                     ..............................................q-SVHGVNPQTLVEKIMRNRIYA..S.IY.WKEQCFGLTA................................-ETLVDKAVE-..LQEFGG..............-TFG.GNQ.............................................QP.THFLCLLLKM.LQLQPELE..........VVK.QFIE......................................................NEDYK..YVTVLGAV....Y...L.....RLVGK........................PLEV....YT.LLE.....PL..LSDYR.KIRKRNVIG...................-----....-WEITHVDEIAD.ALL.......HEEYY...ID..L..ALPRLADRELLEKN-e....................................................................
A0A093SL62_9PASS/20-204                ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKAI--dq...................................................................
A7RN21_NEMVE/18-202                    ..............................................l-PLWGSERTMNMNNMILTNILQ..S.PY.FKNELYQLKT................................YHEVVDEIYYK..VDHLEP..............WEKG.SRKtsgqvgmcg...........................gvrgvgaggIV.STAYCLLYKL.FTLRLTRK..........QLN.GLLT......................................................HTDSP..YIRALGFM....Y...I.....RYCQP........................PADL....WE.WYE.....PY..LEDEE.---------...................EVDPKa..gTGCTMTMGQLVR.SFL.......LKLEW...YG..T..LFPRIPVPIQKD---lek..................................................................
A0A183CCA7_GLOPA/31-196                ..............................................h-TVKGTNPQYLIEKIIRTRIYD..S.LY.WKEQCFGLSA................................-ETVVDRAIE-..LRYIGG..............-IYA.GNI.............................................KP.AQFLCLTLKL.LQLQPDKD..........III.EFIR......................................................QDDFK..YVRALGAM....Y...I.....RLIFN........................SVEV....YK.YLE.....PL..YNDYR.KLRYMNRMG...................-----....KFELLHMDEFID.NLL.......REDHY...CD..V..QLPRLQKRQALEEK-d....................................................................
A0A078DXJ9_BRANA/10-198                ...............................................KNIRGTNPQNLVEKIVRTKIQN..H.TF.WKEQCFGLTA................................-ETLVDKAME-..LDHVGG..............-TFG.GNR.............................................KP.TPFLCLVLKM.LQIQPEKE..........IVV.EFIKnddykhdmfvf...............................lpkllsfvritfLGVVK..YVRVLGAF....Y...L.....RLTGS........................DVDV....YR.YLE.....PL..YNDYR.KVRQKLADG...................-----....RFSLTHVDEVIE.ELL.......TKDYS...CD..I..AMPRLKKRCTLEQN-g....................................................................
A0A183IS23_9BILA/37-220                .............................................ly--YWGSKETMNLNHLVLENILQ..S.PY.FKNTLFQLKT................................YHEVIDEIFYN..VQHLEP..............WEKG.TRRttgqtgmcg...........................gvrgvgaggVV.SSAYCLLYKL.FTLKLTRK..........QVT.GLLN......................................................HADSC..YIRGLGFM....Y...V.....RYCLH........................PHTF....WD.WYE.....PY..LDDDE.---------...................EVDPKa..gGGDAMTIGQMVK.LLL.......TKLEW...YC..T..LFPRIPVPIQF----add..................................................................
W7KEH1_PLAFO/11-168                    ............................................knf----GSNPQYLISNIIRSKIYD..S.PY.WKEKCFALTS................................--------IN-..LKYVGG..............-TYG.GNR.............................................KP.TRFLCLILKL.LQIQPDKD..........IIY.EYIK......................................................NEDFV..YLRALGIF....Y...L.....RLIGK........................SLEV....YN.HLE.....PI..LFDYR.KIRMRLQNG...................-----....TFEKIYMDVFVD.NCL.......ILNNF...LD..V..DFPTLTKRQVLEEN-n....................................................................
A0A0F8DAS5_CERFI/24-191                ............................................lap---NGLNPATIMEKAVRDRIID..S.YF.YKEQCFALNE................................-ADIVDRVVEF..VQFIGG..............-TYG.VTQ.............................................KP.TPFLCLAFKL.LQLAPSDA..........ILS.EYLEl....................................................gGEHFK..YLRALACF....Y...I.....RLTRP........................AKEC....YL.LLE.....PF..LEDRR.KLKRKGRAG...................-----....-TTLTYVDEFVD.HLL.......VKERV...CG..T..SLWKMPKRDVLEDM-d....................................................................
A8X281_CAEBR/57-204                    ..............................................l-PIWGNQVTMNLNTLVLENIRE..S.YY.YKNNLVEIDS................................FQTLVEQIFYQ..VKHLEP..............WEKG.TRRlqgmtgmcg...........................gvrgvgaggVV.SSAYCLLYRL.FNLRITRK..........QLI.SMLN......................................................SRQSV..YIRGIGFM....Y...I.....RYTQP........................PADL....WY.WLE.....PY..LDDDS.E--------...................-----....------------.---.......-----...--..-..---------------idprsgg..............................................................
A0A137QTB7_9AGAR/10-173                ..............................................k-AIHGQNPQYLVETVIRNRIYE..C.SY.WKEHCFALTG................................--IIIDKAIE-..LRAIGG..............-VYG.GNQ.............................................KP.TEFLCLLLKL.LQIQPEKE..........ILL.EYLQ......................................................ADEFK..YLRALAAI....Y...I.....RMTFR........................AIDI....YE.ILE.....PL..LKDFR.KLRLRNMNG...................-----....-YALTYIDEFVY.ELL.......TEERV...CD..I..ILPRIPKRQTLEET-d....................................................................
H3DCW8_TETNG/25-209                    ..............................................l-PLWGNEKTMNLNPMILTNVLS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QLM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PPDL....LE.WYD.....GF..LDDDE.---------...................ELDVKa..gGGCVMTVGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKSI--dq...................................................................
G5C765_HETGA/85-176                    .......................................sqapraek----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.---K......................................................NEDFK..YVCMLGAL....Y...M.....RLTGT........................AIDC....YK.CLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELR.......HSERV...CD..I..MLPRLQKRYVLEE--ve...................................................................
A0A151WST0_9HYME/1-180                 ...............................................---------MNLNPLILTNIQS..S.HY.FKVNLYELKT................................YHEVIDEIYYK..VSHLEP..............WEKG.SRKtagqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.FTLRLTRK..........QLN.GLIN......................................................HPDSP..YIRALGFM....Y...IstvtiRYTQP........................PADL....FS.WYN.....DY..LEDEE.---------...................ELDVKa..gGGQVMKMGDILK.QFL.......TKLEW...FS..T..LFPRIPVPIQKD---le...................................................................
G1S8M8_NOMLE/1-148                     ...............................................------------------RIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A0R3W616_TAEAS/10-175                ..............................................h-TLHGTNPQYLVEKIIRSRIYE..C.QF.WKEHCFALTS................................-ELLVDKAVE-..LKYIGG..............-TYG.GLT.............................................KP.TPFICLVLKM.LQIQPDKD..........IVI.EFIK......................................................QEDYK..YARALGAF....Y...L.....RLVGE........................SVEI....YK.YLE.....AL..YNDFR.KLKQQDTTG...................-----....KFSIVRMDEFID.QLL.......NEERV...CD..V..ILPRLQKRSVLEDN-n....................................................................
A9TDL8_PHYPA/6-170                     ........................................vqtcgkp-------LDTLIERVLCTNILS..S.DY.FK-ELFSLKT................................YLEIVDEIYNH..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKL.FTMKFTVK..........QMQ.DILD......................................................HPDSP..YIRALGFL....Y...L.....RYVGD........................PKTL....WD.WFE.....PY..VEDTE.---------...................EFSPG...sNGKMTTMGVYVR.DII.......LNQYY...FD..T..LFPRIPVPILR----qita.................................................................
A0A0L6VIQ5_9BASI/10-176                ..............................................l-SIHGTNPQFLIDKILRSRIYE..S.EY.WKESCFGLTA................................-ESIIDKAVFD..LNYLAS..............-TFT.ANL.............................................RP.SPFICLLLKL.LQLQPEKE..........IIL.EYLR......................................................AEEFK..YLRALAAF....Y...V.....RLTFT........................PINV....YQ.TLE.....PM..LQDYR.KLRIRELDG...................-----....SYGLMTFDEFID.KLL.......TETIV...FE..V..VLPRLTSRKVLEE--le...................................................................
Q59WJ8_CANAL/17-194                    ...........................................dkry----TINKSNLIEPIIRHRIQD..S.LF.YKQHLYLSNE................................-ATILPIIIEH..VHYIGG..............--TD.SSN.............................................RP.STFISCLFRL.LELEPSKE..........IIK.TYLTq...................................................ldFNEFK..YLTALTLI....Y...I.....RLTYP........................SQEV....YS.IFD.....QY..FQDFR.KLRIKLKTP...................VFDSQklpiHYKITFIDEWVD.TLL.......VNERV...ID..L..MLPRLIPRTTLVE--rg...................................................................
A0A094AGC6_9PEZI/22-189                ............................................lap---NGLNPATIFEKPVRERIID..C.YF.WKDQCFALNE................................-ADIVSRVVEH..VHFVAG..............-TYG.DSQ.............................................RP.SPFLCLAFKM.LQLGPGDD..........ILN.EYLGy....................................................gGERFK..YLRALACF....Y...V.....RLTRP........................AKEV....YE.TLE.....PF..LEDGR.KLRRRGRQG...................-----....-TSLTFVDQFVD.ELL.......TKERI...CA..T..SLWKMPKREVLEDL-e....................................................................
A0A0Q3U491_AMAAE/50-234                ..............................................l-PLWGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKAI--dq...................................................................
E5A0N9_LEPMJ/24-234                    .............................................al--IRGQNPALLFEKGVRERITE..S.YY.WKEQCFGLNA................................-ATLCDRAAE-..LKFIGG..............-ITG.ITG.............................................KP.TPFLCLAFKL.LQLVPEKA..........IIL.EYLNfrsddgeedeatngqnghangee........eegnvdegdkqvhkpqdlnaagkLGDFK..YLRCLAAF....Y...I.....RLAWQ........................PVEI....YK.TLE.....PL..LTDYR.KIKRRLKDG...................-----....-YTLTYIDQFID.DLL.......TKDRI...CA..T..SLWKLPSRANLEDL-d....................................................................
S7MJI8_MYOBR/1-34                      ...............................................----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....----MHVDEFID.ELL.......HSERV...CD..I..ILPWLQKRYVLEEA-e....................................................................
A0A0L7R1H9_9HYME/10-175                ...............................................KSIRGTNPQYLVEKIIRSRVYD..S.KY.WKEECFALTA................................-ELLVDKAME-..LRFIGG..............-VYG.GNV.............................................KP.TPFLCLILKM.LQIQPEKD..........IIV.EFIK......................................................NEEFK..YVRALGAL....Y...M.....RLTGS........................SLDC....YK.YLE.....PL..FNDNR.KLRRQNKQG...................-----....KFELIHMDEFID.DLL.......RDERS...CD..V..ILPRIQKRHVLEEN-n....................................................................
A0A087W133_ECHMU/27-211                ..............................................l-KLWGNQVTMNINPMIHTNIIQ..S.PY.FKTNLIELKT................................YHEVIDEIYYK..VTHLEP..............WERN.SRRmggqtgmcg...........................gvrgvgaggIV.STAYCLLFKL.FTLKLTRK..........QLK.GLLE......................................................HPDSP..YIRALGFM....Y...I.....RYCLP........................PEDL....WM.WFA.....PY..LDDEE.---------...................EIDVRa..gGGCSMTIGAMLG.QWL.......TKLDW...FS..T..LFPRIPVPVQKKID-e....................................................................
A0A059LRU5_9CHLO/10-175                ..............................................a-SVHGTNPQNLIEYIVRQKVYD..S.LY.WKQECFGLTA................................-EGVVAKAAE-..LKYVGG..............-MHG.QPQ.............................................KP.SEFLCLALKL.LQIAPERG..........VVL.EFVR......................................................NEDFK..YLRLLGAF....Y...L.....RLVAR........................PAEI....YA.TLE.....PL..LLDSR.RVRRRDLAG...................-----....RFSLWHVDEAVD.ALL.......SKERV...YD..V..ALPRLTPRHVLEE--tg...................................................................
F6HI04_VITVI/3-166                     ..........................................iqtsg-----KPIDSLLEKVLCMNILS..S.DY.FK-ELYRLKT................................YHEVVDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAVGFL....Y...L.....RYAGD........................PKTL....WN.WFE.....PY..VKDEE.---------...................EFSPG...sTGRMTTMGAYVR.DLL.......LGQYY...FD..T..LFPRIPVPIMR----qiv..................................................................
A0A0B1TH01_OESDE/490-655               ..............................................h-TVRGTNPQFLVEKIIRQRIYD..S.KY.WKEYCFALSA................................-DLVVDRALE-..LRYIGG..............-IYA.GNV.............................................KP.TPFLCLSLKM.LQIQPEKD..........III.EFIQ......................................................QEQSK..YARALGAM....Y...L.....RLTFT........................SVEI....YK.YLE.....PL..FNDYR.KLRYMNKQG...................-----....RFELVYMDEFID.NLL.......REERY...CD..I..QLPRLQKRQALEE--vg...................................................................
C5GJR6_AJEDR/21-214                    ..............................................l--IRGANPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LTYIGG..............-TYG.LAQ.............................................KP.TPFLCLAFKL.LQLAPEKD..........IVL.EYLNfhdpenerveggegn........................gleeeqdandgvvkaVGDFK..YLRALAAF....Y...I.....RLTFD........................AADI....YR.TLE.....PL..LVDYR.KLKRRTKDG...................-----....-FMLTYIDQFVD.DLL.......TKDRV...CG..T..SLWKLPSRTQLEDL-d....................................................................
A0A0D1YMY3_9PEZI/20-211                .............................................pt--IRGQNPALLFEKGVRERITE..S.YY.WKEQCFGLNA................................-ATLCDRAAE-..LTFVGG..............-TYG.AVG.............................................RP.TPFLCLAFKL.LQLVPEKE..........IIL.EYLNfhdegetmgdlng...........................enandqgaeidqrrRGDFK..YLRALAAF....Y...I.....RLAWE........................PVEI....YQ.TLE.....PL..LLDYR.KLKRRTRDG...................-----....-FTLTYMDQFID.DLL.......TKDRV...CA..T..SLWKLPHRAILEDL-d....................................................................
A0A0H5C1I8_CYBJA/16-169                ............................................rkh---KGVNSTELAEKIVRERVFD..S.LY.WKLNCFNVNA................................-ATILNRCVE-..LRCVGS..............--FE.QSG.............................................RP.FPFLCLFVKL.IQMLPPSE..........IIE.FYLQ......................................................QHEFK..YLKVLALL....Y...V.....RIVER........................DQD-....--.TLR.....QH..LSDYR.KIILFENGA...................-----....-WSLTTVDVIVD.RLL.......TEDFF...IG..L..TLPF-----------mgas.................................................................
U5CUR3_AMBTC/1-70                      ...............................................----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..YVRILGAF....Y...L.....RLVGK........................PTDV....YQ.YLE.....PL..YNDYR.KLRRKSADG...................-----....SFVLIRVDEFID.ELL.......TKEHS...CD..I..ALPRVPK--------.....................................................................
G3BAA6_CANTC/7-180                     .......................................dkrrvsgy--------AHILETIVRNRIKD..S.LF.YKQHLYLTNE................................-QTILQVIVDN..VKYVGG..............--LD.SSN.............................................RP.SPFLCCLLRL.LEIGPSAA..........VVG.LYLK......................................................QPEFK..YLTILTLI....Y...I.....RLTQP........................PTEV....YQ.VLD.....TY..RSNYT.KVRVLLSSP...................EMVDGv.pvNYGIIHIDEFVD.ELE.......RSDRV...VG..V..VMPRLESRRRL----varg.................................................................
D7FPC2_ECTSI/167-227                   ............................................lvh----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..--------....-...-.....-----........................-EEL....WG.WLE.....PY..MDDEK.KFKPSPTEG...................-----....---SMTMGKWVR.KII.......SDMQY...YG..T..MLPRIPVLIER----kmk..................................................................
A0A0Q9WN88_DROMO/1-69                  ...............................................----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..-------M....Y...L.....RYTQP........................PGDL....YD.WYE.....DY..LQDEE.---------...................EIDVKa..gGGQVMTIGQMVY.QFM.......TKLDW...FS..T..LFPRIPVPIQKQIE-k....................................................................
D5GP15_TUBMM/20-183                    .............................................qt--FHGVNPLLLVEKIIRERIFE..S.LY.WKEQAFGLNA................................-ATLLDRAVE-..LTYIGG..............-QY-.SNQ.............................................RP.TPFLCLTFKL.LQLQPSRE..........IIL.VYLN......................................................DPDFK..YLRSLAAF....Y...I.....RLTWS........................AVDI....YR.TLE.....PL..MGDYR.KLRVRGMGG...................-----....-WRMTYVDEFID.ELL.......TKERV...CD..I..ALPHIKTRAMLEDA-d....................................................................
J7RRK2_KAZNA/15-210                    ...............................................KQLNHQSVSLVIPRLTRDKVHH..V.LY.YKVNLEVGSLrg............................dtMLQLSKVLIRD..LGTIKAntl........nqtHILG.GVE.............................................--.--FKCLLMKL.VEIRPTRE..........QLV.YILEtq..................................................nkTFDDK..YIVALILT....Y...I.....RIQYFyvtl................hdelARKW....RE.LFK.....TY..MKDFR.KLKAVDFEQdc...............wsQSQKI....NVKVTHLDELID.WLV.......TETQI...WG..I..PLGMCQW-CNIY---ndsd.................................................................
A0A0D2T6W8_GOSRA/10-175                ...............................................KSIRGTNPQNLVEKIVRSKIYQ..N.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHIGG..............-TYG.GNR.............................................KP.TPFMCLVMKM.LQIQPEKD..........IVV.EFIK......................................................NDDYK..YVRVLGAF....Y...L.....RLTGI........................DSDI....YR.YLE.....PL..YNDYR.KVRRKSPDG...................-----....NFMLTHVDEVID.ELL.......TRDYS...CD..I..ALPRIKKRWTLES--lg...................................................................
S8ESL2_FOMPI/10-173                    ..............................................e-AIHGQNPQYLVETVIRNRIYE..S.PY.WKEHCFALTA................................-ETLIDKSIE-..LKCIGG..............-VYG.N-Q.............................................KP.TEFLCLLLKL.LQLQPQKE..........ILL.EYLQ......................................................ADEFK..YLRALAIM....Y...I.....RMTFR........................SVEV....YE.ILE.....PL..LKDYR.KIRYRGMNG...................-----....-YSLTYIDEFVD.NLL.......VEERV...CD..I..ILPRLTKRDVLEDN-g....................................................................
A9UQL8_MONBE/10-172                    .............................................gt--VHGANPQFLVEKIIRTRIYD..T.LY.WKEHCFALTA................................-ETVIDKAVQ-..LDHIGG..............-VYG.GSI.............................................KP.TPFLCLTLKL.LQLAPDKD..........IIY.AYIA......................................................AKDFK..YLQALGVF....Y...L.....RLVGT........................AKEC....YS.YLE.....PF..LEDFR.KLRHMKRDG...................-----....QYELMHMDEFVD.QLL.......REDRV...CD..I..ILPRLMVRMQ-----pt...................................................................
A0A0B4GRE7_9HYPO/24-191                ............................................lap---NGLNPATIMEKAVKDRIVE..S.YF.YKEQCFALNE................................-ADIVDRVVEH..VRFVGG..............-THG.DAQ.............................................KP.SPFLCLAFKL.LELGPSEG..........VVR.EYLSy....................................................gGEHFK..YLRALACF....Y...Y.....RLTRR........................AADV....HR.ALE.....PF..LGDRR.KLRTRGRRG...................-----....-AGLTYVDEFVD.GLL.......TRERV...CA..T..SLWKMPPREVLEDL-d....................................................................
A0A024VK41_PLAFA/10-82                 ...........................................iknf----GSNPQYLISNIIRSKIYD..S.PY.WKEKCFALTS................................-ESIIDQAIN-..LKYVGG..............-TYG.GNR.............................................KP.TRFLCLIY--.--------..........---.----......................................................-----..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------iyiyiym..............................................................
A0A059LNV7_9CHLO/42-209                ............................................leq---YGNSSTFNFENVIRQNVLI..S.SY.YHKSAAVLDN................................WQALVDEIYYS..VDNVEP..............WMSG.NAR.............................................GP.TTAFNLLYRL.CQLRPTHG..........EIR.MMLD......................................................HKDSP..YIRAIGFL....Y...L.....RYVCN........................PRQL....WQ.WMQ.....PY..IEDSE.---------...................EFSPSp.egLGKTVSMGDFVR.DIL.......LDQYY...FE..T..IFPRIPKAVEDEI--ka...................................................................
I3LP32_PIG/10-97                       ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------.....................................................................
A0A0M8P2W3_9EURO/73-256                ..............................................l--VRGVNPATLFEKAVRDRITD..S.YY.WKEQCFGLNA................................-ATLCDRAVE-..LTSIGG..............-TYG.VSE.............................................KP.TPFLCLAFKL.LQLGPDRD..........VIL.ELLNytdpgsgdea..................................enpddalvkeRGDFK..YLRALAAF....Y...V.....RLTFE........................PVDI....YK.ILE.....PL..LLDYR.KLKRRVRDT...................-----....-FTLTYMDQFVD.DLL.......TKDRV...CG..T..SLWKLPPRSQLEDL-d....................................................................
M0X6G8_HORVD/3-153                     ............................................iqt---SGKPIDMLMEKVLCMNILS..S.DY.FK-ELYRMKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYVAD........................PKIL....WT.WYE.....PY..LKDDE.---------...................EFSPG...sNGRMTTMGVFVR.DLI.......LGQKL...CQ..-..---------------la...................................................................
S7PSV6_MYOBR/10-175                    ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
W5P5R7_SHEEP/10-175                    ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
A0A0K0DK53_ANGCA/45-229                ..............................................l-SCWGNQQTMNLNGLVLENVKE..S.YY.YKNHLVEIDS................................AQQLLDEVFYK..VKHLEP..............WEKG.TRKvqgmtgmcg...........................gvrgvgaggVV.SSAFCLLYRF.FKVRLTRA..........-IE.FVLG......................................................RC--H..HISVVWVL....C...I.....YATLS........................PQLI....YGnVLQ.....SPidIDDEE.---------...................EIDPRs..gGGDVMTFGQVVR.IML.......TKLDW...YG..T..LFPRIPVPIQKEID-e....................................................................
Q69K06_ORYSJ/10-175                    ...............................................KSIHGTNPQNLVEKIVRSKIYQ..S.TY.WKEQCFGLTA................................-ETLVDKAME-..LDHTGG..............-TYG.GNR.............................................KP.TPFLCLALKM.LQIQPDKD..........IVV.EFIK......................................................NEDYK..YVRVLGAF....Y...L.....RLTAT........................VADV....YQ.YLE.....PL..YNDYR.KIRHKLSDG...................-----....KFTLTHVDEFID.DLL.......TKDYS...CD..T..ALPRIQKRWVLET--sg...................................................................
A0A099P229_PICKU/22-191                ..............................................q-RVHGLNRVLLMEKILREKVLD..S.QY.WHVKASQLQF................................-YGLLKECVLH..VDCVGT..............YENS.AKT.............................................KT.TKFVALLLRL.LQLAEIPK..........DVV.EWLVv....................................................gDHGHV..YLSVLFMV....Y...V.....RLVFE.......................dSAEI....WK.LLE.....RK..YNEYD.KVRYIENGR...................-----....-VTDRHIDEIAD.GLL.......MESHF...VD..M..TLPRLVRRWVLEEK-g....................................................................
Q8IM21_PLAF7/173-335                   ............................................lem----TNTTTYNVNTLLRNNILS..S.EY.FK-SLIPIKT................................FKEVVDEIHSY..ADHVEP..............YCIG.SNR.............................................AP.STLFCCLYKF.FTMQLSEK..........QLK.SLIE......................................................NKDSC..YIRACGFL....Y...L.....RYVHS........................PANL....WM.WFE.....PY..LLEED.---------...................EFSISc..dKRRKVTIGEYVQ.SLL.......SDDKY...FN..T..VLPRLPIKIK-----nvy..................................................................
D7FPC2_ECTSI/52-172                    ..............................................l-PIHGNDRTFNLNTLLAQTILA..S.EY.FK-SLAGITTylegvkivglaagdchtmtydvsgkaygwgsyREKVVDEIYSY..CDHVAP..............WAPG.TSR.............................................VP.SSAFCLLMKL.FVIKLTRP..........QMN.EILV......................................................HEE--..--------....-...-.....-----........................----....--.---.....--..-----.---------...................-----....------------.---.......-----...--..-..---------------l....................................................................
A0A094E0S4_9PEZI/22-189                ............................................lap---NGLNPATIFEKPVRERIID..C.YF.WKDQCFALNE................................-ADIVSRVVEH..VHFVAG..............-TYG.DSQ.............................................RP.SPFLCLAFKL.LQLGPGDD..........ILK.EYLGy....................................................gGERFK..YLRALACF....Y...V.....RLTRP........................AKQV....YE.TLE.....PY..LEDGR.KLRRRGRQG...................-----....-TSLTFVDQFVD.ELL.......TKERI...CA..T..SLWKMPKREQLEDM-e....................................................................
A0A066WLJ0_9HOMO/10-172                ..............................................i-HIHGQNPQFLVEKVIRTRIWE..S.AF.WKEECFALSE................................--SLIDKAIE-..LNTIGG..............-VYG.NQR.............................................-P.THFICLLLKL.LQIQPEKE..........ILI.EYLM......................................................VDEFK..YLRALAAM....Y...I.....RMTFP........................AVEV....YE.LLE.....PL..LKDYK.KIRLRNVAG...................-----....-YSLTFMDEFVD.QLL.......TEERV...CD..I..ILPRMAKREVLEET-e....................................................................
B4IGQ6_DROSE/1-166                     ...............................................----------------------..-.--.--------KT................................YHEVVDEIYYQ..VKHMEP..............WERG.SRKtsgqtgmcg...........................gvrgvgaggIV.STAYCLLYKL.YTLRLTRK..........QIN.GLLN......................................................HTDSA..YIRALVVA....F...A.....RRGPSislhlpa..........klrytqpPSDL....YD.WYE.....DY..LQDEE.---------...................EIDVKa..gGGQVLTIGQMVY.QFM.......TKLDW...FS..T..LFPRIPVPIQKQIE-k....................................................................
G3AGB8_SPAPN/17-194                    ............................................dkr---NVLNKAYLIEPIIRHRIQD..S.IF.YKQHLYLTNE................................-ATILPIIVEH..VKYVSG..............--TD.SSG.............................................RP.SPFICCLLRM.LELEPSKD..........MID.TYLTq...................................................lgFNEFK..YLTALALI....Y...V.....RLVYS........................SDVV....YK.TFD.....PY..FQDAR.KLRVKLKSPi................fnEVKLP...iGYSLTYIDAWVD.ELL.......TRERV...VD..I..ILPRLVPRIKF----vesg.................................................................
I1GG42_AMPQE/33-217                    ..............................................l-PLFGNKETMNINNMIITNILQ..S.RY.FKIELYEKKT................................FHEVVDEIFYR..VEHLEP..............WEKN.SRKlsgqvgmca...........................gvrgvaaggIV.STPFCLLYKL.FTLKLTRK..........QVK.VMLN......................................................HVDSP..YIRGLGFM....Y...I.....RYCQP........................PNNF....LD.WFS.....PY..LEDEE.---------...................EIDLKa..gGGYPVTIGVMCH.MML.......TKMEW...FG..T..MFPRISVNVQKDI--hd...................................................................
I1EKT3_AMPQE/1-78                      ...............................................----------------------..-.--.----------................................-----------..------..............----.---.............................................--.----------.--------..........---.----......................................................-----..YVRALGAL....Y...L.....RIVGT........................SVEC....YK.YLE.....PL..YNDYR.KIKYKNRQG...................-----....KFELSHVDEFVD.SLL.......REDRV...CD..V..ILPRIQKRHILEET-e....................................................................
A0A0V0XET8_TRIPS/10-175                ..............................................a-SLKGTNPQYLIEKVTRSRIYD..S.RY.WKEECFALSA................................-ELLVDRGME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLLLKM.LQIQPEKD..........IVI.EFIR......................................................QEDSK..YIRALGAL....Y...L.....RMTFS........................YVEV....YK.YLE.....PL..LNDYR.KLRWINKQG...................-----....KFELIHMDEFVD.KLL.......REERF...CD..V..QLPRLQKRALLEET-n....................................................................
G1N3A5_MELGA/1-182                     ...............................................---WGNEKTMNLNPMILTNILS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKTI--dq...................................................................
A0DJV2_PARTE/10-175                    .........................................hlandg------RQMTLIDQIIRNKVFN..C.RY.WKEDCFGLTA................................-VTLVDKACK-..LDCVGA..............-TYS.GTG.............................................KP.VPFLCLLMKL.LQINPDKE..........III.EFLK......................................................SKDYK..YISALAMF....Y...I.....RLTSK........................PKEA....YP.TIE.....QF..YADFR.KIRIRNLDG...................-----....TFAIWHMDELAE.KLL.......SEEII...FG..I..SLPRFQKRWILEE--lg...................................................................
A0A0V1CJ71_TRIBR/10-175                ..............................................a-SLKGTNPQYLIEKVTRSRIYD..S.RY.WKEECFALSA................................-ELLVDRGME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLLLKM.LQIQPEKD..........IVI.EFIR......................................................QEDSK..YIRALGAL....Y...L.....RMTFS........................YVEV....YK.YLE.....PL..LNDYR.KLRWINKQG...................-----....KFELIHMDEFVD.KLL.......REERF...CD..V..QLPRLQKRAFLEE--tn...................................................................
H2TYE2_TAKRU/22-164                    ..............................................l-PLWGNEKTMNLNPMILTNVLS..S.PY.FKVQLYELKT................................YHEVVDEIYFK..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QLM.GLIT......................................................HTDSP..YIRALGFM....Y...I.....RYTQP........................PPDL....LE.WYD.....GF..LDDDE.---------...................-----....------------.---.......-----...--..-..---------------iyt..................................................................
A0A095BZN2_SCHHA/10-175                ..............................................h-TVHGTNPQYLLEKIVRSRIYE..S.KF.WKEHCFALTA................................-ELLVDKAVE-..LRYVGG..............-VYS.GSV.............................................KP.TPFLCLTLKM.LQIQPDKD..........IVI.EFIK......................................................QEPYK..YARALGAF....Y...L.....RLVGD........................SVEI....YK.YLE.....TL..YNDFR.RLKFQDKMG...................-----....NFSLIYMDDFID.QLL.......TEERV...CD..V..ILPRLQKREVLEE--ln...................................................................
I2H5J2_TETBL/16-212                    ...............................................KQLNHQSVSLVIPRLTRDKIHS..A.LY.YKVNLQDPSMrg............................ntLLGLNNVIIRD..LGTLNNesi........nkkNVLG.GVE.............................................--.--FKCILMKL.VELRPTIE..........QLD.IILEisd................................................atgEFNNK..YIIALILV....Y...L.....RIQYYyane................tsdeAKRF....KA.LFQ.....QY..INDYR.KMKAISLNIdc...............wsQSQII....TVELIHMDELVH.WLS.......AKDNI...WG..I..PLGKCSWCNILE---df...................................................................
R1EUR9_EMIHU/44-217                    ..........................................dpvhg------APAFNINPMLLEGIRM..GdRF.WE--LAKLTT................................FGEVVDAIFYE..VKYVTP..............WVPG.THGkrssgmqs............................avrgvsnagTP.GIAYTMLLKL.FLLRLTRD..........QVR.SLLR......................................................HPDSP..YIRAIGFL....Y...L.....RLGLY.......................dFKEL....WA.WFQ.....PY..LGDDD.Q--F-----...................FIDGT....PATATTIGE---.---.......-----...--..-..---------------fdffgdrlprlpvlvsrqie.................................................
A0A067BPW6_SAPPC/9-173                 ..............................................t-HVHGVNPQHLVEKILRNRIYD..C.MY.WKEHCFGLTE................................-ETLVEKAIE-..LSYIAG..............-HFG.GNQ.............................................QP.SPFLCLLLKM.LQMQPDMD..........VVM.TFIE......................................................NGDYK..YVTALGAM....Y...L.....RLTGK........................PVEI....YP.VLE.....NL..LSDYR.KVRFRKTMG...................-----....-WDVLHMDEVAD.LLL.......REEYF...CN..I..ALPRLVDRFQLET--mn...................................................................
C4M949_ENTHI/7-169                     ..............................................l-PTQGNTRTMNIDSILFTNITH..S.DY.MFKTLGSIHS................................ISDLIDIIIND..VHYISP..............YIQK.SSS.............................................SP.STAFCVLLRL.FQLNPTPD..........DIR.MMST......................................................H-SNK..YVRCIAAL....I...I.....RYSIQ........................FNLL....LS.YLK.....PF..VDDRA.-VVNISLHG...................-----....-EKTKQIKCLVK.DLI.......LEPKF...EG..C..ILPRIPQ--------vyykp................................................................
A0A0V0S2G5_9BILA/10-175                ..............................................a-SLKGTNPQYLIEKVTRSRIYD..S.RY.WKEECFALSA................................-ELLVDRGME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLLLKM.LQIQPEKD..........IVI.EFIR......................................................QEDSK..YIRALGAL....Y...L.....RMTFS........................YVEV....YK.YLE.....PL..LNDYR.KLRWINKQG...................-----....KFELIHMDEFVD.KLL.......REERF...CD..V..QLPRLQKRAFLEE--tn...................................................................
A0A0D2P7T1_GOSRA/1-112                 ...............................................----------------------..-.--.----------................................-----------..------..............-MTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HPDSP..YIRAIGFL....Y...L.....RYAAD........................PKTL....WS.WFE.....PY..IKDEE.---------...................EFSPG...sSGRMTTMGVYVR.DLL.......LGQYY...FD..T..LFPRIPVPVL-----rqvt.................................................................
I1JHT5_SOYBN/4-166                     .......................................qtcgrpid---------SLLEKVLCMNILS..S.DY.FK-ELYRLKT................................YHEVIDEIYNQ..VDHVEP..............WMTG.NCR.............................................GP.STAFCLLYKF.FTMKLTVK..........QMH.GLLK......................................................HLDSP..YIRAVGFL....Y...L.....RYCAD........................PKTL....WN.WFE.....PY..VKDDE.---------...................EFSPG...sNGRMTTMGVYVR.DLL.......LGQYY...FD..T..LFPRIPVPV------lrqvv................................................................
A0A0N1PBP9_LEPSE/285-423               .............................rlltvfeqheqdvsavlr----------------------..-.--.----------................................------YCEQK..VRYAGV..............--FD.DDE.............................................EA.SPFLIAMGLC.WRLHLTMD..........DVC.RHFA......................................................RHPRR..VIRALALY....L...A.....RYTLA........................PEDY....VH.FFL.....PS..LNDEV.IIACTEDAQ...................-----....--VTHSMKDLSR.QLL.......TRNDV...VD..A..WLPMLAR--------ywqdh................................................................
J4C3Z9_THEOR/10-175                    .............................................hl--IHGTNPQFLFSKILRDKVYN..S.FY.WKESCFGLTA................................-ESLIDKAVQ-..LKYVGG..............-TFG.GNR.............................................QP.SPFLCLVLKM.LQIQPDME..........IVH.EYIK......................................................NEDFK..YLRALGVY....Y...M.....RLVGG........................AAEV....YG.TLE.....PI..LGDYR.KLRFRNTDG...................-----....SYSIKYMDEFVD.ECL.......TSSTY...LD..V..DFPPLAKRMSLEA--tr...................................................................
L5K6N9_PTEAL/10-175                    ..............................................h-SIHGTNPQYLVEKIIRTRIYE..S.KY.WKEECFGLTA................................-ELVVDKAME-..LRFVGG..............-VYG.GNI.............................................KP.TPFLCLTLKM.LQIQPEKD..........IIV.EFIK......................................................NEDFK..YVRMLGAL....Y...M.....RLTGT........................AIDC....YK.YLE.....PL..YNDYR.KIKSQNRNG...................-----....EFELMHVDEFID.ELL.......HSERV...CD..I..ILPRLQKRYVLEEA-e....................................................................
D0NNV1_PHYIT/37-201                    ..............................................l-PIYGNDTTYNLNTLLHQNILQ..S.AY.FH-DLYKFRT................................YHEVVDEIYYR..VDHAEP..............WSPG.TAR.............................................IP.SSCFCLLHKF.FLMRLTRK..........QMQ.GLLR......................................................HSDSP..YIRVVGFL....Y...L.....RFTCD........................PEEL....WT.WFE.....PY..LEDSE.---------...................EFNASa..nPSLKTTIGEWLI.SLL.......EENNY...FG..T..ILPRIPKKIE-----dgik.................................................................
A0A0C2FU65_9BILA/1-176                 ...............................................---------MNLNGLVLENVKE..S.YY.YKNHLVEIDS................................AQQLLDEVFYK..VKHLEP..............WEKG.TRKvqgmtgmcg...........................gvrgvgaggVV.SSAFCLLYRF.FKVRLTRK..........QLI.SMIN......................................................SRVSP..YIRGLGFM....Y...I.....RYTQP........................PADL....WE.WFE.....PY..LDDEE.---------...................EIDPRs..gGGDVMTFGQVVR.IML.......TKLDW...YG..T..LFPRIPVPIQKEID-e....................................................................
A7ARD6_BABBO/10-175                    .............................................vm--VHGTNPQNLFSKILRDKVYN..S.MY.WKESCFGLTA................................-ESIIDKAID-..LQYIGG..............-TFG.GNR.............................................QP.SPFLCLVLKL.LQIQPEIE..........IIQ.EYIR......................................................NEEFK..YLRALGIY....Y...M.....RLVGN........................AVQI....YQ.NLE.....PV..YADYR.KLRFRNNDG...................-----....SYDIRHMDEFVD.DCL.......RLSSY...LD..V..DLPILPKRMILEET-k....................................................................
G4VNB2_SCHMA/10-175                    ..............................................h-TVHGTNPQYLLEKIVRSRIYE..S.KF.WKEHCFALTA................................-ELLVDKAVE-..LRYVGG..............-VYS.GSV.............................................KP.TPFLCLTLKM.LQIQPDKD..........IVI.EFIK......................................................QEPYK..YARALGAF....Y...L.....RLVGD........................SVEI....YK.YLE.....TL..YNDFR.RLKFQDKMG...................-----....NFSLIYMDDFID.QLL.......TEERV...CD..V..ILPRLQKREVLEE--ln...................................................................
A0A098VUZ7_9MICR/10-175                ...............................................KSIHGTDPQFLIEKIVRERIYE..S.LY.WKQECYDLTT................................-ESLVEKAVR-..LSHIGS..............-TFG.GNQ.............................................KP.TPFLCLLLKL.LQLQPDFE..........IVY.ALIK......................................................DPTFK..YLRILASF....Y...L.....RLVGR........................PRDI....YE.NLE.....PL..YSDYR.KIRVKAPSS...................-----....DYYLLCIDQVIE.TLL.......NEDGI...FS..I..HLPRIPKRRDVEAK-d....................................................................
A0A091QL98_MERNU/1-137                 ..............................................q----------------------..-.--.----------................................-----------..VTHVEP..............WEKG.SRKtagqtgmcg...........................gvrgvgtggIV.STAFCLLYKL.FTLKLTRK..........QVM.GLIT......................................................HTDSP..YIRALGFM....Y...-.....--TQP........................PTDL....WD.WFE.....SF..LDDEE.-----DLDV...................--KAG....GGCVMTIGEMLR.SFL.......TKLEW...FS..T..LFPRIPVPVQKTI--dq...................................................................
H6BS57_EXODN/19-185                    .............................................pl--IRGQNPALLFETPMRDRITD..S.LY.WKEQCFGLNA................................-ATLCDRAVE-..LTYIGG..............-TYG.VAM.............................................KP.TPFICLAFKL.LTLVPDKE..........IVL.EYLKn....................................................gGEEWK..YLRALAAF....Y...I.....RLTFD........................PADV....YK.TLE.....PL..LEDYR.KLRYRRKET...................-----....-YELIHMDEFVD.NLL.......TKERV...CG..T..SLWKLPARQLLEDL-d....................................................................
W7X5L5_TETTS/175-341                   .............................................si---WEYDSSGTLNPKLKTNIMN..S.SY.FKIDLFSLKT................................YHEVIDEIQKH..VNHAEP..............YAIG.PTG.............................................VP.STLFCCLYKF.MLMKLTVK..........QVK.GLVE......................................................YKQSP..MVRAIGFL....Y...I.....RFCCD........................PKYM....FA.WFK.....KH..LLDDE.EFKPGAD--...................----K....NSPNMTIGDYVE.KLL.......SDQEY...YG..T..RLPRIPIKIETK---ika..................................................................
A0A0B2VGD8_TOXCA/46-230                ..............................................l-PLWGNTQSMNLNALVLENIIQ..C.TY.YKNYLSDTTG................................FQQLTEEIYYN..VKHLEP..............WERG.TRKtqgmtgmcg...........................gvrgvgaggVV.STAFCLLYKL.FTIRLTRK..........QLV.SMIN......................................................NRDSP..YIRGIGFM....Y...I.....RFCQP........................PTDL....WA.WME.....PY..LEDEE.---------...................QIDPRs..gGGDLMTMAQVVK.MML.......TKLDW...YG..T..LFPRIPVPIQKEIE-q....................................................................
A0A183IE68_9BILA/1-119                 .............................................me----------------------..-.--.----------................................-----------..LRFVGG..............-VYG.GNT.............................................KP.TPFLCLVLKM.LQIQPDKD..........IVI.EFIR......................................................QEDSK..YIRALGAL....Y...M.....RLTAS........................YVEV....YK.YLE.....PL..FNDYR.KLRWMNKNG...................-----....TFEIVHMDELID.KLL.......RDESI...CD..I..QLPRLQVR-------py...................................................................
#=GC SS_cons                           ..............................................T--BTTC-HHHHS-HHHHHHHHH..S.HH.HHHHSTT--H................................-HHHHHHHCCH..-SSECS..............-EET.TTT.............................................EE.-HHHHHHHHH.HHH---HH..........HHH.HHHHH....................................................HHCC-H..HHHHHHHH....H...H.....HHHS-........................HHHH....HH.HHG.....GG..GG---.EEEEEETTS...................-----....-EEEEEHHHHHH.HHH.......H-SEE...TT..E..E------HHHHHHT-T....................................................................
#=GC seq_cons                          ..............................................h..lhGpssphllppll+spIhp..S..Y.aKtphasLss.................................ppllDchhp...lpalts...............hhG.ssp.............................................tP.osahCLlhKh.hplpsp+c...........lh.phlp......................................................pp-.p..YlRALGhh....Y...l.....Rhsts........................sh-l....ap.ahE.....Ph..lpD.c.cl+....ts............................thplhphc-alc.pLL.......pcpch...hs..s..hLPRlshph.hc...p....................................................................
//
DBGET integrated database retrieval system