GenomeNet

Database: Pfam
Entry: PRTP
LinkDB: PRTP
Original site: PRTP 
#=GF ID   PRTP
#=GF AC   PF01366.13
#=GF DE   Herpesvirus processing and transport protein
#=GF AU   Bateman A
#=GF SE   Pfam-B_1171 (release 3.0)
#=GF GA   20.30 20.30;
#=GF TC   24.90 24.60;
#=GF NC   18.90 18.70;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   9696839
#=GF RT   Herpes simplex virus type 1 cleavage and packaging proteins UL15
#=GF RT   and UL28 are associated with B but not C capsids during
#=GF RT   packaging. 
#=GF RA   Yu D, Weller SK; 
#=GF RL   J Virol 1998;72:7428-7439.
#=GF DR   INTERPRO; IPR000501;
#=GF CC   The members of this family are associate with capsid
#=GF CC   intermediates during packaging of the virus.
#=GF SQ   211
#=GS PRTP_HHV2/15-246      AC P36385.1
#=GS Q9PZ53_9ALPH/18-682   AC Q9PZ53.1
#=GS Q2F7S8_HCMV/5-695     AC Q2F7S8.1
#=GS H2A1T0_MUHV1/5-660    AC H2A1T0.1
#=GS Q2F7Q9_HCMV/5-695     AC Q2F7Q9.1
#=GS A8T7D6_HCMV/3-693     AC A8T7D6.1
#=GS Q782R6_9ALPH/18-682   AC Q782R6.1
#=GS G8H8L9_HHV1/11-682    AC G8H8L9.1
#=GS Q2F7U2_HCMV/5-694     AC Q2F7U2.1
#=GS Q3C1Z0_9ALPH/15-681   AC Q3C1Z0.1
#=GS F8SUP4_9BETA/1-76     AC F8SUP4.1
#=GS Q5Y0S4_9ALPH/28-680   AC Q5Y0S4.1
#=GS Q2F7U6_HCMV/5-695     AC Q2F7U6.1
#=GS E9M5J4_9GAMA/216-573  AC E9M5J4.1
#=GS F0UXF1_9BETA/1-47     AC F0UXF1.1
#=GS Q96909_9BETA/1-317    AC Q96909.1
#=GS Q09IA5_HHV1/11-682    AC Q09IA5.1
#=GS Q25BY8_HHV1/11-682    AC Q25BY8.1
#=GS F8RDC6_HHV1/11-682    AC F8RDC6.1
#=GS TRM1_BHV2B/19-664     AC P17587.1
#=GS G8H5G4_HHV1/11-682    AC G8H5G4.1
#=GS G3G8Q7_9ALPH/2-632    AC G3G8Q7.1
#=GS Q86664_FHV1/25-679    AC Q86664.2
#=GS F0J888_9BETA/3-644    AC F0J888.1
#=GS TRM1_SUHVF/2-638      AC P11871.1
#=GS A2Q6M0_MUHVK/5-660    AC A2Q6M0.1
#=GS Q9E1Y6_9ALPH/5-653    AC Q9E1Y6.1
#=GS H2A371_MUHV1/5-658    AC H2A371.1
#=GS G3CF88_ILTV/5-673     AC G3CF88.1
#=GS Q2F7T1_HCMV/5-695     AC Q2F7T1.1
#=GS Q5Y920_9ALPH/1-195    AC Q5Y920.1
#=GS Q1HVB9_EBVA8/1-605    AC Q1HVB9.1
#=GS Q9IBU7_9ALPH/20-683   AC Q9IBU7.1
#=GS P88905_HHV8/1-607     AC P88905.1
#=GS Q2F7S0_HCMV/5-692     AC Q2F7S0.1
#=GS TRM1_EHV1V/6-669      AC Q6S6N9.2
#=GS Q2QBE8_CHV16/1-651    AC Q2QBE8.1
#=GS TRM1_HHV1A/11-682     AC P12835.1
#=GS Q7TFP3_RHCM6/3-642    AC Q7TFP3.1
#=GS Q5Y921_9ALPH/1-195    AC Q5Y921.1
#=GS Q77CC6_BHV1C/37-727   AC Q77CC6.1
#=GS F0UXF3_9BETA/3-684    AC F0UXF3.1
#=GS G8H914_HHV1/11-682    AC G8H914.1
#=GS F8REW2_HHV1/11-682    AC F8REW2.1
#=GS G9CUD7_9ALPH/20-683   AC G9CUD7.1
#=GS D3YP92_HHV1/11-682    AC D3YP92.1
#=GS Q2F7R5_HCMV/5-695     AC Q2F7R5.1
#=GS G3CEZ2_ILTV/5-673     AC G3CEZ2.1
#=GS Q9J2M5_9GAMA/1-599    AC Q9J2M5.1
#=GS Q2F7U0_HCMV/5-695     AC Q2F7U0.1
#=GS D0PP99_MHV68/1-571    AC D0PP99.1
#=GS Q85426_RCMVM/3-732    AC Q85426.1
#=GS Q2F7T0_HCMV/5-695     AC Q2F7T0.1
#=GS Q2F7S6_HCMV/5-695     AC Q2F7S6.1
#=GS B3UX12_MUHV1/5-660    AC B3UX12.1
#=GS D5LX68_HCMV/5-695     AC D5LX68.1
#=GS Q9YUI3_9BETA/3-554    AC Q9YUI3.1
#=GS Q69068_9BETA/3-612    AC Q69068.1
#=GS G8XTW2_SCMVC/3-644    AC G8XTW2.1
#=GS Q6QCM5_HHV3/5-661     AC Q6QCM5.1
#=GS Q5Y919_9ALPH/1-195    AC Q5Y919.1
#=GS Q2F7S2_HCMV/5-695     AC Q2F7S2.1
#=GS G8H880_HHV1/11-682    AC G8H880.1
#=GS D3XDP3_MUHV1/5-660    AC D3XDP3.1
#=GS G8XSX1_9BETA/3-638    AC G8XSX1.1
#=GS E2IUE1_SHV1/48-745    AC E2IUE1.1
#=GS F0UXF5_9BETA/1-53     AC F0UXF5.1
#=GS E9M5J4_9GAMA/1-219    AC E9M5J4.1
#=GS Q993K8_9GAMA/1-597    AC Q993K8.1
#=GS Q5Y968_9ALPH/2-655    AC Q5Y968.1
#=GS Q99D21_BHV4/1-605     AC Q99D21.1
#=GS Q0Q8Z2_HHV3/5-148     AC Q0Q8Z2.1
#=GS H8ZQZ3_ILTV/5-673     AC H8ZQZ3.1
#=GS Q2F7R1_HCMV/5-695     AC Q2F7R1.1
#=GS Q2FAM6_9BETA/3-642    AC Q2FAM6.1
#=GS B7TPX2_9BETA/3-625    AC B7TPX2.1
#=GS A2TIW1_9ALPH/16-694   AC A2TIW1.1
#=GS O56281_9BETA/3-611    AC O56281.1
#=GS A8DNQ7_9ALPH/16-694   AC A8DNQ7.1
#=GS Q2F7T3_HCMV/5-695     AC Q2F7T3.1
#=GS TRM1_VZVD/5-661       AC P09284.1
#=GS Q2F7R9_HCMV/5-695     AC Q2F7R9.1
#=GS F8RE06_HHV1/11-682    AC F8RE06.1
#=GS A8E1D4_MUHVK/5-660    AC A8E1D4.1
#=GS Q2HRD2_HHV8P/1-607    AC Q2HRD2.1
#=GS G9I250_HHV2/15-682    AC G9I250.1
#=GS D0U1J9_MHV68/1-571    AC D0U1J9.1
#=GS Q2F7T5_HCMV/5-695     AC Q2F7T5.1
#=GS G8H8U1_HHV1/11-682    AC G8H8U1.1
#=GS Q5Y922_9ALPH/1-195    AC Q5Y922.1
#=GS Q9WJZ7_HCMV/1-315     AC Q9WJZ7.1
#=GS F8RDS9_HHV1/11-682    AC F8RDS9.1
#=GS F8SUP7_9BETA/1-76     AC F8SUP7.1
#=GS Q7T5E0_CHV1/23-681    AC Q7T5E0.1
#=GS TRM1_MUHVS/5-660      AC P30674.1
#=GS F5B4S8_ILTV/5-673     AC F5B4S8.1
#=GS F8TC21_9ALPH/18-682   AC F8TC21.1
#=GS D3YPI6_HHV1/11-682    AC D3YPI6.1
#=GS Q89585_9ALPH/37-727   AC Q89585.1
#=GS Q2F7V1_HCMV/5-695     AC Q2F7V1.1
#=GS G3G8X2_9ALPH/2-632    AC G3G8X2.1
#=GS E7DVK6_HCMV/5-694     AC E7DVK6.1
#=GS Q2F7T6_HCMV/5-692     AC Q2F7T6.1
#=GS Q6SLG8_9ALPH/2-655    AC Q6SLG8.1
#=GS TRM1_EHV1/6-669       AC P68351.1
#=GS Q2F7S3_HCMV/5-695     AC Q2F7S3.1
#=GS Q53D60_9GAMA/1-599    AC Q53D60.1
#=GS F0UXG1_9BETA/3-677    AC F0UXG1.1
#=GS B0CMT7_HHV3/5-661     AC B0CMT7.1
#=GS Q2F7V0_HCMV/5-695     AC Q2F7V0.1
#=GS H2A2Q7_MUHV1/5-660    AC H2A2Q7.1
#=GS H8ZRF1_ILTV/5-673     AC H8ZRF1.1
#=GS Q5PPC6_SUHVF/2-638    AC Q5PPC6.1
#=GS Q2F7R4_HCMV/5-695     AC Q2F7R4.1
#=GS Q9QTC0_9ALPH/18-682   AC Q9QTC0.1
#=GS G8H8F0_HHV1/11-682    AC G8H8F0.1
#=GS Q4JQU5_VZVO/5-661     AC Q4JQU5.1
#=GS Q69103_HHV2/15-246    AC Q69103.1
#=GS TRM1_EHV2/1-639       AC Q66612.1
#=GS B9VQF6_9ZZZZ/11-682   AC B9VQF6.1
#=GS F0UXE9_9BETA/3-681    AC F0UXE9.1
#=GS Q5Y917_9ALPH/1-195    AC Q5Y917.1
#=GS B3UXZ2_MUHV1/5-660    AC B3UXZ2.1
#=GS G1EUP2_BHV4/1-605     AC G1EUP2.1
#=GS Q806A0_CHV1/85-743    AC Q806A0.1
#=GS C8CFA5_HCMV/5-695     AC C8CFA5.1
#=GS Q8JYD4_9GAMA/1-595    AC Q8JYD4.1
#=GS TRM1_HHV7J/3-611      AC P52385.1
#=GS H2A1B9_MUHV1/5-660    AC H2A1B9.1
#=GS O41929_MHV68/1-572    AC O41929.1
#=GS TRM1_ALHV1/1-596      AC O36361.1
#=GS A1BLZ9_9GAMA/1-598    AC A1BLZ9.1
#=GS Q69374_ILTV/1-180     AC Q69374.1
#=GS B9VXM5_HCMVT/5-695    AC B9VXM5.1
#=GS O39232_9GAMA/1-78     AC O39232.1
#=GS TRM1_HHV6U/3-612      AC P52384.1
#=GS G8XUD2_9BETA/3-640    AC G8XUD2.1
#=GS G3G952_9ALPH/2-638    AC G3G952.1
#=GS F0J884_9BETA/3-635    AC F0J884.1
#=GS Q80BQ7_SHV2/1-592     AC Q80BQ7.1
#=GS D3YRZ5_HCMVO/5-695    AC D3YRZ5.1
#=GS A7X7K2_9BETA/3-642    AC A7X7K2.1
#=GS F5HC79_HCMVM/5-695    AC F5HC79.1
#=GS O40914_HHV8/1-607     AC O40914.1
#=GS G8H194_9BETA/3-643    AC G8H194.1
#=GS F8RG58_HHV1/11-682    AC F8RG58.1
#=GS H8ZRN0_ILTV/5-673     AC H8ZRN0.1
#=GS Q9WT24_HHV6H/3-612    AC Q9WT24.1
#=GS PRTP_PSHV1/39-768     AC Q6UDK3.1
#=GS TRM1_TUHV2/3-652      AC Q9WRL6.1
#=GS Q69093_HHV2/1-76      AC Q69093.1
#=GS Q9DGW3_MEHV1/18-677   AC Q9DGW3.1
#=GS Q2F7U7_HCMV/5-695     AC Q2F7U7.1
#=GS Q2VSN0_9GAMA/1-598    AC Q2VSN0.1
#=GS TRM1_SHV21/1-592      AC P24911.1
#=GS Q8V6I6_9BETA/1-82     AC Q8V6I6.1
#=GS Q8UZD4_9GAMA/1-603    AC Q8UZD4.1
#=GS Q91HJ1_ILTV/1-447     AC Q91HJ1.1
#=GS Q69094_HHV2/42-78     AC Q69094.1
#=GS H2A294_MUHV1/5-659    AC H2A294.1
#=GS Q8B407_9GAMA/1-594    AC Q8B407.1
#=GS TRM1_HHV11/11-682     AC P10212.1
#=GS F8RFB3_HHV1/11-682    AC F8RFB3.1
#=GS TRM1_ELHVK/3-620      AC Q9DKU0.2
#=GS Q2F7S7_HCMV/5-695     AC Q2F7S7.1
#=GS Q69325_SHV2/1-70      AC Q69325.1
#=GS G9IX93_HHV3/5-661     AC G9IX93.1
#=GS B7FEH4_9ALPH/15-678   AC B7FEH4.1
#=GS Q2F7R6_HCMV/5-695     AC Q2F7R6.1
#=GS Q04459_HSVA1/1-160    AC Q04459.1
#=GS PRTP_GAHVM/20-683     AC Q77MS2.1
#=GS Q8QS32_9BETA/3-681    AC Q8QS32.1
#=GS F8RF36_HHV1/11-682    AC F8RF36.1
#=GS F0UXF4_9BETA/1-47     AC F0UXF4.1
#=GS TRM1_HHV6Z/3-612      AC P52544.2
#=GS Q2F7R0_HCMV/5-695     AC Q2F7R0.1
#=GS TRM1_EBVB9/105-709    AC P25939.1
#=GS O39274_EHV4/15-676    AC O39274.1
#=GS Q04234_HCMV/5-695     AC Q04234.1
#=GS Q5ZR68_9ALPH/2-655    AC Q5ZR68.1
#=GS TRM1_HHV1F/11-677     AC P06490.1
#=GS G8XTC8_SCMVC/3-644    AC G8XTC8.1
#=GS F0J8A1_9BETA/3-643    AC F0J8A1.1
#=GS Q9QH64_ILTV/5-251     AC Q9QH64.1
#=GS Q2F7U5_HCMV/5-695     AC Q2F7U5.1
#=GS Q2F7R3_HCMV/5-695     AC Q2F7R3.1
#=GS Q5Y918_9ALPH/1-195    AC Q5Y918.1
#=GS Q5Y916_9ALPH/1-195    AC Q5Y916.1
#=GS Q2F7S9_HCMV/5-695     AC Q2F7S9.1
#=GS H9DV05_9ALPH/16-694   AC H9DV05.1
#=GS TRM1_EHV1B/6-669      AC Q6DLH9.2
#=GS Q2F7R2_HCMV/5-695     AC Q2F7R2.1
#=GS A8B020_9BETA/3-643    AC A8B020.1
#=GS G8H984_HHV1/11-682    AC G8H984.1
#=GS TRM1_HCMVA/5-695      AC P16724.1
#=GS F0UXF9_9BETA/1-47     AC F0UXF9.1
#=GS Q77L98_TUHV1/3-652    AC Q77L98.1
#=GS Q6X240_9ALPH/34-716   AC Q6X240.1
#=GS Q9YTQ6_ATHV3/1-592    AC Q9YTQ6.1
#=GS Q777A8_EBVB9/105-709  AC Q777A8.1
#=GS F0J897_9GAMA/1-610    AC F0J897.1
#=GS Q8AZ07_9GAMA/1-594    AC Q8AZ07.1
#=GS F0UXF7_9BETA/3-685    AC F0UXF7.1
#=GS Q8B413_9GAMA/1-594    AC Q8B413.1
#=GS Q69261_9ALPH/1-265    AC Q69261.1
#=GS TRM1_HHV2H/15-682     AC P89451.1
#=GS B3UXI8_MUHV1/5-660    AC B3UXI8.1
#=GS Q9WRU0_9GAMA/1-599    AC Q9WRU0.1
#=GS G9IVT9_HHV3/5-661     AC G9IVT9.1
#=GS B3F8Y4_9ALPH/16-694   AC B3F8Y4.1
#=GS Q2F7T4_HCMV/5-695     AC Q2F7T4.1
PRTP_HHV2/15-246                 ....................a-RQKLLALLGQVQTYVFQLELLRRCDPQI..GL..GKLAQLKLNALQVRVLRRHLRPGLEAQA.AAFLTPLSVTLELLLEYAWREGERLLGHLDTFA......T...TGD.........VSAFFTETM...GLA..RPCPYHQQIRLETYG.GD-VRMELCFLHDVENFLKQLNYCHLTTPPSGATAALERVREFMVAAVGSGLIVPPELSDPSH.PCAVCFEELCVTANQGATIARRLADRICNHVTQQA...QVRLDANEL----------------...--------.....................-----------..................----------------.----------------------..............-------------------.---------.------------------.---...........---------------------------------------------------------......................................------.-.-----......................................................-.--------------------.............................................-----------------------------------------------------------------------------------........----------------------------------------------------------------------------------............----...--------------......--..-----------rry..........
Q9PZ53_9ALPH/18-682              ....................a-SQKLLAVWGQLQSYLFQVELLKRCDPRV..GV..RMIKPLKLNVLMVRYLENLMAPGLTEQL.ERNISPLSYGLWLALRRARLDGEVLLRALCEFT......D...TGD.........VHGFFIKSM...TIS..GDCPYHEVVELDTYG.GS-VRTEIKFLHDVENILKQLNYCHLIVKAGTAENFMLALDRYLIETLGAGSVVSPELCDPSQ.PCSVCFEELCVTANSGDSAHKRIIGKICNHVTKQI...VLRVHPDDMVAHIPHAACLSDEKRS...VVQAALSL.....................IRPTRGDKDPGgsg...........dtvsVADAATAVLDAHNVFL.PASGNLYAISELQFWIASSERKpn.........qprANTIDSFADNLEDLAFKER.LFDLRTSVV.EMTVFGRRMDHFERVFAQ.EIEn........mnAADRLLLGGRAVAPDDIIEALIRACYDHHMSTPLLKRLLYPEEAAQDALKTTLEQVT......................................SHSTRN.G.PLCQD......................................................G.DGAPEDDFSNSEHLRIR--Egvtpl..................................pdvrehYDWLELVRSASADVARRRKMYAERLSKRSLASLDKCITEQRKELEKMLRVNVYGEILIDSYTTLFNGFRSRNRLLEAIRKRCTni....idNRITADAFDAHRFMQTSLLKHRIDPAMLPSLTHKFFRLLNGPMFNHDVHRFAQPSNTALYFSVENVGLLPHLKEEIARFMIH............SCSS...SDWIVSKFRGFYDF......DG..IDSITAAHRMA.............
Q2F7S8_HCMV/5-695                ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpegea.....ihlrgreamsgtgttltT-----.-.----Asnssnssihnq................................rnnggggrargG.GKKAVGGGVNGQDGDGSENGlrvrncd...............................ehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGDQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
H2A1T0_MUHV1/5-660               ....................t-LQKLCVVCSKCNECAMDVECLKYCDPNI..VS..MDSTAFRRNGVMVIHLYRTLYPALVSQN.AVQTSVLTLYMEMLLQGLYDTMREIDMALTDFG......T...HRD.........RQRYYRRVL...KLD..-SCNRHESITITFAP.ELALTIDLATLNDVERLLCKINCVYGAVDASQGVAVCRRLLSLLARLCDICPVAGPEIYRETV.TCFQCYEELMAVPNQGRSINRRMQGLLCDHITIK-...KVLVQLDMDAQTVEQDMGDIAIRAPsvkGIIRAIKS.....................LASFSPASYA-..................YINDAEEALRGYNLFS.EIPDRIYSLSDYTYWSKTS---..............EAIVRHVGITMRQLNVSHS.LWKTLRTEL.SRYHYGEDLEDVFTLGEG.RFG...........GDERIYVGSIFAAPGKVVDMITSMSIKSFENNPLFNRL-HESNEIYAKIKSLIEEIRgvgdgpaa......................gaavsraeA-----.-.----Asgagag..........................................geegagA.---SAGRGN----------Tggdegagtt...........................tamssalecGDPLLRVHDVNKEVNVRKRAYLKKVSEMGYNKVMACIRNQEHLVTKLVNVNLVGTVCLEAVSKIMNGFLSRQRSITEAETYP-........DVAESLGYDEHLYVINNLVHKRLPSELLPQLGQQIYRFINGPMFTHYLDRHPLPYNVNMAYACDNAGILPHVKEDLVRCADG............TVVP...SDWMTVGYMGFFRF......AD..IRELNDLQKMV.............
Q2F7Q9_HCMV/5-695                ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpegeaihlrgreamsgtgttlmtasnsS-----.-.----Nssthsqrn.....................................nggggrargG.-------------------Gkkvvgggvngqdgdgs............englrvrncdehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGDQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
A8T7D6_HCMV/3-693                ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpegeaihlrgreamsgtgttlmtasnsS-----.-.----Nssthsqrn.....................................nggggrargG.GKKAVGGGANGQDGDGSENGlrvrncd...............................ehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGDQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
Q782R6_9ALPH/18-682              ....................a-SQKLLAVWGQLQSYLFQVELLKRCDPRV..GV..RMIKPLKLNVLMVRYLENLMAPGLTEQL.ERNISPLSYGLWLALRRARLDGEVLLRALCEFT......D...TGD.........VHGFFIKSM...TIS..GDCPYHEVVELDTYG.GS-VRTEIKFLHDVENILKQLNYCHLIVKAGTAENFMLALDRYLIETLGAGSVVSPELCDPSQ.PCSVCFEELCVTANSGDSAHKRIIGKICNHVTKQI...VLRVHPDDMVAHIPHAACLSDEKRS...VVQAALSL.....................IRPTRGDKDPGgsg...........dtvsVADAATAVLDAHNVFL.PASGNLYAISELQFWIASSERKpn.........qprANTIDSFADNLEDLAFKER.LFDLRTSVV.EMTVFGRRMDHFERVFAQ.EIEn........mnAADRLLLGGRAVAPDDIIEALIRACYDHHMSTPLLKRLLYPEEAAQDALKTTLEQVT......................................SHSTRN.G.PLCQD......................................................G.DGAPEDDFSNSEHLRIR--Egvtpl..................................pdvrehYDWLELVRSASADVARRRKMYAERLSKRSLASLDKCITEQRKELEKMLRVNVYGEILIDSYTTLFNGFRSRNRLLEAIRKRCTni....idNRITADAFDAHRFMQTSLLKHRIDPAMLPSLTHKFFRLLNGPMFNHDVHRFAQPSNTALYFSVENVGLLPHLKEEIARFMIH............SCSS...SDWIVSKFRGFYDF......DG..IDSITAAHRMA.............
G8H8L9_HHV1/11-682               ....................a-RQKLLALLGQVQTYVFQIELLRRCDPHI..GR..GKLPQLKLNALQVRALRRRLRPGLEAQA.GAFLTPLSVTLELLLEYAWREGERLLGSLETFA......T...AGD.........VAAFFTETM...GLA..RPCPYHQRVRLDTYG.GT-VHMELCFLHDVENFLKQLNYCHLITPSRGATAALECVREFMVGAVGSGLIVPPELSDPSH.PCAVCFEELCVTANQGATIARRLADRICNHVTQQA...QVRLDANELRRYLPHAAGLSDADRA...RALSVLDH.....................ALARTAGGDGQphpa.........pendsVRKEADALLEAHDVFQ.ATTPGLYAISELRFWLASGDRA.............gQTTMDAFASNLTALARREL.QQETAAVAV.ELALFGRRAEHFDRAFGS.HLAa........ldMVDALIIGGQATSPDDQIEALIRACYDHHLTTPLLRRLVSPEQCDEEALRRVLARMG......................................AGGAAD.A.PKGGAgpdddgdrva.................................veegtrglgapG.-------------------Gggededrr.............................rgpggqgpETWGDIATQAAADVRERRRLYADRLTKRSLASLGRCVREQRGELEKMLRVSVHGEVLPATFAAVANGFAARARFCALT-AGAGtv....idNRSAPGVFDAHRFMRASLLRHQVDPALLPSITHRFFELVNGPLFDHSTHSFAQPPNTALYYSVENVGLLPHLKEELARFIMG............AGGS..gADWAVSEFQRFYCF......DG..ISGITPTQRAA.............
Q2F7U2_HCMV/5-694                ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpegeaih.lrgreamsgtgttlmtassS-----.-.----Nssthsqrn.....................................nggggrtrgG.GKKAVGGGVNGQDGDGSENGlrvrncd...............................ehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGDQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
Q3C1Z0_9ALPH/15-681              ....................a-RQKLLALLGQVQTYVFQIELLRRCDPQI..GL..GKLAQLKLNALQVRVLRRHLRQGLEAQA.AAFLTPLSVTLELLLEYAWREGERLLGHLETFA......S...TGD.........VSAFFAETM...GLT..RPCPYHKQIRLDTYG.GD-VRMELCFLHDVENFLKQLNYCHLITPPRGATAALERVREFMVVAVGSGLIVPPELSDPSH.PCAVCFEELCVTANQGATIARRLADRICNHVTQQA...QVRLDANELRRYLPHATGLSDAARA...RALCVLDQ.....................ALARTAAGGAGprppp........adsssVREEADALLEAHDVFQ.TTTPGLYAISELRFWLASGDRA.............rHSTMDAFADNLNALAQREL.QQETAAVAV.ELALFGRRAEHFDRAFGG.HLAa........ldMVDALIIGGQATSPDDQIEALIRACYDHHLTTPLLRRLVSPEQCDEEALRRVLARLG......................................AGGAAG.G.PEEED.....................................................pR.VAAEEGGRRRGTGTPASEDGervpe..................................pgaqgpESWGDIATRAAADVRERRRLYADRLTKRSLASLGRCVREQRGELEKMLRVSVHGEVLPATFAAVANGFAARARFCALT-AGAGtv....idNRAAPGVFDAHRFMRASLLRHQVDPALLPSITHRFFELVNGPLFDHSTHSFAQPPNTALYYSVENVGLLPHLKEELARFIMG............AGGS..gADWAVSEFQKFYCF......DG..ISGITPTQRAA.............
F8SUP4_9BETA/1-76                .....................-----------------------------..--..----------------------------.---------------------------------......-...---.........---------...---..---------------.---------------------------------------------------------------.-----------------------------------...-------------------------...--------.....................-----------..................----------------.----------------------..............-------------------.---------.------------------.---...........---------------------------------------------------------......................................------.-.-----......................................................-.--------------------.............................................-----------------------------------------------------------------------------------........-------------------------------------LLIGPVITHHRDTFPLPFNIDMAYSCDNANILPHVKENLVKCIES............NIGP...GQWMVSSYNGFFDF......SD..SNDINEMQRKM.............
Q5Y0S4_9ALPH/28-680              ....................a-RQKLLALFGQVQTYVFQLELLRRCDPRI..GR..GKLAALKLNALQVRAVRRRLRPGLAAQA.RAFLTPLSVTLELLLEYAQREGERLLGCLEAFG......EgagAGD.........VAAFFAESM...GLA..RPCPYHQRIRLETYG.GG-VDTELCFLHDVENFLKQLNYCHLVTPPRGAVAALERVRDFLVGAVGSGLIVPPEISDPSH.PCAVCFEELCVTANQGATVARRLADRICNHVTQQA...QVRLDDNELRRYLPHAAGFSEAARA...RALRVLDQ.....................ALERTAAGASRergp..........adesARREADALLEAHDVFQ.PTTPGLYAVSELRFWLASGDRA.............hQSTMDAFADNLTELARREL.RHETAVAAV.ELALFGRRAEHFERAFGE.RLAa........ldMVDALLVGGQATSPEDQIEALIRACYDHHLTTPLLRRLVSPEQSDEEALRRVLARIG......................................GGRGDA.G.ETGEE......................................................-.GEGGAGAAAGEPAREAGP--.............................................ESWADVAGRAAADVRERRRLYADRLTKRSLASLGRCVREQRGELEKMLRVSVHGEVLPATFAAVSNGFAARVRFRDLTAAA-Gtv....vdNRAAPGVFDAHRFMRASLLRHHVDPALLPSITHRFFELVNGPLFDHATHSLAQPPNTALYYSVENVGLLPHLKEELARFIMG............AGGA..gTEWAVSEFQKFYSF......DG..ISGITPTQRAA.............
Q2F7U6_HCMV/5-695                ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpegeaihlrgreamsgtgttlmtasnsS-----.-.----Nssthsqrn.....................................nggggrargG.GKKAVGGGANGQDGDGSENGlrvrncd...............................ehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGDQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
E9M5J4_9GAMA/216-573             sepspapttteplpdaplasc-----------------------------..--..----------------------------.---------------------------------......-...---.........---------...---..---------------.---------------------------------------------------------------.-----------------------------------...-------------------------...--------.....................-----------..................----------HHNIFS.PVTTETIYLSTLLYWTANDYQTs............eNSPQEAKCSELSKIFTKEAaRFTDWKVHV.-QKRNIPFFNHYFCTTRP.T--...........PLQLLFSGGLCTSHCHIIDALKEDCTQAFLKKVQYSTTLTMKSELFHKLSQLLSSHT......................................TENHSL.T.ENMTS......................................................-.---------------ISSD-.............................................-----FETKTLSDAEKRKQAYFKKLSTKGVRDLVECLNKQTSRLQDMLIPRVWGSLLYHEVALLMNHFISRKRLMSQI-G-DT........HLPTEELQKNSTFIKTSMYGHTLNNDHLSSLAHTYYSLLVGPLEDQD-VIFHTPLNIVLAQALDAAGWLPHQKHLIAFDVNS............VQSP...RDWIDPTFNKFYSF......PK..-HCLTAIQKTA.............
F0UXF1_9BETA/1-47                .....................-----------------------------..--..----------------------------.---------------------------------......-...---.........---------...---..---------------.---------------------------------------------------------------.-----------------------------------...-------------------------...--------.....................-----------..................----------------.----------------------..............-------------------.---------.------------------.---...........---------------------------------------------------------......................................------.-.-----......................................................-.--------------------.............................................-----------------------------------------------------------------------------------........------------------------------------------------------------------GVLPHAKDDLVKCAEG............TVYP...SEWMVVKYMSFLHF......SE..CQDLNVLQKEM.............
Q96909_9BETA/1-317               .....................-----------------------------..--..----------------------------.---------------------------------......-...---.........---------...---..---------------.---------------------------------------------------------------.-----------------------------------...-------------------------...--------.....................-----------..................----------------.----------EFTYWSKIS---..............ESVIQKASITLNQLNLCHS.LYADLQNEI.SKFLYGETIQDVFNFNEE.NVT...........NDDKLYIGSRFISPCRLVDIITNVSIKNLEEDPVFTKL-AEEDEIQTKIKTLLNELE......................................NSAHET.V.PKKYV......................................................-.---------T----------.............................................-HSMTQDHNLQQEIHIRKKAYYQKISESGYSKVMLCIKEQEALINKLMNINILGNHIFESLSKMMNAFANRQLQSLGN-----........FSADPFTYDDHLYIKNNLLSKKLPQELLPNLSQEMYRLLTGPLSNYHTASFPLSSNISMAYACDVADFLPHMKEDLAKCVEG............TIYP...ENWMLCTYNKFFNF......DG..LHNINDMQRQM.............
Q09IA5_HHV1/11-682               ....................a-RQKLLALLGQVQTYVFQIELLRRCDPHI..GR..GKLPQLKLNALQVRALRRRLRPGLEAQA.GAFLTPLSVTLELLLEYAWREGERLLGSLETFA......T...AGD.........VAAFFTETM...GLA..RPCPYHQRVRLDTYG.GT-VHMELCFLHDVENFLKQLNYCHLITPSRGATAALERVREFMVGAVGSGLIVPPELSDPSH.PCAVCFEELCVTANQGATIARRLADRICNHVTQQA...QVRLDANELRRYLPHAAGLSDADRA...RALSVLDH.....................ALARTAGGDGQphpa.........pendsVRKEADALLEAHDVFQ.ATTPGLYAISELRFWLASGDRA.............gQTTMDAFASNLTALARREL.QQETAAVAV.ELALFGRRAEHFDRAFGS.HLAa........ldMVDALIIGGQATSPDDQIEALIRACYDHHLTTPLLRRLVSPEQCDEEALRRVLARMG......................................AGGAAD.A.PKGGAgpdddgdrva.................................veegtrglgapG.-------------------Gggededrr.............................rgpggqgpETWGDIATQAAADVRERRRLYADRLTKRSLASLGRCVREQRGELEKMLRVSVHGEVLPATFAAVANGFAARARFCALT-AGAGtv....idNRSAPGVFDAHRFMRASLLRHQVDPALLPSITHRFFELVNGPLFDHSTHSFAQPPNTALYYSVENVGLLPHLKEELARFIMG............AGGS..gADWAVSEFQRFYCF......DG..ISGITPTQRAA.............
Q25BY8_HHV1/11-682               ....................a-RQKLLALLGQVQTYVFQIELLRRCDPHI..GR..GKLPQLKLNALQVRALRRRLRPGLEAQA.GAFLTPLSVTLELLLEYAWREGERLLGSLETFA......T...AGD.........VAAFFTETM...GLA..RPCPYHQRVRLDTYG.GT-VHMELCFLHDVENFLKQLNYCHLITPSRGATAALERVREFMVGAVGSGLIVPPELSDPSH.PCAVCFEELCVTANQGATIARRLADRICNHVTQQA...QVRLDANELRRYLPHAAGLSDADRA...RALSVLDH.....................ALARTAGGDGQphps.........pendsVRKEADALLEAHDVFQ.ATTPGLYAISELRFWLASGDRA.............gQTTMDAFASNLTALARREL.QQETAAVAV.ELALFGRRAEHFDRAFGS.HLAa........ldMVDALIIGGQATSPDDQIEALIRACYDHHLTTPLLRRLVSPEQCDEEALRRVLARMG......................................AGGAAD.A.PKGGAgpdddgdrva.................................veegarglgapG.-------------------Gggededrr.............................rgpggqgpETWGDIATQAAADVRERRRLYADRLTKRSLASLGRCVREQRGELEKMLRVSVHGEVLPATFAAVANGFAARARFCALT-AGAGtv....idNRSAPGVFDAHRFMRASLLRHQVDPALLPSITHRFFELVNGPLFDHSTHSFAQPPNTALYYSVENVGLLPHLKEELARFIMG............AGGS..gADWAVSEFQRFYCF......DG..ISGITPTQRAA.............
F8RDC6_HHV1/11-682               ....................a-RQKLLALLGQVQTYVFQIELLRRCDPHI..GR..GKLPQLKLNALQVRALRRRLRPGLEAQA.GAFLTPLSVTLELLLEYAWREGERLLGSLETFA......T...AGD.........VAAFFTETM...GLA..RPCPYHQQVRLDTYG.GT-VHMELCFLHDVENFLKQLNYCHLITPSRGATAALERVREFMVGAVGSGLIVPPELSDPSH.PCAVCFEELCVTANQGATIARRLADRICNHVTQQA...QVRLDANELRRYLPHAAGLSDADRA...RALSVLDH.....................ALARTAGGDGQphps.........pendsVRKEADALLEAHDVFQ.ATTPGLYAISELRFWLASGDRA.............gQTTMDAFASNLTALARREL.QQETAAVAV.ELALFGRRAEHFDRAFGS.HLAa........ldMVDALIIGGQATSPDDQIEALIRACYDHHLTTPLLRRLVSPEQCDEEALRRVLARMG......................................AGGAAD.A.PKGGAgpdddgdrva.................................veegarglgapG.-------------------Gggededrr.............................rgpggqgpETWGDIATQAAADVRERRRLYADRLTKRSLASLGRCVREQRGELEKMLRVSVHGEVLPATFAAVANGFAARARFCALT-AGAGtv....idNRSAPGVFDAHRFMRASLLRHQVDPALLPSITHRFFELVNGPLFDHSTHSFAQPPNTALYYSVENVGLLPHLKEELARFIMG............AGGS..gADWAVSEFQRFYCF......DG..ISGITPTQRAA.............
TRM1_BHV2B/19-664                ....................a-RQKLLVVLGQLQTYIFQVELLKRCDPQV..AR..HQIGKLKLNALQVRAVSRHFMEGMSSQA.ATLITPLTLALELSLEYARREGEKLLEALNDLG......E...RSS.........PVAYFEGTM...GLA..RGCPHHQAVKLATYG.GE-IDKELCFLHDVENFLKQMNYCHLITPASAAAEALVSVKAFLARTVGSELIVPPEISDPSH.PCHVCFEELCVTANQGATASRRLAGKICDHVTQQA...RVRLDADEMRRNLPHVVGLSEARRA...RALHALE-.....................VSSKMTEANSGgpaea.......pgpaaaQEREASALLDAHHVFK.SAPPGLYAVSELRFWLSSGDRT.............sGSTVDAFADNLSALAERER.RYETGAVAV.ELAAFGRRGEHFDRTFGD.RVAs........ldMVDALFVGGQSAAPDDQIEALVRACYNHHLSAPVLRQLAGSEHGDAEALRSALEGLH......................................AAEDPP.G.DGNAE......................................................-.-KEARRAPSLGGG----PE-.............................................DDWAALAARAAADVGARRRLYADRLTKRSLASLGRCVREQRGELEKMLRVSTYGEVLPTVFAAVCNGFAARTRFCELT-ARAGtv....idNRGNPDTFDTHRFMRASLMRHRVDPALLPGITHQFFELVNGPLFDHATHGFAQPPNTALYFSVENVGLLPHLKEELARFMMG............KADS...-DWAISEFQKFYHF......DG..TSGITPTQRIA.............
G8H5G4_HHV1/11-682               ....................a-RQKLLALLGQVQTYVFQIELLRRCDPHI..GR..GKLPQLKLNALQVRALRRRLRPGLEAQA.GAFLTPLSVTLELLLEYAWREGERLLGSLETFA......T...AGD.........VAAFFTETM...GLA..RPCPYHQRVRLDTYG.GT-VHMELCFLHDVENFLKQLNYCHLITPSRGATAALERVREFMVGAVGSGLIVPPELSDPSH.PCAVCFEELCVTANQGATIARRLADRICNHVTQQA...QVRLDANELRRYLPHAAGLSDADRA...RALSVLDH.....................ALARTAGGDGQphps.........pendsVRKEADALLEAHDVFQ.ATTPGLYAISELRFWLASGDRA.............gQTTMDAFASNLTALARREL.QQETAAVAV.ELALFGRRAEHFDRAFGS.HLAa........ldMVDALIIGGQATSPDDQIEALIRACYDHHLTTPLLRRLVSPEQCDEEALRRVLARMG......................................AGGAAD.A.PKGGAgpdddgdrva.................................veegarglgapG.-------------------Gggededrr.............................rgpggqgpETWGDIATQAAADVRERRRLYADRLTKRSLASLGRCVREQRGELEKMLRVSVHGEVLPATFAAVANGFAARARFCALT-AGAGtv....idNRSAPGVFDAHRFMRASLLRHQVDPALLPSITHRFFELVNGPLFDHATHSFAQPPNTALYYSVENVGLLPHLKEELARFIMG............AGGS..gADWAVSEFQRFYCF......DG..ISGITPTQRAA.............
G3G8Q7_9ALPH/2-632               ....................a-ERRLVAVLGQVQTYVFQLEMLKRCDPAV..VR..ELAPRVKLNALMCRYLARRL--PLEAQ-.---MTPLTCALRLALAYARAEGDRVLGALAA--......A...GDD.........AEAYFERTM...G--..GACRFHARVALDTYG.GR-VETELQFLHDAENLLKQLNYCHLITPHAVD---LSAVDEFLARTIGGGLVVPPELYDPAQ.PCAVCFEELCVTANQGEATHRRLLGCVCDHLTRQL...AVRVDPEDVAKNLPHVRGLDEARRG...RALAALAA.....................VDAAEAREAEAgaeag........dagetARRRADALLDAHDVFR.PASRRLYAVSELQFWLASTNQA..............VRALDLFTHNLDDLERRER.RAEVRAAAV.ELALFGRRPEHFDRARAArELD...........IIDGLLVGGCAASPDERLEALIRACYDHHMSTPMLRML-DPDRANRDALERLLEGGD......................................DADADG.G.AAGGA......................................................D.AGDGGVGDEDGPGAPPPADA.............................................VAWADLPAAALRDAERRRRLYADRLSRRSAASLAQCVREQRRELEKTLRVNVYGDALLHTYVAVAAGFRARRAFCEAV-ARAGt.....vvDERETGCFDAHSFMKATVQRHPVDAALLPALTHKFFELVNGPLFAHDTHAFAQPPNTALYFAVENVGLLPHLKEELARFMVA............R---...-DWCVSEFRGFYRF......QT..-AGVTATQRQA.............
Q86664_FHV1/25-679               ....................a-RQRLLVILGQIQTYIFQIELLKRCDPEV..LR..RYMNPLKLNALTIRFLSRKLFPALGNQA.RHIQTPLTYAVWIALRYASIEGERLIDVATT-F......I...DRS.........FLEFFKETM...KLE..APCEYHKTLNLTTYG.GN-VITEMRFLHDLENFLKQLNYCHLITSFGSALRVMEDIDMFMVKTLGGGFIVPPELFDPMQ.PCSICFEELCVTANQGEAVHRRLLGCICDHLTRQM...SLKIEEDYLVKHLPYIPGLVDEKRN...AAQAAIEK.....................IEAGRRKAIDNhsk............ndlTDNLADGLLDTHNVFK.SAPKSLYAVSELKFWLASAGLDg...........veRRTIDSFTDNLQTLSLREQ.HVRLQIVTA.ELALFGRSMNHFERVVGE.GLVd........fdIIDNLMIGSYVISPDDQLGALIRACYDHHLSTPLLRQLTNPDKSDKEALKQLLERIG......................................NNQESS.N.EEECL......................................................D.--DHIETQSQSDRAIDSPEGcnv.......................................lpqRSWDKLLERAASDAAHRRRLYAERLSKRSLASLGRCVREQRRELEKTLRVNVYGDTLIHTYVSVYNGFCARRAFCDTA-ARAGmv....idNRYNESVFDSHSFMKASLLRHSIDPSLLPSLTHKFFELVNGPLFDHDSHNFAQPPNTAFYFSVENVGLLPHLKEELAGFMLT............STRG...-GWTVSKFQRFYYF......GD.dTSGVTTTQRLA.............
F0J888_9BETA/3-644               ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESSPFKRNALAIAYLYRRIYPEVVRQN.RTQTSLLSLYLEMILKALYEDTELLDRALKEYS......R...RPD.........RMEYYRTIL...RLD..-RCDRHHTVELTFTE.HVKFSVNLATLNDIERFLCKMNYVYAILSPESGLEVCSQLLQMLRRLCGVSPVACQEAYVEGM.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIVVH-...RPSSQCDVNIQTVEQDLLELTQRIPslsGVLTALKN.....................LFSSSSVYHS-..................YIQEAEEALKEYNLFT.DIPARIYSLSDFTYWSRTS---..............EVIVKRVGISIQQLNVYHH.LCRVLMNTL.SNHLYGEDVEDIFVVGEK.ALS...........REERLFVGSVFAAPSRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKSLLDEIR......................................RPAAPD.G.AAAEVggg................................................saiR.------GQDPQNTSSSN--Gaaqded.................................ddfldyLDARTRAHNVTREVNIRKRAYLQKVSEVGYAKVIRCIKSQERLTSKLIDVNLIGTVCLDFISRLMNGFIYRTQYRENPDV--V........DVSQTLSYDEHLYVVNNIIHKSLPAESLPLLGQQIYQLCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHIKDDLVKCAEG............TVHP...SEWMVVKYQSFFNF......GD..CVDLNMLQKEM.............
TRM1_SUHVF/2-638                 ....................a-ERRLVAVLGQVQTYVFQLEMLKRCDPAV..VR..ELAPRVKLNALMCRYLARRL--PLEAQ-.---TTPLTCALRLALAYARAEGDRVLGALAA--......A...GDD.........AEAYFERTM...G--..GACRFHARVALDTYG.GR-VETELQFLHDAENLLKQLNYCHLITPHAVD---LSAVDEFLARTIGGGLVVPPELYDPAQ.PCAVCFEELCVTANQGEATHRRLLGCVCDHLTRQL...AVRVDPEDVAKNLPHVHGLDEARRG...RALAALAA.....................VDAAEAREAEAastaaaga..eagdagetARRRADALLDAHDVFR.PASRRLYAVSELQFWLASTNQA..............VRALDLFTHNLDDLERRER.RAEVRAAAV.ELALFGRRPEHFDRARAArELD...........IIDGLLVGGCAASPDERLEALIRACYDHHMSTPMLRML-DPDRANRDALERLLEGGD......................................DADADG.G.AAGGA......................................................D.AGDGGVGDEDGPGAPPPADA.............................................VAWADLPAAALRDAERRRRLYADRLSRRSAASLAQCVREQRRELEKTLRVNVYGDALLHTYVAVAAGFRARRAFCEAA-ARAGt.....vvDERETGCFDAHSFMKATVQRHPVDAALLPAVTRKFFELVNGPLFAHDTHAFAQPPNTALYFAVENVGLLPHLKEELARFMVA............R---...-DWCVSEFRGFYRF......QT..-AGVTATQRQA.............
A2Q6M0_MUHVK/5-660               ....................t-LQKLCVVCSKCNECAMDVECLKYCDPNI..VS..MDSTAFRRNGVMVIHLYRTLYPALVSQN.AVQTSVLTLYMEMLLQGLYDTMREIDMALTDFG......T...HRD.........RQRYYRRVL...KLD..-SCNRHESITITFAP.ELALTIDLATLNDVERLLCKINCVYGAVDASQGVAVCRRLLSLLARLCDICPVAGPEIYRETV.TCFQCYEELMAVPNQGRSINRRMQGLLCDHITIK-...KVLVQLDMDAQTVEQDMGDIAIRAPsvkGIIRAIKS.....................LASFSPASYA-..................YINDAEEALRGYNLFS.EIPDRIYSLSDYTYWSKTS---..............EAIVRHVGITMRQLNVSHS.LWKTLRTEL.SRYHYGEDLEDVFTLGEG.RFG...........GDERIYVGSIFAAPGKVVDMITSMSIKSFENNPLFNRL-HESNEIYAKIKSLIEEIRgvgdgpa.......................agaaasraE-----.-.----Aasgaga.........................................ggeegagA.---AAGRGN----------Tggdegagtt...........................tamssalecGDPLLRVHDVNKEVNVRKRAYLKKVSEMGYNKVMACIRNQEHLVTKLVNVNLVGTVCLEAVSKIMNGFLSRQRSITEAETYP-........DVAESLGYDEHLYVINNLVHKRLPSELLPQLGQQIYRFINGPMFTHYLDRHPLPYNVNMAYACDNAGILPHVKEDLVRCADG............TVVP...SDWMTVGYMGFFRF......AD..IRELNDLQKMV.............
Q9E1Y6_9ALPH/5-653               ....................i-NRVMMVLLGQLKTYTFQMELLRRCDPRI..AC..RFISSLTINCLTVRYIIKHLQPGLIKQT.SGKLTPLIYSLVVTLKYLQYEAEALLELLINFNgnliscV...DED.........IKTYFVSAF...GLN..NHCPYHHMVYLKTYG.EN-INTEIQFLHDVENFLKQLNYCYIITSAENALTTLCDMEPFLVKTIGSGFITPLEIFDHTH.PCSVCFEELCITANQGEVLHRRLLGCICDHVTKQM...RINVDVNDILTCVPYVTNTSHEKRN...SAVKALRA.....................LKNKQMHYTEKsr..............esHQKIAADILDAHSVFK.PAPRCMYALSELQFWLTSSSREh...........stQRTLDAFVNNLDALGESEK.NAELMAITT.ELALFENTPLHFNRAFST.ELGs........lnAIDSILVGNCYLSPDSQINALIQACYNHHMSSSLMQHLVNPSQDNEVALRQLLEQLE......................................CSNENT.A.GTDGT......................................................-.-----ILDEHSQVNELASEV.............................................YGWEQLIAQSRSNADVRKRAYLERLSKRSLISLGKCVKEQRKELEKTLRVNVYGETLLYTFVTVYNAFSARRLFLSLLN-ESGti....idNRISETAFDSHMFVRNALIKSTVDAAMLPSLTHKFFELVNGPIFCHDEHCFAQPPNTALFFTVENVGLFPHLKEELAKFMGA............VVGS...-NWTVSTFRSFYSF......HG..VEGVTTAQRLA.............
H2A371_MUHV1/5-658               ....................t-LQKLCVVCSKCNECAMDVECLKYCDPNI..VS..MDSTAFRRNGVMVIHLYRTLYPALVSQN.AVQTSVLTLYMEMLLQGLYDTMREIDMALTDFG......T...HRD.........RQRYYRRVL...KLD..-SCNRHESITITFAP.ELALTIDLATLNDVERLLCKINCVYGAVDASQGVAVCRRLLSLLARLCDICPVAGPEIYRETV.TCFQCYEELMAVPNQGRSINRRMQGLLCDHITIK-...KVLVQLDMDAQTVEQDMGDIAIRAPsvkGIIRAIKS.....................LASFSPASYA-..................YINDAEEALRGYNLFS.EIPDRIYSLSDYTYWSKTS---..............EAIVRHVGITMRQLNVSHS.LWKTLRTEL.SRYHYGEDLEDVFTLGEG.RFG...........GDERIYVGSIFAAPGKVVDMITSMSIKSFENNPLFNRL-HESNEIYAKIKSLIEEIRgvgdgp.........................aagaaasR-----.-.----Aeaasg............................................agaggE.EGAAAGRGNTGGDE-----Gagttta................................mssalecGDPLLRVHDVNKEVNVRKRAYLKKVSEMGYNKVMACIRNQEHLVTKLVNVNLVGTVCLEAVSKIMNGFLSRQRSITEAETYP-........DVAESLGYDEHLYVINNLVHKRLPSELLPQLGQQIYRFINGPMFTHYLDRHPLPYNVNMAYACDNAGILPHVKEDLVRCADG............TVVP...SDWMTVGYMGFFRF......AD..IRELNDLQKMV.............
G3CF88_ILTV/5-673                ..................tql---RLMALAGQLQTLLFQIDILKRCDPEI..LLqkRLRSRIKHNALMALYIHSLLSNELSMQV.NYRLTLQTYCVWLWLRRACSEIAALCNEIDKYS......V...LKD.........RKCFFEATL...GYGkgFICPLHAEVQLQLYGmSSIISKELVLINDVENFMKQLNYCHCVVSCKNAIEALNTIDEFLVLSSGGSLVAAPDTYDHGQ.PCYVCLEELSVTANQGETIYRRLGYKICDHLTRQF...PVNVSTDDLKRHLPFLRDVDPEKLK...NVLSNETR.....................IEAENHVEAGRtls............sspGESEASKILNKYDVFT.EPPGPVYQLSELQYWLASGKRTpsgve...sqtttsQSVLKQLDKDLSELFKRAE.DFEQECIRL.ERTLFGKVHAHFHRVAQA.ELIsp......qhsLVDTLITGVLATSPDTEIAALIKACYDHHLSLPLFRRLRNPEKVDTDALEELVEKLR......................................GSDKET.Q.PVTEG......................................................T.STSDLTANLRGTIERDEDS-.............................................--IEVLLKKAERDLDVRQKNYVEKLSARSFSNLDRCIKTQRAELEKLMRVNIYGETLPVMYVTLKNAFLARRAFLDIVCAEESlhskilriDQNDGRAYDWHQYIRSSITRYQIDQTMLPRLTNRFFEILSGPLFKHHKERFPQPPNTSIYFSVENVGLLPHLKEELANFTKR............HRSC...-DWMTSEFRRFYNF......AG..ISNSTAIQRAA.............
Q2F7T1_HCMV/5-695                ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpegeaihlrgreamsgtgttlmtasnsS-----.-.----Nssthsqrn.....................................nggggrargG.-------------------Gkkvvgggvngqdgdgs............englrvrncdehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGDQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDFVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
Q5Y920_9ALPH/1-195               ...................rg-----------------------------..--..----------------------------.---------------------------------......-...---.........---------...---..---------------.---------------------------------------------------------------.-----------------------------------...-------------------------...--------.....................-----------..................----------------.----------------------..............-------------------.---------.------------------.---...........---------------------------------------------------------......................................------.-.-----......................................................-.--------------------.............................................------------ETEERKRAYAARLSRRSFLNLSKCVEKQRAFLDKMLSVNVWGQFLLEAAVRTRNGFSRRARFLERVTSFGGev....rdKRLCRTDYDARQFVRNALLRHEVDPALLSELVNRFYELINGPYFTHAYHVFAQPHNTPLYFCVENVGLLPHIKNELASFMLI............RSHR...-EWMVSEYKEFYKFppvcdpEK..AGALNDLQRL-a............
Q1HVB9_EBVA8/1-605               ....................m-SGLLAAAYSQVYALAVELSVCARLDPRS..--..LDVAAVVRNAGLLAELEAILLPRLRRQN.DRACSALSLELVHLLENSREASAALLAPGRK--......-...---.........----GTRVP...PLR..---TPSVAYSVEFYG.GHKVDVSLCLINDIEILMKRINSVFYCMSHTMGLESLERALDLLGRFRGVSPIPDPRLYITSV.PCWRCVGELMVLPNHGNPSTAEGTHVSCNHLAVPVnpePVSGLFENEVRQAGLGHLLEAEEKA...RPGGPEEG.....................A---------Vpgp............grpEAEGATRALDTYNVFS.TVPPEVAELSELLYWNSGGHAIg...........atGQGEGGGHSRLSALFARER.RLALVRRAC.EEALAGARLTHLFDAVAP.G--...........ATERLFCGGVYSSSGDAVEALKADCAAAFTAHPQYRAILQKRNELYTRLNRAMQRLG......................................RGEEEA.S.RESPE......................................................-.------VPRPAGAREPGPS-.............................................--------GALSDALKRKEQYLRQVATEGLAKLQSCLAQQSETLTETLCLRVWGDVVYWELARMRNHFLYRRAFVSGP-WEDR........RAGEGAAFENSKYIKTHLFTQTLSSEHLHALTHSLYTFITGPLAEES-GLFPPPSNVALARCCDAAGTLPHQKAFLTSLIWP............GIEP...SDWIETSFNSFYSV......PG..-GSLASSQQ--il...........
Q9IBU7_9ALPH/20-683              ....................a-TQKLFAIWGQIQSYLFQVELLKRCDPTV..GV..RMINRLKLNVLMIYYLEKKMVPALKEQR.EMNLTPLTYGLWLALRRAKLEGELLLDALCEFK......D...GGN.........LRDFFRKSM...SMC..GDCPYHSTVELDTYG.GK-VSTEIKFLHDVENVLKQLNYCHLILKADTVENFMVSLDNYLLKTLGSGSVVPPELYDPSQ.PCSVCFEELCVTANSGDSTHKRIVRKICDHITKQI...NIRVNSDDMVTHLPHATYVPDDKRT...TAQTALDV.....................IQSTMRDTTTEnds............nisVSKAAAAALDAHNVFL.PASGDLYAISELQFWIASSGRKlh.........qprGNTVESFADNLEALVSKER.LFDLRTSIV.ETAVFDRRMDHFERVFAQ.EIEh........mnAADRLLLGGRAAAPDDIIEALIKACYDHHMSAPLLKRLLYPDEAAHDALKTVLERVS......................................SHCIGN.D.IQCQD......................................................G.DGTCGERMNETGHFRTNDSFamst....................................tslghDEWLEMVKSASSDVARRRKMYAERLTKKSLASLDKCITEQRHELEKMLRVNVYGEVLIDSYTALFNGFRSRKRLLEAVKNCCAni....idNRNSDDAFDAHRFMQTSLLKHRIDPAMLPSLTHKFFQLVNGPMFSHDRHRFAQPSNTALYFSVENVGLLPHLKEEMARFMFH............SSRK...TDWTVSKFRGFYDF......ST..IDNVTAAHRMA.............
P88905_HHV8/1-607                .....................MAKELAAVYADVSALAMDLCLLSYADPAT..--..LDTKSLALTTGKFQSLHGTLLPLLRRQN.AHECSGLSLELEHFWKTWLMLWPRWECALAE--......-...NCL.........QKSIFPSCI...-WT..QHATSNRSVRFNFYG.NWALELKLSLINDVEIFFKRLSSVFYCIGSGSALEGLGEVLRFVGKLRGISPVPGPDLYVSNL.PCLECLQEVCLTPNQGTSLQAMLPDTACSHICTPAcgePVRGLFENELKQLGLQTPESIPTTP...--------.....................CQSRVRQDDE-..................IRQSSLMAVGDHHIFG.EVTRSVLEISNLIYWSSGHSDA..............TCDGDRDCSHLASLFTHEA.DMHKRRVDLaGCLGERGTPKHFFDCFRP.D--...........SLETLFCGGLFSSVEDTIESLQKDCSSAFYQQVNYTTALQKQNEFYVRLSKLLAAGQ......................................LNLGKC.S.TESCQ......................................................-.-----SEARRQLVGGGKPE-.............................................--------EVLRDAKHRQELYLQKVARDGFKKLSDCIRHQGHILSQTLGLRLWGSVIYNEASALQNHFLHRAQFISLP-WQDL........TVDCPTRFENSKYIKNSLYCQRLGREHVEILTLEFYKLITGPLSKRH-TLFPSPPNVTLAQCFEAAGMLPHQKMMVSEMIWP............SIEP...KDWIEPNFNQFYSF......EN..-QDINHLQKRA.............
Q2F7S0_HCMV/5-692                ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpegeai...hlrgreamsgtgttlmtaS-----.-.----Nssthsqrn.....................................nggggrargG.-------------------Gkkvvgggvngqdgdgs............gnglrvrncdehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGDQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
TRM1_EHV1V/6-669                 ....................a-RQRLLAIFGQVQAYIFQVEMLKRCDPLA..LL..PLVGSLKLNALTIRMLRRKLGGALIEQA.QHQQTPLACALTMALEYAEVEGERVLRAVDDVN......L...AG-.........PEGFFRATM...RLD..EPCEYHVRVHLDTYG.GP-IDAEVQFLHDAENFLKQLNYCHLITGFEAGLDALESVARFLTRTVGSGIVVPPELCDPTH.PCSVCFEELCVTANQGEAVHRRLLECTCDHITRQM...AVRVANIDIARHLPHALSVASERRA...AAEAALRA.....................LEARRVQGHNGksag..........tedpTQQVASRLLESHHVFK.PASRCLYAVSELKFWLASTKHGdm..........gqPRAIDTFTENLETLDKQEK.FFHLQAATV.ELALFGRTLDHFDRLFAD.QLLg........ldVIDGMLVGSCAVSPDDHIEALIKACYTHHMSAPLLQRLTDPDTSNREALKQLLGRIG......................................VDTDDG.A.GELGDaldvdld........................................nlggappV.NST----------------Pcgedal................................crtvseeRPWDKLLERATADASQRRRMYAERLSKRSIASLGRCVREQRRELEKTLRVNVYGEVLLHTYVSSYNGFCARRGFCAAV-SRAGti....idNRSSTSAFDSHQFMKAALLRHPIDQSLMPSITHKFFELINGPVFDNAGHNFAQPPNTALYYSVENVGLLPHLKEELARFMIT............AAKG...-DWSISEFQRFYCF......EG..VTGVTATQRLA.............
Q2QBE8_CHV16/1-651               ....................m------------QTYVFQLELLRRCDPRI..GR..GKLAALKLNALQVRAVRRRLRPGLAAQA.RAFLTPLSVTLELLLEYAQREGERLLGCLEAFG......EgggEGD.........VAAFFAGSM...GLA..RPCPYHQRIRLETYG.GG-VETELCFLHDVENFLKQLNYCHLVTPPRGAVAALGRVRDFLVGAVGSGLIVPPEISDPTH.PCAVCFEELCVTANQGATVARRLADRICNHVTQQA...QVRLDDNELRRYLPHAAGFSEAARA...RALRVLDQ.....................ALERTAAGADPargp..........adesARREADALLEAHDVFQ.AATPGLYAISELRFWLASGDRA.............hQSTMDAFADNLTELARREL.RHETAVAAV.ELALFGRRAEHFERAFGE.RLAa........ldMVDALLVGGQATSPEDQIEALIRACYDHHLTTPLLRRLVSPEQSDEEALRRVLARLG......................................GAGRGG.A.GDAGE......................................................G.EDGAARPPSPSPAAPGGGEAsrg.......................................dgpESWADVAGRAAADARERRRLYADRLTKRSLASLGRCVREQRGELEKMLRVSVHGEVLPATFAAVSNGFAARVRFRDLT-AGAGtv....vdNRAAPGVFDAHRFMRASLLRHHVDPALLPSITHRFFELVNGPLFDHATHSLAQPPNTALYYSVENVGLLPHLKEELARFIMG............AGGA..gTEWAVSEFQKFYSF......DG..ISGITPTQRAA.............
TRM1_HHV1A/11-682                ....................a-RQKLLALLGQVQTYVFQIELLRRCDPHI..GR..GKLPQLKLNALQVRALRRRLRPGLEAQA.GAFLTPLSVTLELLLEYAWREGERLLGSLETFA......T...AGD.........VAAFFTETM...GLA..RPCPYHQRVRLDTYG.GT-VHMELCFLHDVENFLKQLNYCHLITPSRGATAALERVREFMVGAVGSGLIVPPELSDPSH.PCAVCFEELCVTANQGATIARRLADRICNHVTQQA...QVRLDANELRRYLPHAAGLSDADRA...RALSVLDH.....................ALARTAGGDGQphps.........pendsVRKEADALLEAHDVFQ.ATTPGLYAISELRFWLASGDRA.............gQTTMDAFASNLTALARREL.QQETAAVAV.ELALFGRRAEHFDRAFGS.HLAa........ldMVDALIIGGQATSPDDQIEALIRACYDHHLTTPLLRRLVSPEQCDEEALRRVLARMG......................................AGGAAD.A.PKGGAgpdddgdrva.................................veegtrglgapG.-------------------Gggededrr.............................rgpggqgpETWGDIATQAAADVRERRRLYADRLTKRSLASLGRCVREQRGELEKMLRVSVHGEVLPATFAAVANGFAARARFCALT-AGAGtv....idNRSAPGVFDAHRFMRASLLRHQVDPALLPSITHRFFELVNGPLFDHSTHSFAQPPNTALYYSVENVGLLPHLKEELARFIMG............AGGS..gADWAVSEFQRFYCF......DG..ISGITPTQRAA.............
Q7TFP3_RHCM6/3-642               ....................l-LQKLCVVCSKCNEYAMELECLKYCDPSV..LL..AESSPFKKNALAIAYLYRRIYPELVRQN.RTQTSLLSLYMEMILKALYEDTELLDRALKAYS......R...RQD.........RAEYYRTVL...RLD..-RCDRHHTVELTFTD.NVKFSVTLATLNDIERFLCKMNYVYAILSPESGLEVCSQLLQLLRRLCGVSPVACQEAYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIVVH-...RPSSQCDVNIQTVEQDLTELTQRIPslsGVLTALKN.....................LFSSSSVYHS-..................YIQEAEEALREYNLFT.DIPARIYSLSDFTYWSRTS---..............EVIVKRVGISMQQLNIYHH.LCRVLMNVL.SRYLYGEDVEDIFVLGEK.LLS...........REQRLFVGSVFAAPSRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKCLLDEIR......................................RPVPDG.A.AAAEGvg.................................................aaiH.GQDPQSTSSNGGAPD----Edne......................................fldyMDARTRIHNVTREVNIRKRAYLQKVSEVGYAKVIRCIKSQERLTSKLIDVNLIGTVCLDFISRLMNGFIYRTRYRDNPDV--V........DVSQVLSYDEHLYVVNNIIHKSLPVESLPLLGQQIYQLCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHIKDDLVKCAEG............TVYP...SEWMVVKYQGFFDF......SS..CGDLNMLQKEM.............
Q5Y921_9ALPH/1-195               ...................rg-----------------------------..--..----------------------------.---------------------------------......-...---.........---------...---..---------------.---------------------------------------------------------------.-----------------------------------...-------------------------...--------.....................-----------..................----------------.----------------------..............-------------------.---------.------------------.---...........---------------------------------------------------------......................................------.-.-----......................................................-.--------------------.............................................------------ETEERKRAYAARLSRRSFLNLSKCVEKQRAFLDKMLSVNVWGQFLLEAAVRTRNGFSRRARFLERVTGFGGev....rdKRHCRTDYDARQFVRNALLRHEVDPALLSELVNRFYELINGPYFTHAYHVFAQPHNTPLYFSVENVGLLPHIKNELASFMLI............RNHR...-EWMVSEYKEFYKFppvcdpEK..TGALNDLQRL-a............
Q77CC6_BHV1C/37-727              ....................a-RQRLLAILGQVQTYNFQLALLGRCDPAV..AR..RHLDAVKLNALMVRWLRRRLGGALRAQA.RVRLTPLTYALDLALDHAAAESDALLAAAGT--......-...ASA.........PAEFFARTM...GLE..GACRFHRRARLALYG.GETIDIEIQFLHDVENFLKQLNFAHLLASTDAALAALGDVDAFLRATVAGGGVAPPELHDFAQ.PCLVCFEELCVTANQGESVGRRLALCACDHVTRQL...RVRTELCSVGQYLPHVQGVSRARLA...AAAAALAA.....................LAAPTAAGAGGppvlatap.pggdgdggsVREAAASVLDAHHVFR.PAPRWLYAVSELQFWMSSSARGe...........aaASAVAAFAGNLEALAAREA.QHRLQVAAA.EMALFGRSPEHFDRALAD.KLAq........ldGVDCLLVGSAAVAPDERLEALIRACYDHHMSASLIRRLTRPDQRNEDALRELLRRAA......................................AGEAGA.A.AVGLGg...................................................pgR.--DEGGGDEPEEEGGTDNDGgagagvggggagps.................ggadggggaeddgpAGWAALAARARADADVRRQRYAERLSKRSMDSLGRCIRDQRRELEKTLRVSVYGDVLLNVYVAVHNGFCARRAFRAALASA-Gtv....vdNRASDATFDAHRFMKEALLRHAVDPATWPALTHQFFDLVNGPLFDGSAHNFAQPPNTALYFSVENVGLLPHLKEELAAFMLA............AAGG...-GWAVSDFQQFFCF......ASarARGVTAAQRLA.............
F0UXF3_9BETA/3-684               ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AECTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALTAYS......R...QPD.........RAAFYRTVL...RLD..-RCERHHTVELRFTD.SVRFSVTLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVAPQEAYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTARIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPDRIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHH.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALA...........GEERMFVGSVFAAPSRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKRILEEIRrplpdgtggdgp..............egeatrlrgretA-----.-.----Gsaa................................................sgtS.AASGRGTASTTHSTRSQRSRgrggggadggsengg...............gprvrgcdehealdaLDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKAQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQN--VL........DVGQHLTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHAKDDLVKCAEG............TVYP...SEWMVVKYMSFFNF......SD..CEDLNVLQKEM.............
G8H914_HHV1/11-682               ....................a-RQKLLALLGQVQTYVFQIELLRRCDPHI..GR..GKLPQLKLNALQVRALRRRLRPGLEAQA.GAFLTPLSVTLELLLEYAWREGERLLGSLETFA......T...AGD.........VAAFFTETM...GLA..RPCPYHQRVRLDTYG.GT-VHMELCFLHDVENFLKQLNYCHLITPSRGATAALERVREFMVGAVGSGLIVPPELSDPSH.PCAVCFEELCVTANQGATIARRLADRICNHVTQQA...QVRLDANELRRYLPHAAGLSDADRA...RALSVLDH.....................ALARTAGGDGQphpa.........pendsVRKEADALLEAHDVFQ.ATTPGLYAISELRFWLASGDRA.............gQTTMDAFASNLTALARREL.QQETAAVAV.ELALFGRRAEHFDRAFGS.HLAa........ldMVDALIIGGQATSPDDQIEALIRACYDHHLTTPLLRRLVSPEQCDEEALRRVLARMG......................................AGGAAD.A.PKGGAgpdddgdrva.................................veegarglgapG.-------------------Gggededrr.............................rgpggqgpETWGDIATQAAADVRERRRLYADRLTKRSLASLGRCVREQRGELEKMLRVSVHGEVLPATFAAVANGFAARARFCALT-AGAGtv....idNRSAPGVFDAHRFMRASLLRHQVDPALLPSITHRFFELVNGPLFDHSTHSFAQPPNTALYYSVENVGLLPHLKEELARFIMG............AGGS..gADWAVSEFQRFYCF......DG..ISGITPTQRAA.............
F8REW2_HHV1/11-682               ....................a-RQKLLALLGQVQTYVFQIELLRRCDPHI..GR..GKLPQLKLNALQVRALRRRLRPGLEAQA.GAFLTPLSVTLELLLEYAWREGERLLGSLETFA......T...AGD.........VAAFFTETM...GLA..LPCPYHQRVRLDTYG.GT-VHMELCFLHDVENFLKQLNYCHLITPSRGATAALERVREFMVGAVGSGLIVPPELSDPSH.PCAVCFEELCVTANQGATIARRLADRICNHVTQQA...QVRLDANELRRYLPHAAGLSDADRA...RALSVLDH.....................ALARTAGGDGQphps.........pendsVRKEADALLEAHDVFQ.ATTPGLYAISELRFWLASGDRA.............gQTTMDAFASNLTALARREL.QQETAAVAV.ELALFGRRAEHFDRAFGS.HLAa........ldMVDALIIGGQATSPDDQIEALIRACYDHHLTTPLLRRLVSPEQCDEEALRRVLARMG......................................AGGAAD.A.PKGGAgpdddgdrva.................................veegarglgapG.-------------------Gggededrr.............................rgpggqgpETWGDIATQAAADVRERRRLYADRLTKRSLASLGRCVREQRGELEKMLRVSVHGEVLPATFAAVANGFAARARFCALT-AGAGtv....idNRSAPGVFDAHRFMRASLLRHQVDPALLPSITHRFFELVNGPLFDHSTHSFAQPPNTALYYSVENVGLLPHLKEELARFIMG............AGGS..gADWAVSEFQRFYCF......DG..ISGITPTQRAA.............
G9CUD7_9ALPH/20-683              ....................a-TQKLFAIWGQIQSYLFQVELLKRCDPTV..GV..RMINRLKLNVLMIYYLEKKMVPALKEQR.EMNLTPLTYGLWLALRRAKLEGELLLDALCEFK......D...GGN.........LRDFFRKSM...SMC..GDCPYHSTVELDTYG.GK-VSTEIKFLHDVENVLKQLNYCHLILKADTVENFMVSLDNYLLKTLGSGSVVPPELYDPSQ.PCSVCFEELCVTANSGDSTHKRIVRKICDHITKQI...NIRVNSDDMVTHLPHATYVPDDKRT...TAQTALDV.....................IQSTMRDTTTEnds............nisVSKAAAAALDAHNVFL.PASGDLYAISELQFWIASSGRKlh.........qprGNTVESFADNLEALVSKER.LFDLRTSIV.ETAVFDRRMDHFERVFAQ.EIEh........mnAADRLLLGGRAAAPDDIIEALIKACYDHHMSAPLLKRLLYPDEAAHDALKTVLERVS......................................SHCIGN.D.IQCQD......................................................G.DGTCGERMNETGHFRTNDSFamst....................................tslghDEWLEMVKSASSDVARRRKMYAERLTKKSLASLDKCITEQRHELEKMLRVNVYGEVLIDSYTALFNGFRSRKRLLEAVKNCCAni....idNRNSDDAFDAHRFMQTSLLKHRIDPAMLPSLTHKFFQLVNGPMFSHDRHRFAQPSNTALYFSVENVGLLPHLKEEMARFMFH............SSRK...TDWTVSKFRGFYDF......ST..IDNVTAAHRMA.............
D3YP92_HHV1/11-682               ....................a-RQKLLALLGQVQTYVFQIELLRRCDPHI..GR..GKLPQLKLNALQVRALRRRLRPGLEAQA.GAFLTPLSVTLELLLEYAWREGERLLGSLETFA......T...AGD.........VAVFFTETM...GLA..RPCPYHQRVRLDTYG.GT-VHMELCFLHDVENFLKQLNYCHLITPSRGATAALERVREFMVGAVGSGLIVPPELSDPSH.PCAVCFEELCVTANQGATIARRLADRICNHVTQQA...QVRLDANELRRYLPHAAGLSDADRA...RALSVLDH.....................ALARTAGGDGQphps.........pendsVRKEADALLEAHDVFQ.ATTPGLYAISELRFWLASGDRA.............gQTTMDAFASNLTALARREL.QQETAAVAV.ELALFGRRAEHFDRAFGS.HLAa........ldMVDALIIGGQATSPDDQIEALIRACYDHHLTTPLLRRLVSPEQCDEEALRRVLARMG......................................AGGAAD.A.PKGGAgpdddgdrva.................................veegarglgapG.-------------------Gggededrr.............................rgpggqgpETWGDIATQAAADVRERRRLYADRLTKRSLASLGRCVREQRGELEKMLRVSVHGEVLPATFAAVANGFAARARFCALT-AGAGtv....idNRSAPGVFDAHRFMRASLLRHQVDPALLPSITHRFFELVNGPLFDHSTHSFAQPPNTALYYSVENVGLLPHLKEELARFIMG............AGGS..gADWAVSEFQRFYCF......DG..ISGITPTQRAA.............
Q2F7R5_HCMV/5-695                ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpegeaihlrgreamsgtgttlmtasnsS-----.-.----Nssthsqrn.....................................nggggrargG.GKKAVGGGANGQDGDGSENGlrvrncd...............................ehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGDQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
G3CEZ2_ILTV/5-673                ..................tql---RLMALAGQLQTLLFQIDILKRCDPEI..LLqkRLRSRIKHNALMALYIHSLLSNELSMQV.NYRLTLQTYCVWLWLRRACSEIAALCNEIDKYS......V...LKD.........RKCFFEATL...GYGkgFICPLHAEVQLQLYGmSSIISKELVLINDVENFMKQLNYCHCVVSCKNAIEALNTIDEFLVLSSGGSLVAAPDTYDHGQ.PCYVCLEELSVTANQGETIYRRLGYKICDHLTRQF...PVNVSTDDLKRHLPFLRDVDPEKLK...NVLSNETR.....................IEAENHVEAGRtls............sspGESEASKILNKYDVFT.EPPGPVYQLSELQYWLASGKRTpsgve...sqtttsQSVLKQLDKDLSELFKRAE.DFEQECIRL.ERTLFEKVHAHFHRVAQA.ELIsp......qhsLVDTLITGVLATSPDTEIAALIKACYDHHLSLPLFRRLRNPEKVDTDALEELVEKLR......................................GSDKET.Q.PVTEG......................................................T.STSDLTANLRGTIERDEDS-.............................................--IEVLLKKAERDLDVRQKNYVEKLSARSFSNLDRCIKIQRAELEKLMRVNIYGETLPVMYVTLKNAFLARRAFLDIVCAEESlhskilriDQNDGRAYDWHQYIRSSITRYQIDQTMLPRLTNRFFEILSGPLFKHHKERFPQPPNTSIYFSVENVGLLPHLKEELANFTKR............HRSC...-DWMTSEFRRFYNF......AG..ISNSTAIQRAA.............
Q9J2M5_9GAMA/1-599               .....................MARELAALYAQLSALAVDLSLVIFADPRS..--..IDGARILKTKTQIENLNRDLLPLLREQN.SVETSSLSLEVEHLAKNIEDKLGELERSLRQ--......-...RYS.........SREHFETLH...-LR..PECHYHSTVTFQFYG.GGLIDVNMCLINDVELLCKRLGSVFYCIGANEALSGLDRVLTFLSTLRGISPIPHPDLYVTSV.PCVQCLREIELVPNQGSSLLAVLADRHCDHLCKKVraePIHGLFETELSQLGLKVTKRSDA--...--------.....................TQHGVRSSADQ..................LRESSLAAIQDHNIFK.RVSASIMELSNLIYWNAGQTGL..............QTGTENECSQMARLLTHEA.DMHEHRALI.---TPKLSATHFYDCFRP.D--...........PIESLFCGGLFNSIDDTINALSRDCSVTFFQQANYTNVMRKQNELFTRLNSILRQGS......................................AGSQKP.A.TPSEP......................................................-.--------RTTTVAATA---.............................................------ASDVIKDAQYRKEQYMKKVARDGFKKLTECLQTQGAVLANALCMRVWGGVAYGEASELVNHFLLRRRFVALP-WEAR........CRSDQILFENSKYIKNSLYSQRLSREHVEIITLQFYGLITGPLTRQS-DLFPGPANVVLAQCFEAAGMLPHHKMLVSEMIWP............QIQP...KDWIDQTFNRFYQL......PE..-GDLNAVQKSA.............
Q2F7U0_HCMV/5-695                ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRVLMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpegeaihlrgreamsgtgttlmtasnsS-----.-.----Nssthsqrn.....................................nggggrargG.GKKAVGGGANGQDGDGSENGlrvrncd...............................ehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGDQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
D0PP99_MHV68/1-571               .....................MSKEIAVIYAQIYGLCVDLSLVPYMDPGS..--..FHLSAITNNYHKLCQIQKIIGDHLLSNN.SQTPCALTLELEHLLSNAIELCKNILS------......-...---.........HENTCTPLL...-CN..NQCLLDMSCMVCFYG.GDTVDVPLDTINKVDMLFKKLNVTFYCTSFNHTMPLLRKVFAQLGKFRGLSPIPSPGIYDISQ.PCIQCLQQVEYLPNQGLSKDTLLRKAICNHVFPMV...PP--EPIDFAQVGP-----SPST--...--------.....................--VQKPSEDA-..................VVMARPQAMVEYNVFS.VPTSDVLQLSNLLYWTSSDQL-..............TTSSNIDCSNLSNIYAREN.MLLTSSEKV.-----GQLCHRALKKHTP.S--...........PFELLFTGGLVTEHSKIVSALKDDCTASFLKKTNYADSLKHKNEMFASLQSLLTGSS......................................SSQKLS.Q.EKVSQ......................................................-.--------------QDRPE-.............................................-------KGFAHDAHKRKEAYLKKLADEGLKRLTNSLDANIANLEKLLGIRIWGQSVYEELAKLLNHFLIRNFLIQSA-SPP-........DWTLEETRERSQFIKSILYGHSINKEHVQSLGTVYYRLLNGPLIQER-GLFKLPINIILAQSLDAAEVLPHQKISMCFDVTN............IKSP...KDWIDVQFNQFYNF......LP..NTPLAGVQEQA.............
Q85426_RCMVM/3-732               ....................t-LQKLCVVCSKCNECAMDAECLKYCDPSI..VL..MDSTAFQRNGATVIHLYRTLYPALVAQN.TAQTSVLSLYLEMLLAGLYRTMRELDTALTDFA......R...HRD.........RERYYRRIL...NLD..-SCP--ESVTLVFAP.GLHLTIELATLNDIERLLCKINCVYGALDRTQGVEVCRRLLSLLGALCDTSPVAGPETYRETS.TCYQCYEELMAVPNQGRSINRRIEGLLCDHVTVK-...KVLVQLDTDAQTVEQDLGEVAIRAPrvkSIIRSLKN.....................LASSSAGSCA-..................YINDAEEALRGYNLFS.EIPERIYSLSDYTYWSKTS---..............EVIVRHVGVTMRQLNASHG.LWKALRGEL.SRFLYGEAVEDIFSLGEG.RFA...........GHERMFVGSISAAPGKVVDMITSMSVKSFENNPLFNRL-HESNEIYAKIRSLIEEIR......................................DADDPG.S.TAATGtsggtsggtsggtwggtsggisggtapapgtevpergrrssshgsstsrpgtsrR.AAGGAGRSRRGADTSAEGSGsgaagardadsrcggggvtrgdppeaaaassttapargmnfalecGDPLLRTHDVNKEVNVRKRAYLKKVSEVGYNKVMACIKSQEHLVTKLVNVNLVGTVCLEALSKVMNGFLSRQRATKEARALP-........DVGESLAYDEHLYVVNNLVHKRLPVELLPHLGQQVYRFINGPLFTRYLDRYPLPYNVNMAYACDNGGILPHVKEDLVRCADG............TAEP...GDWMVAGYQGFFSF......VD..VRDVNDLQKAV.............
Q2F7T0_HCMV/5-695                ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpegeaihlrgreamsgtgttlmtasnsS-----.-.----Nssthsqrn.....................................nggggrargG.GKKVVGGGANGQD------Gdgsenglrvr.........................ncdehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGDQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
Q2F7S6_HCMV/5-695                ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpegeaihlrgreamsgtgttlmtasnsS-----.-.----Nssthsqrn.....................................nggggrargG.-------------------Gkkvvgggvngqdgdgs............englrvrncdehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGDQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
B3UX12_MUHV1/5-660               ....................t-LQKLCVVCSKCNECAMDVECLKYCDPNI..VS..MDSTAFRRNGVMVIHLYRTLYPALVSQN.AVQTSVLTLYMEMLLQGLYDTMREIDMALTDFG......T...HRD.........RQRYYRRVL...KLD..-SCNRHESITITFAP.ELALTIDLATLNDVERLLCKINCVYGAVDASQGVAVCRRLLSLLARLCDICPVAGPEIYRETV.TCFQCYEELMAVPNQGRSINRRMQGLLCDHITIK-...KVLVQLDMDAQTVEQDMGDIAIRAPsvkGIIRAIKS.....................LASFSPASYA-..................YINDAEEALRGYNLFS.EIPDRIYSLSDYTYWSKTS---..............EAIVRHVGITMRQLNVSHS.LWKTLRTEL.SRYHYGEDLEDVFTLGEG.RFG...........GDERIYVGSIFAAPGKVVDMITSMSIKSFENNPLFNRL-HESNEIYAKIKSLIEEIRgvgdgp.........................aagaaasR-----.-.----Aeaasgagagg..................................eegpgaaagrG.--------N----------Tggdegagtt...........................tamssalecGDPLLRVHDVNKEVNVRKRAYLKKVSEMGYNKVMACIRNQEHLVTKLVNVNLVGTVCLEAVSKIMNGFLSRQRSITEAETYP-........DVAESLGYDEHLYVINNLVHKRLPSELLPQLGQQIYRFINGPMFTHYLDRHPLPYNVNMAYACDNAGILPHVKEDLVRCADG............TVVP...SDWMTVGYMGFFRF......AD..IRELNDLQKMV.............
D5LX68_HCMV/5-695                ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpegeaihlrgretmsgtgttlmtasnsS-----.-.----Nssthsqrn.....................................nggggrargG.GKKVVGGGANGQD------Gdgsenglrvr.........................ncdehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGDQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
Q9YUI3_9BETA/3-554               ....................l-LQKLCVVCSKCNEYAMELECLKYCDPSV..LL..AESSPFKKNALAIAYLYRRIYPELVRQN.RTQTSLLSLYMEMILKALYEDTELLDRALKAYS......R...RQD.........RAEYYRTVL...RLD..-RCDRHHTVELTFTD.NVKFSVTLATLNDIERFLCKMNYVYAILSPESGLEVCSQLLQLLRRLCGVSPVACQEAYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIVVH-...RPSSQCDVNIQTVEQDLTELTQRIPslsGVLTALKN.....................LFSSSSVYHS-..................YIQEAEEALREYNLFT.DIPARIYSLSDFTYWSRTS---..............EVIVKRVGISMQQLNIYHH.LCRVLMNVL.SRYLYGEDVEDIFVLGEK.LLS...........REQRLFVGSVFAAPSRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKCLLDEIR......................................RPVPDG.A.AAAEGvg.................................................aaiH.GQDPQSTSSNGGAPD----Edne......................................fldyMDARTRIHNVTREVNIRKRAYLQKVSEVGYAKVIRCIKSQERLTSKLIDVNLIGTVCLDFISRLMNGFIYRTRYRDNPDV--V........DVSQVLSYDEHLYVVNNIIHKSLP----------------------------------------------------------............----...--------------......--..-----------v............
Q69068_9BETA/3-612               ....................s-LQSLCVLCARLNECALDLECLKFCDPVI..VL..SDMANFKKNGIVILHLYQTFFEGIKEQN.LLCASALTVYMQVLLKAMYEQVLLLDAALESFM......V...DQD.........RKKYFEKVL...CLR..-RCAEHLSINISLNN.GVEFIVQLSTLNDIEQLISKINSVYALLLPQEGLQICGKIIDLLTIMCGACMVAKPESYLETK.TCMKCYEELTLTPNQGKSLRRRLHGKFCNHLTEQ-...KAFFNIEKNIETIEKDLGEAILNYGtvqSVATEIKK.....................IFKQQRSAESL..................HVSDAEKTLKKYNIFS.KVPDVIYSLSEFTYWSKIS---..............ETIVRNVAITLQQLNSCHT.LYKQLQNDV.SLYLYGEVSEDFLALSEN.LLT...........HDERLYVGSIYVSPSRLIDLVTGLSIKNLEESPIFKRL-AEEDEVQHKIKSLLHDIR......................................DPQTTE.T.PGRLN......................................................-.-------------------T.............................................INCMLQTHNLQQEVLARKKAYFQKVSESGYNRVMACIREQESLINKVVSVNVYGNFIFEALSKIMNGFVLRKMYLDGS-----........FRVDSCTYDEHLYIKNNLMPKKLPLELLPDLSEIMYTLLTGPLSDFHKSAYPLPANISMAYGCDHAEMLPHMKEDLARCIEG............TIHP...SVWMVCEYNEFFNF......SG..VTDVNDMQKKM.............
G8XTW2_SCMVC/3-644               ....................l-LQKLCVVCSKCNEYAMELECLKYCDPSV..LL..AESSPFKRNALAIAYLYRRIYPEVVRQN.RTQTSLLSLYLEMILKALYEDTELLDRALKAYS......R...RPD.........RMEYYRTIL...RLD..-RCDRHHTVELTFTE.HVKFSVNLATLNDIERFLCKMNYVYAILSPETGLEVCSQLLQLLRRLCGVSPVACQEAYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIVVH-...RPSSQCDVNIQTVEQDLLELTQRIPslpGVLTALKN.....................LFSSSSVYHS-..................YIQEAEEALKEYNLFT.AIPARIYSLSDFTYWSRTS---..............EVIVKRVGISIQQLNVYHH.LCRVLMNAL.SRHLYGEDVEDIFVVGEK.ALS...........REERLFVGSVFAAPSRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKCLLDEIR......................................RPAADG.G.AAAAEagg...............................................gsaiR.-------GQDPQSTSS---Sngnqde................................dndfldyMDARTRIHNVTREVNIRKRAYLQKVSEVGYAKVISCIKSQERLTSKLIDVNLIGTVCLDFISKLMNGFIYRTQYQENPDIV--........DVAQVLSYDEHLYVVNNIIHKSLPVESLPLLGQQIYQLCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHIKDDLVKCAEG............TVYP...SEWMVVKYQGFFDF......SN..CGDLNMLQKEM.............
Q6QCM5_HHV3/5-661                ....................i-NRTLLVLLGQVYTYIFQVELLRRCDPRV..AC..RFLYRLAANCLTVRYLLKLFLRGFNTQL.KFGNTPTVCALHWALCYVKGEGERLFELLQHFK......T...RFVygetkdsncIKDYFVSAF...NLK..-TCQYHHELSLTTYG.GY-VSSEIQFLHDIENFLKQLNYCYIITSSREALNTLETVTRFMTDTIGSGLIPPVELFDPAH.PCAICFEELCITANQGETLHRRLLGCICDHVTKQV...RVNVDVDDIIRCLPYIPDVPDIKRQ...SAVEALRT.....................LQTKTVVNPMGaknd..........tfdqTYEIASTMLDSYNVFK.PAPRCMYAISELKFWLTSNSTEg............pQRTLDVFVDNLDVLNEHEK.HAELTAVTV.ELALFGKTPIHFDRAFSE.ELGs........ldAIDSILVGNRSSSPDSQIEALIKACYAHHLSSPLMRHISNPSHDNEAALRQLLERVG......................................CEDDLT.K.EASDS......................................................-.--ATASECDLNDDSSITFAV.............................................HGWENLLSKAKIDAAERKRVYLEHLSKRSLTSLGRCIREQRQELEKTLRVNVYGEALLQTFVSMQNGFGARNVFLAKV-SQAGci....idNRIQEAAFDAHRFIRNTLVRHTVDAAMLPALTHKFFELVNGPLFNHDEHRFAQPPNTALFFTVENVGLFPHLKEELAKFMGG............VVGS...-NWLLSPFRGFYCF......SG..VEGVTFAQRLA.............
Q5Y919_9ALPH/1-195               ...................rg-----------------------------..--..----------------------------.---------------------------------......-...---.........---------...---..---------------.---------------------------------------------------------------.-----------------------------------...-------------------------...--------.....................-----------..................----------------.----------------------..............-------------------.---------.------------------.---...........---------------------------------------------------------......................................------.-.-----......................................................-.--------------------.............................................------------ETEERKRAYAARLSRRSFLNLSKCVEKQRAFLDKMLSVNVWGQFLLEAAVRTRNGFSRRARFLERVTGFGGev....rdKRHCRTDYDARQFVRNALLRHEVDPALLSELVNRFYELINGPYFTHAYHVFAQPHNTPLYFSVENVGLLPHIKNELASFMLI............RNHR...-EWMVSEYKEFYKFppvcdpEK..TGALNDLQRL-a............
Q2F7S2_HCMV/5-695                ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpegevihlrgreamsgtgttlmtasnsS-----.-.----Nssthsqrn.....................................nggggrargG.GKKAVGGGANGQDGDGSENGlrvrncd...............................ehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGNQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNRGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
G8H880_HHV1/11-682               ....................a-RQKLLALLGQVQTYVFQIELLRRCDPHI..GR..GKLPQLKLNALQVRALRRRLRPGLEAQA.GAFLTPLSVTLELLLEYAWREGERLLGSLETFA......T...AGD.........VAAFFTETM...GLA..RPCPYHQRVRLDTYG.GT-VHMELCFLHDVENFLKQLNYCHLITPSRGATAALERVREFMVGAVGSGLIVPPELSDPSH.PCAVCFEELCVTANQGATIARRLADRICNHVTQQA...QVRLDANELRRYLPHAAGLSDADRA...RALSVLDH.....................ALARTAGGDGQphps.........pendsVRKEADALLEAHDVFQ.ATTPGLYAISELRFWLASGDRA.............gQTTMDAFASNLTALARREL.QQETAAVAV.ELALFGRRAEHFDRAFGS.HLAa........ldMVDALIIGGQATSPDDQIEALIRACYDHHLTTPLLRRLVSPEQCDEEALRRVLARMXxxxxx............................xxxxgG-----.-.----Agpdddgdrv....................................aveegarglG.--------APG--------Gggededrr.............................xxxxxxxxXXXXXXXXXXXXXXXERRRLYADRLTKRSLASLGRCVREQRGELEKMLRVSVHGEVLPATFAAVANGFXARARFCALT-AGAGtv....idNRSAPGVFDAHRFMRASLLRHQVDPALLPSITHRFFELVNGPLFDHSTHSFAQPPNTALYYSVENVGLLPHLKEELARFIMG............AGGS..gADWAVSEFQRFYCF......DG..ISGITPTQRAA.............
D3XDP3_MUHV1/5-660               ....................t-LQKLCVVCSKCNECAMDVECLKYCDPNI..VS..MDSTAFRRNGVMVIHLYRTLYPALVSQN.AVQTSVLTLYMEMLLQGLYDTMREIDMALTDFG......T...HRD.........RQRYYRRVL...KLD..-SCNRHESITITFAP.ELALTIDLATLNDVERLLCKINCVYGAVDASQGVAVCRRLLSLLARLCDICPVAGPEIYRETV.TCFQCYEELMAVPNQGRSINRRMQGLLCDHITIK-...KVLVQLDMDAQTVEQDMGDIAIRAPsvkGIIRAIKS.....................LASFSPASYA-..................YINDAEEALRGYNLFS.EIPDRIYSLSDYTYWSKTS---..............EAIVRHVGITMRQLNVSHS.LWKTLRTEL.SRYHYGEDLEDVFTLGEG.RFG...........GDERIYVGSIFAAPGKVVDMITSMSIKSFENNPLFNRL-HESNEIYAKIKSLIEEIRgvgdgpa.......................agaaasraE-----.-.----Aasgaga.........................................ggeegagA.---AAGRGN----------Tggdegagtt...........................tamssalecGDPLLRVHDVNKEVNVRKRAYLKKVSEMGYNKVMACIRNQEHLVTKLVNVNLVGTVCLEAVSKIMNGFLSRQRSITEAETYP-........DVAESLGYDEHLYVINNLVHKRLPSELLPQLGQQIYRFINGPMFTHYLDRHPLPYNVNMAYACDNAGILPHVKEDLVRCADG............TVVP...SDWMTVGYMGFFRF......AD..IRELNDLQKMV.............
G8XSX1_9BETA/3-638               ....................l-LQKLCVVCSKCNEYAMELECLKYCDPSI..LL..AESSPFKRNALAITRLYRRIYPELVKQN.HVQTSLLTLYMEVSLKALYEDTEMLDQALMKYS......Q...KPD.........RMEYYRTIL...RLD..-RCERHHVVELKFTD.DVKFSVPLGTLNEVERFLCKMNCVYAVMSPDHGLEICCQLLRLLRSLCGISPVACPEVYADGI.TCAQCYEELTVVPNQGRSLNKRLQGLLCNHIAVH-...RPCTQSGTNMQTVEQDLSEYVHRIPklgGLVSTIKA.....................LFSSSSVSHS-..................YIHEAEETLKEYNLFT.DIPERIYSLSDFTYWSRTS---..............EILVKRVDTTINQLNVYHS.LCRLLMNEI.SRYMYGEEVEDIFVLGEK.ILS...........GEERLFVGSVFAAPNRIIDLITSMSIQAFEENPAFNRL-HENNEMYSKIKSLLEEIR......................................RPSEDE.A.VERPV......................................................R.SGSEVETVGATGAAEAA--Cnqa.......................................lecGDPRVNMHNITREVNLRKRAYLQKVSEVGYNKVMRCIKNQEKLTNKLIDVNLVGTTCLDLISKMMNGFIDRNKFKDDAT--VI........DVCEDLSYDEHLYVVNNLIHKKLPVESLPTLGQQIYRLCNGPLFTHCQDRYPMSHNVDMAYACDNAGVLPHVKDDLVKYAEG............TVHP...HEWMVVKYLCFFNF......TK..CDDLNALQKEM.............
E2IUE1_SHV1/48-745               ....................a-LQKLLALVGQVQTYTFQIELLKRCDPRV..GV..RKIPPLKHNALQVRVLTRRLRPGLVAQA.DALVTPASLILDLSLAYARREGERLLAELEAFA......A...VAAsgda.aedeIRKFFARTM...SLS..GPCAHHHRVHLETYG.GG-VDMELCFLHDAENLLKQINYCHLITPPAEAAVALERVWEFLSETVGAGFVVPPEISDPSH.PCSVCFEELCATANQGASLAHRLADRSCDHITQQA...RVRLDDGEIARYLPHAAGVSAAARR...RAAAVLER.....................ASAAPDGSSRRdrgd.........acaaaTLAASDALLEEHHVFR.AASRGLYAVSELRFWLASGDRS.............cASTIDAFVDNLTALAEREA.RQEVSMAAV.EMALFGRSCDHFDRAFGR.ELAt........ldTVDALMVGGQASSPDDQIQALIRACYDHHMSAPLIRRLVDPRQGDEEALRRVLMQLG......................................RRPQRP.RtGGERG......................................................G.DASGEGASRAEDAGAEESPRddeasglpgesd.....................rrrpdaiaetggAAWAEVAARASEDARERRRLYADRLTKRSLASLGRCVREQRGELEKMLRVSVYGELLPVTYAAVYNGFVARRRFRDGVAAA-Gtv....vdNRSAAETFDAHRFMRASLLRHQVDPAMLPSLTHKFFELVNGPMFDHHSHSLAQPPNTALYYSVENVGLLPHLKEELAHFMMApgggsrgakgvsKGGA...ADWAVSEFQRFYCF......CE..SSGITPTQRAA.............
F0UXF5_9BETA/1-53                .....................-----------------------------..--..----------------------------.---------------------------------......-...---.........---------...---..---------------.---------------------------------------------------------------.-----------------------------------...-------------------------...--------.....................-----------..................----------------.----------------------..............-------------------.---------.------------------.---...........---------------------------------------------------------......................................------.-.-----......................................................-.--------------------.............................................-----------------------------------------------------------------------------------........------------------------------------------------------------YACDNAGVLPHAKDDLVKCAEG............TVYP...SEWMVVKYMSFFNF......SD..CEDLNVLQKEM.............
E9M5J4_9GAMA/1-219               .....................MSKNLAAIYAQVYGFCLDLSLVEFMESHS..--..VKIQALKNNLRRIETLLEKILPALKQQN.STCPTSLTLELEHLLINSFYWCKNYLNGGAA--......-...---.........------KVG...S-S..-RPKGGAKLQFCLYG.SDIIMTCISTINDIDTLLKKLNTVFYCMSQASAINLLTELQTMLQDFRGISPIPYPDTYTLHS.SCLECVHDAHVFPNQGSSFATMLQQNICYHLFPHL...P------------------------...--------.....................-----------..................----------------.----------------------..............-------------------.---------.------------------.---...........---------------------------------------------------------......................................------.-.-----......................................................-.--------------------.............................................-----------------------------------------------------------------------------------........----------------------------------------------------------------------------------............----...--------------......--..-----------yepcpagveseps
Q993K8_9GAMA/1-597               .....................MTGMLAAVYSQIYAVSFELGLCRHLDQSS..--..LDTGAVTRNIARLRKLRTILGKQLDKQN.EVMCTALSLELSHLLENSLIEAENLEK------......-...---.........-RNDLQETP...---..--ILPSASFTAKFYG.QYSQDVSMYLINDIEIFIKRLNSVFYCLSYNMGLEALNKAEKLLGKFRGVSPVPDPRLYLIDV.PCWLCLHEQAVLPNQGKPKISGSGRLSCNHLAVPVipePVIGLFENEVRQASLTHLLKKQD--...----NTRR.....................IHHSREKRN--..................-TTEAYQSLDEYCVFS.SVPPEISELSELLYWNSSRNSIs............lTGGEEETWSRLSKLISRDE.EMLEVMRKC.ELALAGASYNHTFVSRMP.G--...........ILERLFCGGIFSSVGDMSEALKLDCASAFTSQPQYRIIADQRNELYTRLNHAMSRLR......................................RTENEQ.R.ENTEP......................................................-.--HAPYVNQIQGNKDSS---.............................................--------VIWSDAAKRREQYLRQLAAEGLTKLQACLARQGELMSETLALRVWGDTVYEEMAAMYNHFIARRAFVHRA-WEDK........RDGTAEIFENSKYIKTHLFNQTLSSEHVNALTMTVYSLLTGPLLGDA-GMFPPPENVALSYSCEAAGILPHQKLFMASLVWP............GIQP...AEWIETSFNSFYQP......PD..-GTLAETQQI-l............
Q5Y968_9ALPH/2-655               ....................d-SRETVALVSRLNAFLFQLELLKRCDPEAvvVS..PLRRSLKLNCLMVAYLRDRLEVHVKEQN.RTEADYALYSLGLALTSACREAGRCWQLLEEFE......R...NRD.........KRAFFRGAM...GLD..VPCPYHVETELRAYG.DVRVTKQLSTVNDAENLLKQVNYIHAVVPEAAAAELFARIDDFFSETLANGPVAAFEAYDESA.PCAVCFEELCVTANQGQSVYKRLADRVCDHLATRY...QVHVDEDDLLKNLPYAGGHAPQRLN...ALCEDLRH.....................ARHEAQDERQKaengc.......gatesaVMDETERLLNSFDVFC.NVPPAVYKMSELKFWLLAGSGD..............ETAIDLYGRRLADLEEKDA.LLARQEALT.SLRLFGVRLTHFHDLFPP.A-D...........PMEKVAVGSPRLPPETRMVALINAFYARAADVPLFRRLRETGERNTEALRKVLVQIQ......................................SGETAE.G.ESDDG......................................................-.-----RETAVGESFRSQNES............................................lRDLEELERRVRGETEERKRAYAARLSRRSFLNLSKCVEKQRAFLDKMLSVNVWGQFLLEAAVRTRNGFSRRARFLERVTGFGGev....rdKRHCRTDYDARQFVRNALLRHEVDPALLSELVNRFYELINGPYFTHAYHVFAQPHNTPLYFSVENVGLLPHIKNELASFMLI............RNHR...-EWMVSEYKEFYKFppvcdpEK..TGALNDLQRL-a............
Q99D21_BHV4/1-605                .....................MARELAAVYSQVFDLSFKTSLLTFCDPRH..--..IDLGAFQRNKKRLKLLIDALYSHLVEQN.RTECSCLSLELEHLIINTYITMQKLETCLNE--......-...NIY.........EKDYFAMLH...-LS..DLCCFHKTVNLCFYG.DCVIPISLSIINDIEIFFSRLNSVFYCISRNNALEGLEETINFLGTLRNISPIPLPDLYLPSI.SCMNCLNETSILPNQGENVFTIMNSINCTHVATPVapePVQGLFENELMHLNIPVDGTDNK--...--------.....................VQLETSDTR--..................IQNASIEAIDQHNIFE.KVSQHILEISNLIYWNSGHSN-..............DQSPKLSCSQMATLIQHET.RMASHRQKVaSHLALTTPPIHFFDSYRA.Y--...........PIESLFCGGIFYSIMDNIQALKQDCSTTFLAKSNYKTIMERKNELYVRLNNLLAPSH......................................TKEGDI.D.KPNTS......................................................-.----IKQARTHTIGETTSE-.............................................--------QIFSDAAARKNNYLQKVTTEGLKKITDCLETQGKIMCNTLTLRTWGMVTYKEAAILKNHFMIRKRFIALPQWHHN........YTAINELYESSKFIKNSLYVQKLSQEHIDSITLQFYSLITGPLVEGP-DFFPSPPNILLANCLDAAKVMPHHKMLISEVIWP............SMEP...KDWIDAEFNAFYNI......TG..-KTLNSVQQC-a............
Q0Q8Z2_HHV3/5-148                ....................i-NRTLLVLLGQVYTYIFQVELLRRCDPRV..AC..RFLYRLAANCLTVRYLLKLFLRGFNTQL.KFGNTPTVCALHWALCYVKGEGERLFELLQHFK......T...RFVygetkdsncIKDYFVSAF...NLK..-TCQYHHELSLTTYG.GY-VSSEIQF-----------------------------------------------------.-----------------------------------...-------------------------...--------.....................-----------..................----------------.----------------------..............-------------------.---------.------------------.---...........---------------------------------------------------------......................................------.-.-----......................................................-.--------------------.............................................-----------------------------------------------------------------------------------........----------------------------------------------------------------------------------............----...--------------......--..-----------yttl.........
H8ZQZ3_ILTV/5-673                ..................tql---RLMALAGQLQTLLFQIDILKRCDPEI..LLqkRLRSRIKHNALMALYIHSLLSNELSMQV.NYRLTLQTYCVWLWLRRACSEIAALCNEIDKYS......V...LKD.........RKCFFEATL...GYGkgFICPLHAEVQLQLYGmSSIISKELVLINDVENFMKQLNYCHCVVSCKNAIEALNTIDEFLVLSSGGSLVAAPDTYDHGQ.PCYVCLEELSVTANQGETIYRRLGYKICDHLTRQF...PVNVSTDDLKRHLPFLRDVDPEKLK...NVLSNETR.....................IEAENHVEAGRtls............sspGESEASKILNKYDVFT.EPPGPVYQLSELQYWLASGKRTpsgve...sqtttsQSVLKQLDKDLSELFKRAE.DFEQECIRL.ERTLFEKVHAHFHRVAQA.ELIsp......qhsLVDTLITGVLATSPDTEIAALIKACYDHHLSLPLFRRLRNPEKVDTDALEELVEKLR......................................GSDKET.Q.PVTEG......................................................T.STSDLTANLRGTIERDEDS-.............................................--IEVLLKKAERDLDVRQKNYVEKLSARSFSNLDRCIKTQRAELEKLMRVNIYGETLPVMYVTLKNAFLARRAFLDIVCAEESlhskilriDQNDGRAYDWHQYIRSSITRYQIDQTMLPRLTNRFFEILSGPLFKHHKERFPQPPNTSIYFSVENVGLLPHLKEELANFTKR............HRSC...-DWMTSEFRRFYNF......AG..ISNSTAIQRAA.............
Q2F7R1_HCMV/5-695                ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpegevihlrgreamsgtgttlmtasnsS-----.-.----Nssthsqrn.....................................nggggrargG.GKKAVGGGANGQDGDGSENGlrvrncd...............................ehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGNQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
Q2FAM6_9BETA/3-642               ....................l-LQKLCVVCSKCNEYAMELECLKYCDPSV..LL..AESSPFKKNALAIAYLYRRIYPELVRQN.RTQTSLLSLYMEMILKALYEDTELLDRALKAYS......R...RQD.........RAEYYRTVL...RLD..-RCDRHHTVELTFTD.NVKFSVTLATLNDIERFLCKMNYVYAILSPESGLEVCSQLLQLLRRLCGVSPVACQEAYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIVVH-...RPSSQCDVNIQTVEQDLTELTQRIPslsGVLTALKN.....................LFSSSSVYHS-..................YIQEAEEALREYNLFT.DIPARIYSLSDFTYWSRTS---..............EVIVKRVGISMQQLNVYHH.LCRVLMNVL.SRYLYGEDVEDIFVLGEK.LLS...........REQRLFVGSVFAAPSRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKCLLDEIR......................................RPVPDG.A.AAAEGvg.................................................aaiR.GQDPQSTSSNGGAPD----Edne......................................fldyMDARTRIHNVTREVNIRKRAYLQKVSEVGYAKVIRCIKSQERLTSKLIDVNLIGTVCLDFISRLMNGFIYRTRYRDNPDV--V........DVSQVLSYDEHLYVVNNIIHKSLPVESLPLLGQQIYQLCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHIKDDLVKCAEG............TVYP...SEWMVVKYQGFFDF......SS..CGDLNMLQKEM.............
B7TPX2_9BETA/3-625               ....................s-LQKLGVVCSKCNECALELQCLKYCDPVA..IL..ADGGPFKRNARIVAKLHATLYPSLREQN.EQATTVLTLYLEMLIRCMHEDFTRMDAALRRFI......D...DGD.........RVAYYRRVL...RLD..-VCDRHYRKIVSLND.HVSFDVKVDTLNDVERVICKLNCVYGLMCPSEGFALCRDLHDYLSRSHGVSPVVATETYHEAA.TCYKCYEELTVVPNQGRSIGKRLSGLLCDHVAVC-...KPLVQLETDMQTIEQDVIETVGRHDrliGIISAIKN.....................IATVTEGQHA-..................YIGEAERALKEYNIFS.EIPQQIYSLSDFTYWSKTS---..............ETIVKHVNVTIKQVNMYHH.LCTLLQNEL.SKIFYGEPIVDMFTCMNV.DLT...........EDERLFVGSVYAAPGKIIDLITSMSIKMFEDNPIFNRL-HENNEVYMKIKYLIEEIR......................................RPADSK.E.SEILD......................................................-.---DTA--VSGQAGD-PLYG.............................................GNPYAKQHDIDKEVVVRKRAYLRKVSEAGYEKVMRCIKKQENCISKLVNVNVMGTVVLEALSKLMNGFIRRIEVDESV----M........HVSDMVSYDDHLYVKNNLLHRTLPLESLPALGQEIYRFLNGPVFTHHRDFYGLPFNVNMAYACDNAGMLPHMKDDLVRCVEG............TPNP...NEWMISEYRKFFDF......SD..VTDLNTLQNR-m............
A2TIW1_9ALPH/16-694              ....................a-RQRLLATFGQLQTYIFQIELLKRCDPDV..ILggETLRNLKLNAMMVRYLEKHINTGFVKQA.EIYLTPMTYALHLSLRYAKKEGESVLAAIESYR......L...HGN.........IRKFFSDTM...GLA..GDCPYHRGVSLRTYG.GE-VRTEIKFLHDVENILKQLNFCHLITPVDEAESFFDALDGFLSLTIGSGFVVPPQLFDPSH.PCSVCFEELCVTANQGEAIHRRMANKICDHITKQI...RVRIDREEILRHLPYIAGLDPERKR...AALAALEA.....................IGQRMRNTDSSyn..............qtTIDTADAILEAHNVFL.PASKRLYAISELRYWLASGSIGntdn.....qtsmmSGTISAFAANLDLLAEREC.RLDLETAAV.ELALFNRTMMHFDKAYAD.NMAe........ldVIDCLLLGSRSASPDDQIEALIRACYDHHMSAPLLRRLADPDKANEDALRKVLERAS......................................KMNSQN.N.GSNRGgdnlqtkntlgi..............................itessdssdtdeD.EQRKSITQRYDLNTNIR---.............................................NTWEDLIRRVDEDTRERRKLYSEKLTKRSLASLDRCVREQRRELEKTLRINVFGETLLSTFVAAYNGFRSRAGVLTKVINAAGtv....idNRNWDGAFDAHRFMRTSLLRQSIDPAMLPSLTHKFFELVNGPLFCHDRHIFAQPPNTPLYFSVENVGLLPHLREELARFMVT............PRGA...-DWTTSTFQGFYDF......SG..IEGVTAAQRLA.............
O56281_9BETA/3-611               ....................s-LQSLCVLCSRLSECALELECLRFCDPVT..LI..PDMTNFRKNGVVIIHLFKTLFAELCHQN.FNCASPVTIYLQILLKAMYNQVLLLDASIHQFL......L...DND.........KQKYFENIF...QLN..-ECKQHLKLDLALNN.YLTFSVDISTINDIEKLLCKMNCIFGLISPLDGINACSQIIEFLTILCGVCVVMKPEVFSETT.TCLKCYEELSLVPNQGKSIRKRLAGKFCNHLTET-...HMVSNLEKNVDIIEKDLDFSTKQYGlvkEYMAKITN.....................IFQQQLYSKPP..................HLQEAENTLINFDLFS.KIPDTIYSLSEFTYWSKIS---..............ESVIQKASITLNQLNLCHS.LYADLQNEI.SKFLYGETIQDVFNFNEE.NVT...........NDDKLYIGSRFISPCRLVDIITNVSIKNLEEDPVFTKL-AEEDEIQTKIKTLLNELE......................................NSAHET.V.PKKYV......................................................-.---------T----------.............................................-HSMTQDHNLQQEIHIRKKAYYQKISESGYSKVMLCIKEQEALINKLMNINILGNHIFESLSKMMNAFANRQLQSLGN-----........FSADPFTYDDHLYIKNNLLSKKLPQELLPNLSQEMYRLLTGPLSNYHTASFPLSSNISMAYACDVADFLPHMKEDLAKCVEG............TIYP...ENWMLCTYNKFFNF......DG..LHNINDMQRQM.............
A8DNQ7_9ALPH/16-694              ....................a-RQRLLATFGQLQTYIFQIELLKRCDPDV..ILggETLRNLKLNAMMVRYLEKHINTGFVKQA.EIYLTPMTYALHLSLRYAKKEGESVLAAIESYR......L...HGN.........IRKFFSDTM...GLA..GDCPYHRGVSLRTYG.GE-VRTEIKFLHDVENILKQLNFCHLITPVDEAESFFDALDGFLSLTIGSGFVVPPQLFDPSH.PCSVCFEELCVTANQGEAIHRRMANKICDHITKQI...RVRIDREEILRHLPYIAGLDPERKR...AALAALEA.....................IGQRMRNTDSSyn..............qtTIDTADAILEAHNVFL.PASKRLYAISELRYWLASGSIGntdn.....qtsvmSGTISAFAANLDLLAEREC.RLDLETAAV.ELALFNRTMMHFDKAYAD.NMAe........ldVIDCLLLGSRSASPDDQIEALIRACYDHHMSAPLLRRLADPDKANEDALRKVLERAS......................................KMNSQN.N.GSNRGgdnlqtkntlgi..............................itessdssdtdeD.EQRKSITQRYDLNTNIR---.............................................NTWEDLIRRVDEDTRERRKLYSEKLTKRSLASLDRCVREQRRELEKTLRINVFGETLLSTFVAAYNGFRSRAGVLTKVINAAGtv....idNRNWDGAFDAHRFMRTSLLRQSIDPAMLPSLTHKFFELVNGPLFCHDRHIFAQPPNTPLYFSVENVGLLPHLREELARFMVT............PRGA...-DWTTSTFQGFYDF......SG..IEGVTAAQRLA.............
Q2F7T3_HCMV/5-695                ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpegea.....ihlrgreamsgtgttltT-----.-.----Asnssnssihnq................................rnnggggrargG.GKKAVGGGVNGQDGDGSENGlrvrncd...............................ehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGDQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
TRM1_VZVD/5-661                  ....................i-NRTLLVLLGQVYTYIFQVELLRRCDPRV..AC..RFLYRLAANCLTVRYLLKLFLRGFNTQL.KFGNTPTVCALHWALCYVKGEGERLFELLQHFK......T...RFVygetkdsncIKDYFVSAF...NLK..-TCQYHHELSLTTYG.GY-VSSEIQFLHDIENFLKQLNYCYIITSSREALNTLETVTRFMTDTIGSGLIPPVELFDPAH.PCAICFEELCITANQGETLHRRLLGCICDHVTKQV...RVNVDVDDIIRCLPYIPDVPDIKRQ...SAVEALRT.....................LQTKTVVNPMGaknd..........tfdqTYEIASTMLDSYNVFK.PAPRCMYAISELKFWLTSNSTEg............pQRTLDVFVDNLDVLNEHEK.HAELTAVTV.ELALFGKTPIHFDRAFSE.ELGs........ldAIDSILVGNRSSSPDSQIEALIKACYAHHLSSPLMRHISNPSHDNEAALRQLLERVG......................................CEDDLT.K.EASDS......................................................-.--ATASECDLNDDSSITFAV.............................................HGWENLLSKAKIDAAERKRVYLEHLSKRSLTSLGRCIREQRQELEKTLRVNVYGEALLQTFVSMQNGFGARNVFLAKV-SQAGci....idNRIQEAAFDAHRFIRNTLVRHTVDAAMLPALTHKFFELVNGPLFNHDEHRFAQPPNTALFFTVENVGLFPHLKEELAKFMGG............VVGS...-NWLLSPFRGFYCF......SG..VEGVTFAQRLA.............
Q2F7R9_HCMV/5-695                ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLGLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HKSNEMYTKIKHILEEIRrplpdgtggdgpegeaihlrgreamsgtgttlmtasnsS-----.-.----Nssthsqrn.....................................nggggrargG.GKKAVGGGANGQDGDGSENGlrvrncd...............................ehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGDQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNSGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
F8RE06_HHV1/11-682               ....................a-RQKLLALLGQVQTYVFQIELLRRCDPHI..GR..GKLPQLKLNALQVRALRRRLRPGLEAQA.GAFLTPLSVTLELLLEYAWREGERLLGSLETFA......T...AGD.........VAAFFTETM...GLA..RPCPYHQRVRLETYG.GT-VHMELCFLHDVENFLKQLNFCHLITPSRGATAALERVREFMVGAVGSGLIVPPELSDPSH.PCAVCFEELCVTANQGATIARRLADRICNHVTQQA...QVRLDANELRRYLPHAAGLSDADRA...RALSVLDH.....................ALARTAGGDGQphpa.........pendsVRKEADALLEAHDVFQ.ATTPGLYAISELRFWLASGDRA.............gQTTMDAFASNLTALARREL.QQETAAVAV.ELALFGRRAEHFDRAFGS.HLAa........ldMVDALIIGGQATSPDDQIEALIRACYDHHLTTPLLRRLVSPEQCDEEALRRVLARMG......................................AGGAAD.A.PKGGAgpdddgdrga.................................veegtrglgapG.-------------------Gggededrr.............................rgpggqgpETWGDIATQAAADVRERRRLYADRLTKRSLASLGRCVREQRGELEKMLRVSVHGEVLPATFAAVANGFAARARFCALT-AGAGtv....idNRSAPGVFDAHRFMRASLLRHQVDPALLPSITHRFFELVNGPLFDHSTHSFAQPPNTALYYSVENVGLLPHLKEELARFIMG............AGGS..gADWAVSEFQRFYCF......DG..ISGITPTQRAA.............
A8E1D4_MUHVK/5-660               ....................t-LQKLCVVCSKCNECAMDVECLKYCDPNI..VS..MDSTAFRRNGVMVIHLYRTLYPALVSQN.AVQTSVLTLYMEMLLQGLYDTMREIDMALTDFG......T...HRD.........RQRYYRRVL...KLD..-SCNRHESITITFAP.ELALTIDLATLNDVERLLCKINCVYGAVDASQGVAVCRRLLSLLARLCDICPVAGPEIYRETV.TCFQCYEELMAVPNQGRSINRRMQGLLCDHITIK-...KVLVQLDMDAQTVEQDMGDIAIRAPsvkGIIRAIKS.....................LASFSPASYA-..................YINDAEEALRGYNLFS.EIPDRIYSLSDYTYWSKTS---..............EAIVRHVGITMRQLNVSHS.LWKTLRTEL.SRYHYGEDLEDVFTLGEG.RFG...........GDERIYVGSIFAAPGKVVDMITSMSIKSFENNPLFNRL-HESNEIYAKIKSLIEEIRgvgdgpa.......................agaaasraE-----.-.----Aasgaga.........................................ggeegagA.---AAGRGN----------Tggdegagtt...........................tamssalecGDPLLRVHDVNKEVNVRKRAYLKKVSEMGYNKVMACIRNQEHLVTKLVNVNLVGTVCLEAVSKIMNGFLSRQRSITEAETYP-........DVAESLGYDEHLYVINNLVHKRLPSELLPQLGQQIYRFINGPMFTHYLDRHPLPYNVNMAYACDNAGILPHVKEDLVRCADG............TVVP...SDWMTVGYMGFFRF......AD..IRELNDLQKMV.............
Q2HRD2_HHV8P/1-607               .....................MAKELAAVYADVSALAMDLCLLSYADPAT..--..LDTKSLALTTGKFQSLHGTLLPLLRRQN.AHECSGLSLELEHLLENVADALTTLGVCT---S......R...KLS.........PEEHFSLLH...-LD..ITCNKHRSVRFNFYG.NWALELKLSLINDVEIFFKRLSSVFYCIGSGSALEGLGEVLRFVGKLRGISPVPGPDLYVSNL.PCLECLQEVCLTPNQGTSLQAMLPDTACSHICTPAcgePVRGLFENELKQLGLQTPESIPTTP...--------.....................CQSRVRQDDE-..................IRQSSLMAVGDHHIFG.EVTRSVLEISNLIYWSSGHSDA..............TCDGDRDCSHLASLFTHEA.DMHKRRVDLaGCLGERGTPKHFFDCFRP.D--...........SLETLFCGGLFSSVEDTIESLQKDCSSAFYQQVNYTTALQKQNEFYVRLSKLLAAGQ......................................LNLGKC.S.TESCP......................................................-.-----SEARRQLVGGDKPE-.............................................--------EVLRDAKHRQELYLQKVARDGFKKLSDCIRHQGHILSQTLGLRLWGSVIYNEASALQNHFLHRAQFISLP-WQDL........TVDCPTRFENSKYIKNSLYCQRLGREHVEILTLEFYKLITGPLSKRH-TLFPSPPNVTLAQCFEAAGMLPHQKMMVSEMIWP............SIEP...KDWIEPNFNQFYSF......EN..-QDINHLQKRA.............
G9I250_HHV2/15-682               ....................a-RQKLLALLGQVQTYVFQLELLRRCDPQI..GL..GKLAQLKLNALQVRVLRRHLRPGLEAQA.AAFLTPLSVTLELLLEYAWREGERLLGHLETFA......T...TGD.........VSAFFTETM...GLA..RPCPYHQQIRLQTYG.GD-VRMELCFLHDVENFLKQLNYCHLITPPSGATAALERVREFMVAAVGSGLIVPPELSDPSH.PCAVCFEELCVTANQGATIARRLADRICNHVTQQA...QVRLDANELRRYLPHAAGLSDAARA...RALCVLDQ.....................ALARTAAGGGAragpp.......padsssVREEADALLEAHDVFQ.ATTPGLYAISELRFWLASGDRA.............rHSTMDAFADNLNALAQREL.QQETAAVAV.ELALFGRRAEHFDRAFGG.HLAa........ldMVDALIIGGQATSPDDQIEALIRACYDHHLTTPLLRRLVSPEQCDEEALRRVLARLG......................................AGGATGgA.EEEEP......................................................R.AAAEEGGRRRGAGTPASEDGergpe..................................pgaqgpESWGDIATRAAADVRERRRLYADRLTKRSLASLGRCVREQRGELEKMLRVSVHGEVLPATFAAVANGFAARARFCALT-AGAGtv....idNRAAPGVFDAHRFMRASLLRHQVDPALLPSITHRFFELVNGPLFDHSTHSFAQPPNTALYYSVENVGLLPHLKEELARFIMG............AGGS..gADWAVSEFQKFYCF......DG..VSGITPTQRAA.............
D0U1J9_MHV68/1-571               .....................MSKEIAVIYAQIYGLCVDLSLVPYMDPGS..--..FHLSAITNNYHKLCQIQKIIGDHLLSNN.SQTPCALTLELEHLLSNAIELCKNILS------......-...---.........HENTCTPLL...-CN..NQCLLDMSCMVCFYG.GDTVDVPLDTINKVDMLFKKLNVTFYCTSFNHTMPLLRKVFAQLGKFRGLSPIPSPGIYDISQ.PCIQCLQQVEYLPNQGLSKDTLLRKAICNHVFPMV...PP--EPIDFAQV-----GPSPST--...--------.....................--VQKSSEDA-..................VVMARPQAMVEYNVFS.VPTSDVLQLSNLLYWTSSDQL-..............TTSSNIDCSNLSNIYAREN.MLLTSSEKV.-----GQLCHRALKKHTP.S--...........PFELLFTGGLVTEHSKIVSALKDDCTASFLKKTNYADSLKHKNEMFASLQSLLTGSS......................................SSQKLN.Q.EKVSQ......................................................-.--------------QDRPE-.............................................-------KGFAHDAHKRKEAYLKKLADEGLKRLTNSLDANIANLEKLLGIRIWGQSVYEELAKLLNHFLIRNFLIQSA--SPT........DWTLEETRERSQFIKSILYGHSINKEHVQSLGTVYYRLLNGPLIQER-GLFKLPINIILAQSLDAAEVLPHQKISMCFDVTN............IKSP...KDWIDVQFNQFYNF......LQ..NTPLAGVQEQA.............
Q2F7T5_HCMV/5-695                ....................l-LQKLCVLCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpegevihlrgreamsgtgttlmtasnsS-----.-.----Nssthsqrn.....................................nggggrargG.GKKAVGGGANGQDGDGSENGlrvrncd...............................ehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGNQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
G8H8U1_HHV1/11-682               ....................a-RQKLLALLGQVQTYVFQIELLRRCDPHI..GR..GKLPQLKLNALQVRALRRRLRPGLEAQA.GAFLTPLSVTLELLLEYAWREGERLLGSLETFA......T...AGD.........VAAFFTETM...GLA..RPCPYHQRVRLDTYG.GT-VHMELCFLHDVENFLKQLNYCHLITPSRGATAALERVREFMVGAVGSGLIVPPELSDPSH.PCAVCFEELCVTANQGATIARRLADRICNHVTQQA...QVRLDANELRRYLPHAAGLSDADRA...RALSVLDH.....................ALARTAGGDGQphps.........pendsVRKEADALLEAHDVFQ.ATTPGLYAISELRFWLASGDRA.............gQTTMDAFASNLTALARREL.QQETAAVAV.ELALFGRRAEHFDRAFGS.HLAa........ldMVDALIIGGQATSPDDQIEALIRACYDHHLTTPLLRRLVSPEQCDEEALRRVLARMG......................................AGGARD.A.PKGGAgpdddgdrva.................................veegarglgapG.-------------------Gggededrr.............................rgpggqgpETWGDIATQAAADVRERRRLYADRLTKRSLASLGRCVREQRGELEKMLRVSVHGEVLPATFAAVANGFAARARFCALT-AGAGtv....idNRSAPGVFDAHRFMRASLLRHQVDPALLPSITHRFFELVNGPLFDHSTHSFAQPPNTALYYSVENVGLLPHLKEELARFIMG............AGGS..gADWAVSEFQRFYCF......DG..ISGITPTQRAA.............
Q5Y922_9ALPH/1-195               ...................rg-----------------------------..--..----------------------------.---------------------------------......-...---.........---------...---..---------------.---------------------------------------------------------------.-----------------------------------...-------------------------...--------.....................-----------..................----------------.----------------------..............-------------------.---------.------------------.---...........---------------------------------------------------------......................................------.-.-----......................................................-.--------------------.............................................------------ETEERKRAYAARLSRRSFLNLSKCVEKQRAFLDKMLSVNVWGQFLLEAAVRTRNGFSRRARFLERVTGFGGev....rdKRHCRTDYDARQFVRNALLRHEVDPALLSELVNRFYELINGPYFTHAYHVFAQPHNTPLYFSVENVGLLPHIKNELASFMLI............RNHR...-EWMVSEYKEFYKFppvcdpEK..TGALNDLQRL-a............
Q9WJZ7_HCMV/1-315                .....................-----------------------------..--..----------------------------.---------------------------------......-...---.........---------...---..---------------.---------------------------------------------------------------.-----------------------------------...-------------------------...--------.....................-----------..................----------------.----------------------..............-------------------.---------.------------------.---...........---------------------------AFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpegeaihlrgreamsgtgttlmtasnsS-----.-.----Nssthsqrn.....................................nggggrargG.-------------------Gkkvvgggvngqdgdgs............englrvrncdehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGDQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
F8RDS9_HHV1/11-682               ....................a-RQKLLALLGQVQTYVFQIELLRRCDPHI..GR..GKLPQLKLNALQVRALRRRLRPGLEAQA.GAFLTPLSVTLELLLEYAWREGERLLGSLETFA......T...AGD.........VAAFFTETM...GLA..RPCPYHQRVRLETYG.GT-VHMELCFLHDVENFLKQLNYCHLITPSRGATAALERVREFMVGAVGSGLIVPPELSDPSH.PCAVCFEELCVTANQGATIARRLADRICNHVTQQA...QVRLDANELRRYLPHAAGLSDADRA...RALSVLDH.....................ALARTAGGDGQphpa.........pendsVRKEADALLEAHDVFQ.ATTPGLYAISELRFWLASGDRA.............gQTTMDAFASNLTALARREL.QQETAAVAV.ELALFGRRAEHFDRAFGS.HLAa........ldMVDALIIGGQATSPDDQIEALIRACYDHHLTTPLLRRLVSPEQCDEEALRRVLARMG......................................AGGAAD.A.PKGGAgpdddgdrva.................................veegarglgapG.-------------------Gggededrr.............................rgpggqgpETWGDIATQAAADVRERRRLYADRLTKRSLASLGRCVREQRGELEKMLRVSVHGEVLPATFAAVANGFAARARFCALT-AGAGtv....idNRSAPGVFDAHRFMRASLLRHQVDPALLPSITHRFFELVNGPLFDHSTHSFAQPPNTALYYSVENVGLLPHLKEELARFIMG............AGGS..gADWAVSEFQRFYCF......DG..ISGITPTQRAA.............
F8SUP7_9BETA/1-76                .....................-----------------------------..--..----------------------------.---------------------------------......-...---.........---------...---..---------------.---------------------------------------------------------------.-----------------------------------...-------------------------...--------.....................-----------..................----------------.----------------------..............-------------------.---------.------------------.---...........---------------------------------------------------------......................................------.-.-----......................................................-.--------------------.............................................-----------------------------------------------------------------------------------........-------------------------------------LLIGPVITHHRDTFPLPFNIDMAYSCDNANILPHVKENLVKCIES............NIGP...GQWMVSSYNGFFDF......SD..SNDINEMQRKM.............
Q7T5E0_CHV1/23-681               ....................a-RQKLLALFGQVQTYVFQLELLRRCDPRI..GR..GKLAALKLNALQVRAVRRRLRPGLAAQA.RAFLTPLSVTLELLLEYAQREGERLLGCLEAFGe...ggE...EGD.........VAAFFVESM...GLA..RPCPYHQPIRLETYG.GC-VDMELCFLHDVENFLKQLNYCHLITPPRGAIAALERVRAFLVGAVGSGLVVPPEISDPSH.PCAVCFEELCVTANQGATIARRLADRICNHVTQQA...QVRLDDNELRRYLPHASGFSEAARA...RALRVLDQ.....................ALERAAAGEAQgrap..........adesARREADALLEAHDVFQ.ATTPGLYAISELRFWLASGDRA.............hQSTMDAFADNLTELARREL.RHETAVAAV.ELALFGRRAEHFERAFGD.RLAa........ldMVDALLVGGQATSPEDQIEALIRACYDHHLTTPLLRRLVNPEQSDEEALRRVLARLG......................................GGRRDA.G.EGEDGa...................................................agE.-AGEGAAAPEAGRGDGREDG............................................pESWADVAGRAAADVRERRRLYADRLTKRSLASLGRCVREQRGELEKMLRVSVHGEVLPATFAAVSNGFAARVRFCDLTAAA-Gtv....vdNRAAPGVFDAHRFMRASLLRHHVDPALLPSITHRFFELVNGPLFDHATHSLAQPPNTALYYSVENVGLLPHLKEELARFIMG............AGGA..gTEWAVSEFQKFYSF......DG..ISGITPTQRAA.............
TRM1_MUHVS/5-660                 ....................t-LQKLCVVCSKCNECAMDVECLKYCDPNI..VS..MDSTAFRRNGVMVIHLYRTLYPALVSQN.AVQTSVLTLYMEMLLQGLYDTMREIDMALTDFG......T...HRD.........RQRYYRRVL...KLD..-SCNRHESITITFAP.ELALTIDLATLNDVERLLCKINCVYGAVDASQGVAVCRRLLSLLARLCDICPVAGPEIYRETV.TCFQCYEELMAVPNQGRSINRRMQGLLCDHITIK-...KVLVQLDMDAQAVEQDMGDIAIRAPsvkGIIRAIKS.....................LASFSPASYA-..................YINDAEEALRGYNLFS.EIPDRIYSLSDYTYWSKTS---..............EAIVRHVGITMRQLNVSHS.LWKTLRTEL.SRYHYGEDLEDVFTLGEG.RFG...........GDERIYVGSIFAAPGKVVDMITSMSIKSFENNPLFNRL-HESNEIYAKIKSLIEEIRgvgdgp.........................aagaarsR-----.-.----Aeaasgag.......................................aggeegagA.---AAGRGN----------Tggdegagtt...........................tamssalecGDPLLRVHDVNKEVNVRKRAYLKKVSEMGYNKVMACIRNQEHLVTKLVNVNLVGTVCLEAVSKIMNGFLSRQRSITEAETYP-........DVAESLGYDEHLYVINNLVHKRLPSELLPQLGQQIYRFINGPMFTHYLDRHPLPYNVNMAYACDNAGILPHVKEDLVRCADG............TVVP...SDWMTVGYMGFFRF......AD..IRELNDLQKMV.............
F5B4S8_ILTV/5-673                ..................tql---RLMALAGQLQTLLFQIDILKRCDPEI..LLqkRLRSRIKHNALMALYIHSLLSNELSMQV.NYRLTLQTYCVWLWLRRACSEIAALCNEIDKYS......V...LKD.........RKCFFEATL...GYGkgFICPLHAEVQLQLYGmSSIISKELVLINDVENFMKQLNYCHCVVSCKNAIEALNTIDEFLVLSSGGSLVAAPDTYDHGQ.PCYVCLEELSVTANQGETIYRRLGYKICDHLTRQF...PVNVSTDDLKRHLPFLRDVDPEKLK...NVLSNETR.....................IEAENHVEAGRtls............sspGESEASKILNKYDVFT.EPPGPVYQLSELQYWLASGKRTpsgve...sqtttsQSVLKQLDKDLSELFKRAE.DFEQECIRL.ERTLFEKVHAHFHRVAQA.ELIsp......qhsLVDTLITGVLATSPDTEIAALIKACYDHHLSLPLFRRLRNPEKVDTDALEELVEKLR......................................GSDKET.Q.PVTEG......................................................T.STSDLTANLRGTIERDEDS-.............................................--IEVLLKKAERDLDVRQKNYVEKLSARSFSNLDRCIKIQRAELEKLMRVNIYGETLPVMYVTLKNAFLARRAFLDIVCAEESlhskilriDQNDGRAYDWHQYIRSSITRYQIDQTMLPRLTNRFFEILSGPLFKHHKERFPQPPNTSIYFSVENVGLLPHLKEELVNFTKR............HRSC...-DWMTSEFRRFYNF......AG..ISNSTAIQRAA.............
F8TC21_9ALPH/18-682              ....................a-SQKLLAVWGQLQSYLFQVELLKRCDPRV..GV..RMIKPLKLNVLMVRYLENLMAPGLTEQL.ERNISPLSYGLWLALRRARLDGEVLLRALCEFT......D...TGD.........VHGFFIKSM...TIS..GDCPYHEVVELDTYG.GS-VRTEIKFLHDVENILKQLNYCHLIVKAGTAENFMLALDRYLIETLGAGSVVSPELCDPSQ.PCSVCFEELCVTANSGDSAHKRIIGKICNHVTKQI...VLRVHPDDMVAHIPHAACLSDEKRS...VVQAALSL.....................IRPTRGDKDPGgsg...........dtvsVADAATAVLDAHNVFL.PASGNLYAISELQFWIASSERKpn.........qprANTIDSFADNLEDLAFKER.LFDLRTSVV.EMTVFGRRMDHFERVFAQ.EIEn........mnAADRLLLGGRAVAPDDIIEALIRACYDHHMSTPLLKRLLYPEEAAQDALKTTLEQVT......................................SHSTRN.G.PLCQD......................................................G.DGAPEDDFSNSEHLRIR--Egvtpl..................................pdvrehYDWLELVRSASADVARRRKMYAERLSKRSLASLDKCITEQRKELEKMLRVNVYGEILIDSYTTLFNGFRSRNRLLEAIRKRCTni....idNRITADAFDAHRFMQTSLLKHRIDPAMLPSLTHKFFRLLNGPMFNHDVHRFAQPSNTALYFSVENVGLLPHLKEEIARFMIH............SCSS...SDWIVSKFRGFYDF......DG..IDSITAAHRMA.............
D3YPI6_HHV1/11-682               ....................a-RQKLLALLGQVQTYVFQIELLRRCDPHI..GR..GKLPQLKLNALQVRALRRRLRPGLEAQA.GAFLTPLSVTLELLLEYAWREGERLLGSLETFA......T...AGD.........VAAFFTETM...GLA..RPCPYHQRVRLDTYG.GT-VHMELCFLHDVENFLKQLNYCHLITPSRGATAALERVREFMVGAVGSGLIVPPELSDPSH.PCAVCFEELCVTANQGATIARRLADRICNHVTQQA...QVRLDANELRRYLPHAAGLSDADRA...RALSVLDH.....................ALARTAGGDGQphps.........pendsVRKEADALLEAHDVFQ.ATTPGLYAISELRFWLASGDRA.............gQTTMDAFASNLTALARREL.QQETAAVAV.ELALFGRRAEHFDRAFGS.HLAa........ldMVDALIIGGQATSPDDQIEALIRACYDHHLTTPLLRRLVSPEQCDEEALRRVLARMG......................................AGGATD.A.PKGGAgpdddgdrva.................................veegarglgapG.-------------------Gggededrr.............................rgpggqgpETWGDIATQAAADVRERRRLYADRLTKRSLASLGRCVREQRGELEKMLRVSVHGEVLPATFAAVANGFAARARFCALT-AGAGtv....idNRSAPGVFDAHRFMRASLLRHQVDPALLPSITHRFFELVNGPLFDHSTHSFAQPPNTALYYSVENVGLLPHLKEELARFIMG............AGGS..gADWAVSEFQRFYCF......DG..ISGITPTQRAA.............
Q89585_9ALPH/37-727              ....................a-RQRLLAILGQVQTYNFQLALLGRCDPAV..AR..RHLDAVKLNALMVRWLRRRLGGALRAQA.RVRLTPLTYALDLALDHAAAESDALLAAAGT--......-...ASA.........PAEFFARTM...GLE..GACRFHRRARLALYG.GETIDIEIQFLHDVENFLKQLNFAHLLASTDAALAALGDVDAFLRATVAGGGVAPPELHDFAQ.PCLVCFEELCVTANQGESVGRRLALCACDHVTRQL...RVRTELCSVGQYLPHVQGVSRARLA...AAAAALAA.....................LAAPTAAGAGGppvlatap.pggdgdggsVREAAASVLDAHHVFR.PAPRWLYAVSELQFWMSSSARGe...........aaASAVAAFAGNLEALAAREA.QHRLQVAAA.EMALFGRSPEHFDRALAD.KLAq........ldGVDCLLVGSAAVAPDERLEALIRACYDHHMSASLIRRLTRPDQRNEDALRELLRRAA......................................AGEAGA.A.AVGLGg...................................................pgR.--DEGGGDEPEEEGGTDNDGgagagvggggagps.................ggadggggaeddgpAGWAALAARARADADVRRQRYAERLSKRSMDSLGRCIRDQRRELEKTLRVSVYGDVLLNVYVAVHNGFCARRAFRAALASA-Gtv....vdNRASDATFDAHRFMKEALLRHAVDPATWPALTHQFFDLVNGPLFDGSAHNFAQPPNTALYFSVENVGLLPHLKEELAAFMLA............AAGG...-GWAVSDFQQFFCF......ASarARGVTAAQRLA.............
Q2F7V1_HCMV/5-695                ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpegeaihlrgreamsgtgttlmtasnsS-----.-.----Nssthsqrn.....................................nggggrargG.-------------------Gkkvvgggvngqdgdgs............englrvrncdehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGDQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
G3G8X2_9ALPH/2-632               ....................a-ERRLVAVLGQVQTYVFQLEMLKRCDPAV..VR..ELAPRVKLNALMCRYLARRL--PLEAQ-.---MTPLTCALRLALAYARAEGDRVLGALAA--......A...GDD.........AEAYFERTM...G--..GACRFHARVALDTYG.GR-VETELQFLHDAENLLKQLNYCHLITPHAVD---LSAVDEFLARTIGGGLVVPPELYDPAQ.PCAVCFEELCVTANQGEATHRRLLGCVCDHLTRQL...AVRVDPEDVAKNLPHVRGLDEARRG...RALAALAA.....................VDAAEAREAEAgaeag........dagetARRRADALLDAHDVFR.PASRRLYAVSELQFWLASTNQA..............VRALDLFTHNLDDLERRER.RAEVRAAAV.ELALFGRRPEHFDRARAArELD...........IIDGLLVGGCAASPDERLEALIRACYDHHMSTPMLRML-DPDRANRDALERLLEGGD......................................DADADG.G.AAGGA......................................................D.AGDGGVGDEDGPGAPPPADA.............................................VAWADLPAAALRDAERRRRLYADRLSRRSAASLAQCVREQRRELEKTLRVNVYGDALLHTYVAVAAGFRARRAFCEAA-ARAGt.....vvDERETGCFDAHSFMKATVQRHPVDAALLPALTHKFFELVNGPLFAHDTHAFAQPPNTALYFAVENVGLLPHLKEELARFMVA............R---...-DWCVSEFRGFYRF......QT..-AGVTATQRQA.............
E7DVK6_HCMV/5-694                ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpegeaih.lrgreamsgtgttlmtassS-----.-.----Nssthsqrn.....................................nggggrtrgG.GKKAVGGGANGQDGDGSENGlrvrncd...............................ehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGDQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
Q2F7T6_HCMV/5-692                ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpegevih.lrgreamsgtgttlmtasnS-----.-.----Sthsqrnn.......................................ggggrargG.GKKAVGGGANGQDGDGSENGlrvrncd...............................ehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGNQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
Q6SLG8_9ALPH/2-655               ....................d-SRETVALVSRLNAFLFQLELLKRCDPEAvvVS..PLRRSLKLNCLMVAYLRDRLEVPVKEQN.RTEADYALYSLGLALTSACREAGRCWQLLEEFE......R...NRD.........KRAFFRGAM...GLD..VPCPYHVETELRAYG.DVRVTKQLSTVNDAENLLKQVNYIHTVVPEAAAAELFARIDEFFSETLANGPVAAFEAYDESA.PCAVCFEELCVTANQGQSVYKRLADRACDHLATRY...QVHVDEDDLLKNLPYAGGHAPQRLN...ALCEDLRR.....................ARREAQDERQRtengc.......saaesaVMDEMERLVNSFDVFC.NVPPAVYKMSELKFWLLAGSGD..............ETAIDLYGRRLADLEEKDA.LLARQEALT.SLRLFGVRLTHFHDLFPP.A-D...........PMEKVAVGSPRLPPETRMVALINAFYARAADVPLFRRLRETGERNTEALRKVLLQIR......................................SGETAE.E.ESDDG......................................................-.-----RDTAVGESFRSQNES............................................lRDLEELERRVRGETEERKRAYAARLSRRSFLNLSKCVEKQRAFLDKMLSVNVWGQFLLEAAVRTRNGFSRRARFLERVTGFGGev....rdKRHCRTDYDARQFVRNALLRHEVDPALLSELVNRFYELINGPYFTHAYHVFAQPHNTPLYFSVENVGLLPHIKNELASFMLI............RNHR...-EWMVSEYKEFYKFppvcdpEK..TGALNDLQRL-a............
TRM1_EHV1/6-669                  ....................a-RQRLLAIFGQVQAYIFQVEMLKRCDPSA..LL..PLVGSLKLNALTIRMLRRKLGGALIEQA.QHQQTPLACALTMALEYAEVEGERVLRAVDDVN......L...AG-.........PEGFFRATM...RLD..EPCEYHVRVHLDTYG.GP-IDAEVQFLHDAENFLKQLNYCHLITGFEAGLDALESVARFLTRTVGSGIVVPPELCDPTH.PCSVCFEELCVTANQGEAVHRRLLECTCDHITRQM...AVRVANIDIARHLPHALSVASERRA...AAEAALRA.....................LEARRVQGHNGksag..........tedpTQQVASRLLESHHVFK.PASRCLYAVSELKFWLASTKHGdm..........gqPRAIDTFTENLETLDKQEK.FFHLQAATV.ELALFGRTLDHFDRLFAD.QLLg........ldVIDGMLVGSCAVSPDDHIEALIKACYTHHMSAPLLQRLTDPDTSNREALKQLLGRIG......................................VDTDDG.A.GELGDaldvdld........................................nlggappV.NST----------------Pcgedal................................crtvseeRPWDKLLERATADASQRRRMYAERLSKRSIASLGRCVREQRRELEKTLRVNVYGEVLLHTYVSSYNGFCARRGFCAAV-SRAGti....idNRSSTSAFDSHQFMKAALLRHPIDQSLMPSITHKFFELINGPVFDNAGHNFAQPPNTALYYSVENVGLLPHLKEELARFMIT............AAKG...-DWSISEFQRFYCF......EG..VTGVTATQRLA.............
Q2F7S3_HCMV/5-695                ....................l-LQKLCVLCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpegevihlrgreamsgtgttlmtasnsS-----.-.----Nssthsqrn.....................................nggggrargG.GKKAVGGGANGQDGDGSENGlrvrncd...............................ehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGNQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
Q53D60_9GAMA/1-599               .....................MARELAALYAQLSALAVDLSLVVFADPRS..--..IDGSRILKTKTQIENLNRDLLPLLRKQN.SVETSSLSLEVEHLAKNIEDKLGELERSLRQ--......-...RYS.........SREHFETLH...-LR..PECHYHATVTFEFYG.GGLIDVNMCLINDVELLCKRLGSVFYCIGANEALSGLDRVLAFLSTLRGISPIPHPDLYVTSV.PCVQCLREIELVPNQGSSLLAVLADRHCDHLCKKVraePIHGLFETELSQLGLKVAKGSDA--...--------.....................TQHGVRSSADQ..................LRESSLAAIQDHNIFK.RVSASIMELSNLIYWNAGQTGL..............QTGTENECSQMAKLLTHEA.EMHEHRALI.---TPKQSAAHFYDCFRP.D--...........PIESLFCGGLFNSIDDTINALSRDCSVTFFQQANYTNVMRKQNELFTRLNSILCQGS......................................AGSQKP.A.TPSEP......................................................-.--------RTATVAATA---.............................................------ASDVIKDAQYRKEQYMKKVARDGFKKLTECLQTQSAVLANALCMRVWGGVAYGEASELVNHFLLRRRFVALP-WEAR........CRSNQILFENSKYIKNSLYSQRLSREHVEIITLQFYGLITGPLTRQS-DLFPGPANVVLAQCFEAAGMLPHHKMLVSEMIWP............QIQP...KDWIDQTFNRFYQL......PE..-GDLNAVQKSA.............
F0UXG1_9BETA/3-677               ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AECTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALMDRALTAYS......R...HPD.........RTAFYRTVL...RLD..-HCDRHHTVELRFTD.SVRFSVTLATLNDIERFLCKMNYVYGILAPEAGLEVCTQVLALLRRLCGISPVARQEAYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLELTERVPrlvGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGVTIQQLNVYHH.LCRVLMNTI.SRHLYGEDVEDIFALGEK.VLA...........GEERMFVGSVFAAPSRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKRILEEIRrpvpdgtggdgpe............ggtsfnrhgagteE--EET.-.----Kaqsttgg........................................ttshsssN.-------------------Grprsgtrkavaaaf................qrgprseeehealdpLDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKAQERLTTKLIDVNLVGPVCLDFISKMMNGFIYRSRFGCDREM--L........DVGQHFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHAKDDLVKCAEG............TVYP...SEWMVVKYMSFFNF......SD..CRDLNVLQKEM.............
B0CMT7_HHV3/5-661                ....................i-NRTLLVLLGQVYTYIFQVELLRRCDPRV..AC..RFLYRLAANCLTVRYLLKLFLRGFNTQL.KFGNTPTVCALHWALCYVKGEGERLFELLQHFK......T...RFVygetkdsncIKDYFVSAF...NLK..-TCQYHHELSLTTYG.GD-VSSEIQFLHDIENFLKQLNYCYIITSSREALNTLETVTRFMTDTIGSGLIPPVELFDPAH.PCAICFEELCITANQGETLHRRLLGCICDHVTKQV...RVNVDVDDIIRCLPYIPDVPDIKRQ...SAVEALRT.....................LQTKTVVNPMGaknd..........tfdqTYEIASTMLDSYNVFK.PAPRCMYAISELKFWLTSNSTEg............pQRTLDVFVDNLDVLNEHEK.HAELTAVTV.ELALFGKTPIHFDRAFSE.ELGs........ldAIDSILVGNRSSSPDSQIEALIKACYAHHLSSPLMRHISNPSHDNEAALRQLLERVG......................................CEDDLT.K.EASDS......................................................-.--ATASECDLNDDSSITFAV.............................................HGWENLLSKAKIDAAERKRVYLEHLSKRSLTSLGRCIREQRQELEKTLRVNVYGEALLQTFVSMQNGFGARNVFLAKV-SQAGci....idNRIQEAAFDAHRFIRNTLVRHTVDAAMLPALTHKFFELVNGPLFNHDEHRFAQPPNTALFFTVENVGLFPHLKEELAKFMGG............VVGS...-NWLLSPFRGFYCF......SG..VEGVTFAQRLA.............
Q2F7V0_HCMV/5-695                ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpegevihlrgreamsgtgttlmtasnsS-----.-.----Nssthsqrn.....................................nggggrargG.GKKAVGGGANGQDGDGSENGlrvrncd...............................ehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGNQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
H2A2Q7_MUHV1/5-660               ....................t-LQKLCVVCSKCNECAMDVECLKYCDPNI..VS..MDSTAFRRNGVMVIHLYRTLYPALVSQN.AVQTSVLTLYMEMLLQGLYDTMREIDMALTDFG......T...HRD.........RQRYYRRVL...KLD..-SCNRHESITITFAP.ELALTIDLATLNDVERLLCKINCVYGAVDASQGVAVCRRLLSLLARLCDICPVAGPEIYRETV.TCFQCYEELMAVPNQGRSINRRMQGLLCDHITIK-...KVLVQLDMDAQTVEQDMGDIAIRAPsvkGIIRAIKS.....................LASFSPASYA-..................YINDAEEALRGYNLFS.EIPDRIYSLSDYTYWSKTS---..............EAIVRHVGITMRQLNVSHS.LWKTLRTEL.SRYHYGEDLEDVFTLGEG.RFG...........GDERIYVGSIFAAPGKVVDMITSMSIKSFENNPLFNRL-HESNEIYAKIKSLIEEIRgvgdgp.........................aagaaasR-----.-.----Aeaasgaga......................................ggdegagaA.----AGRGN----------Tggdegagtt...........................tamssalecGDPLLRVHDVNKEVNVRKRAYLKKVSEMGYNKVMACIRNQEHLVTKLVNVNLVGTVCLEAVSKIMNGFLSRQRSITEAETYP-........DVAESLGYDEHLYVINNLVHKRLPSELLPQLGQQIYRFINGPMFTHYLDRHPLPYNVNMAYACDNAGILPHVKEDLVRCADG............TVVP...SDWMTVGYMGFFRF......AD..IRELNDLQKMV.............
H8ZRF1_ILTV/5-673                ..................tql---RLMALAGQLQTLLFQIDILKRCDPEI..LLqkRLRSRIKHNALMALYIHSLLSNELSMQV.NYRLTLQTYCVWLWLRRACSEIAALCNEIDKYS......V...LKD.........RKCFFEATL...GYGkgFICPLHAEVQLQLYGmSSIISKELVLINDVENFMKQLNYCHCVVSCKNAIEALNTIDEFLVLSSGGSLVAAPDTYDHGQ.PCYVCLEELSVTANQGETIYRRLGYKICDHLTRQF...PVNVSTDDLKRHLPFLRDVDPEKLK...NVLSNETR.....................IEAENHVEAGRtls............sspGESEASKILNKYDVFT.EPPGPVYQLSELQYWLASGKRTpsgve...sqtttsQSVLKQLDKDLSELFKRAE.DFEQECIRL.ERTLFEKVHAHFHRVARA.ELIsp......qhsLVDTLITGVLATSPDTEIAALIKACYDHHLSLPLFRRLRNPEKVDTDALEELVEKLR......................................GSDKET.Q.PVTEG......................................................T.STSDLTANLRGTIERDEDS-.............................................--IEVLLKKAERDLDVRQKNYVEKLSARSFSNLDRCIKIQRAELEKLMRVNIYGETLPVMYVTLKNAFLARRAFLDIVCAEESlhskilriDQNDGRAYDWHQYIRSSITRYQIDQTMLPRLTNRFFEILSGPLFKHHKERFPQPPNTSIYFSVENVGLLPHLKEELANFTKR............HRSC...-DWMTSEFRRFYNF......AG..ISNSTAIQRAA.............
Q5PPC6_SUHVF/2-638               ....................a-ERRLVAVLGQVQTYVFQLEMLKRCDPAV..VR..ELAPRVKLNALMCRYLARRL--PLEAQ-.---TTPLTCALRLALAYARAEGDRVLGALAA--......A...GDD.........AEAYFERTM...G--..GACRFHARVALDTYG.GR-VETELQFLHDAENLLKQLNYCHLITPHAVD---LSAVDEFLARTIGGGLVVPPELYDPAQ.PCAVCFEELCVTANQGEATHRRLLGCVCDHLTRQL...AVRVDPEDVAKNLPHVHGLDEARRG...RALAALAA.....................VDAAEAREAEAastaaaga..eagdagetARRRADALLDAHDVFR.PASRRLYAVSELQFWLASTNQA..............VRALDLFTHNLDDLERRER.RAEVRAAAV.ELALFGRRPEHFDRARAArELD...........IIDGLLVGGCAASPDERLEALIRACYDHHMSTPMLRML-DPDRANRDALERLLEGGD......................................DADADG.G.AAGGA......................................................D.AGDGGVGDEDGPGAPPPADA.............................................VAWADLPAAALRDAERRRRLYADRLSRRSAASLAQCVREQRRELEKTLRVNVYGDALLHTYVAVAAGFRARRAFCEAA-ARAGt.....vvDERETGCFDAHSFMKATVQRHPVDAALLPAVTRKFFELVNGPLFAHDTHAFAQPPNTALYFAVENVGLLPHLKEELARFMVA............R---...-DWCVSEFRGFYRF......QT..-AGVTATQRQA.............
Q2F7R4_HCMV/5-695                ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpegeaihlrgreamsgtgttlmtannsS-----.-.----Nssthsqrn.....................................nggggrargG.GKKAVGGGANGQDGDGSENGlrvrncd...............................ehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGDQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
Q9QTC0_9ALPH/18-682              ....................a-SQKLLAVWGQLQSYLFQVELLKRCDPRV..GV..RMIKPLKLNVLMVRYLENLMAPGLTEQL.ERNISPLSYGLWLALRRARLDGEVLLRALCEFT......D...TGD.........VHGFFIKSM...TIS..GDCPYHEVVELDTYG.GS-VRTEIKFLHDVENILKQLNYCHLIVKAGTAENFMLALDRYLIETLGAGSVVSPELCDPSQ.PCSVCFEELCVTANSGDSAHKRIIGKICNHVTKQI...VLRVHPDDMVAHIPHAACLSDEKRS...VVQAALSL.....................IRPTRGDKDPGgsg...........dtvsVADAATAVLDAHNVFL.PASGNLYAISELQFWIASSERKpn.........qprANTIDSFADNLEDLAFKER.LFDLRTSVV.EMTVFGRRMDHFERVFAQ.EIEn........mnAADRLLLGGRAVAPDDIIEALIRACYDHHMSTPLLKRLLYPEEAAQDALKTTLEQVT......................................SHSTRN.G.PLCQD......................................................G.DGAPEDDFSNSEHLRIR--Egvtpl..................................pdvrehYDWLELVRSASADVARRRKMYAERLSKRSLASLDKCITEQRKELEKMLRVNVYGEILIDSYTTLFNGFRSRNRLLEAIRKRCTni....idNRITADAFDAHRFMQTSLLKHRIDPAMLPSLTHKFFRLLNGPMFNHDVHRFAQPSNTALYFSVENVGLLPHLKEEIARFMIH............SCSS...SDWIVSKFRGFYDF......DG..IDSITAAHRMA.............
G8H8F0_HHV1/11-682               ....................a-RQKLLALLGQVQTYVFQIELLRRCDPHI..GR..GKLPQLKLNALQVRALRRRLRPGLEAQA.GAFLTPLSVTLELLLEYAWREGERLLGSLETFA......T...AGD.........VAAFFTETM...GLA..RPCPYHQRVRLDTYG.GT-VHMELCFLHDVENFLKQLNYCHLITPSRGATAALERVREFMVGAVGSGLIVPPELSDPSH.PCAVCFEELCVTANQGATIARRLADRICNHVTQQA...QVRLDANELRRYLPHAAGLSDADRA...RALSVLDH.....................ALARTAGGDGQphps.........pendsVRKEADALLEAHDVFQ.ATTPGLYAISELRFWLASGDRA.............gQTTMDAFASNLTALARREL.QQETAAVAV.ELALFGRRAEHFDRAFGS.HLAa........ldMVDALIIGGQATSPDDQIEALIRACYDHHLTTPLLRRLVSPEQCDEEALRRVLARMG......................................AGGAAD.A.PKGGAgpdddgdrva.................................vedgarglgapG.-------------------Gggededrr.............................rgpggqgpETWGDIATQAAADVRERRRLYADRLTKRSLASLGRCVREQRGELEKMLRVSVHGEVLPATFAAVANGFAARARFCALT-AGAGtv....idNRSAPGVFDAHRFMRASLLRHQVDPALLPSITHRFFELVNGPLFDHSTHSFAQPPNTALYYSVENVGLLPHLKEELARFIMG............AGGS..gADWAVSEFQRFYCF......DG..ISGITPTQRAA.............
Q4JQU5_VZVO/5-661                ....................i-NRTLLVLLGQVYTYIFQVELLRRCDPRV..AC..RFLYRLAANCLTVRYLLKLFLRGFNTQL.KFGNTPTVCALHWALCYVKGEGERLFELLQHFK......T...RFVygetkdsncIKDYFVSAF...NLK..-TCQYHHELSLTTYG.GY-VSSEIQFLHDIENFLKQLNYCYIITSSREALNTLETVTRFMTDTIGSGLIPPVELFDPAH.PCAICFEELCITANQGETLHRRLLGCICDHVTKQV...RVNVDVDDIIRCLPYIPDVPDIKRQ...SAVEALRT.....................LQTKTVVNPMGaknd..........tfdqTYEIASTMLDSYNVFK.PAPRCMYAISELKFWLTSNSTEg............pQRTLDVFVDNLDVLNEHEK.HAELTAVTV.ELALFGKTPIHFDRAFSE.ELGs........ldAIDSILVGNRSSSPDSQIEALIKACYAHHLSSPLMRHISNPSHDNEAALRQLLERVG......................................CEDDLT.K.EASDS......................................................-.--ATASECDLNDDSSITFAV.............................................HGWENLLSKAKIDAAERKRVYLEHLSKRSLTSLGRCIREQRQELEKTLRVNVYGEALLQTFVSMQNGFGARNVFLAKV-SQAGci....idNRIQEAAFDAHRFIRNTLVRHTVDAAMLPALTHKFFELVNGPLFNHDEHRFAQPPNTALFFTVENVGLFPHLKEELAKFMGG............VVGS...-NWLLSPFRGFYCF......SG..VEGVTFAQRLA.............
Q69103_HHV2/15-246               ....................a-RQKLLALLGQVQTYVFQLELLRRCDPQI..GL..GKLAQLKLNALQVRVLRRHLRPGLEAQA.AAFLTPLSVTLELLLEYAWREGERLLGHLDTFA......T...TGD.........VSAFFTETM...GLA..RPCPYHQQIRLETYG.GD-VRMELCFLHDVENFLKQLNYCHLITPPSGATAALERVREFMVAAVGSGLIVPPELSDPSH.PCAVCFEELCVTANQGATIARRLADRICNHVTQQA...QVRLDANEL----------------...--------.....................-----------..................----------------.----------------------..............-------------------.---------.------------------.---...........---------------------------------------------------------......................................------.-.-----......................................................-.--------------------.............................................-----------------------------------------------------------------------------------........----------------------------------------------------------------------------------............----...--------------......--..-----------rry..........
TRM1_EHV2/1-639                  .....................MARELAAVYAQVFDLAAEVSLLGYCDPSS..--..IDKRCVMANSNKVFKLCESLLPCLRLQN.DTECSPLSLELQHLLQNTREALGVLTDLLSG--......-...DPS.........RSEYFEALHpsrPLE..GPCKRHARVRVPFYG.GAEKTVSLSLLNDVEVFFKRLNSVFYCLPAEGALEALGETVAFLGRLRGVSPIPPADAYVSSV.PCASCFAEAAMLPNQGESVLSMLAAVNCNHVCRQVpsdPVIGVFENELRHLGADARAAGRAGG...GRESERRG.....................REDADDEEDDEeeprdgqgdagdgaalrvLTESSLSVLAGHTIFE.EEDGRLAEISNLVYWSSAADRGg...........vgGTARATSSSHMAKLFAHEA.RMHRSRAWL.----GRGAPSHFFDAHRP.S--...........PLESLFCGGVFNSIDDTIAALQKDCSATFLKKSNYQTLIQQQNELYVRLNEVLNGAG......................................RDEGGA.K.GAEAI......................................................-.--ADAEPLKPDGGASCDPR-.............................................--------DVLSDARVRRDLYLKKLTRDGLRRLTDCIETHGRVLSDTLSLRVWGSALYASAARLVNHFLFRRQFVGLG-WADL........TAGGEAAFENSKYIKNALHGQRLNREHLDSIVVHFYRLITGPLSLQN-SHFPVPDNVALAYCLDAAGAMPHQKLVITEMIWP............GIES...KDWIDCNFNSFYSI......ET..-GDLNLTQKK-t............
B9VQF6_9ZZZZ/11-682              ....................a-RQKLLALLGQVQTYVFQIELLRRCDPHI..GR..GKLPQLKLNALQVRALRRRLRPGLEAQA.GAFLTPLSVTLELLLEYAWREGERLLGSLETFA......T...AGD.........VAAFFTETM...GLA..RPCPYHQRVRLDTYG.GT-VHMELCFLHDVENFLKQLNYCHLITPSRGATAALERVREFMVGAVGSGLIVPPELSDPSH.PCAVCFEELCVTANQGATIARRLADRICNHVTQQA...QVRLDANELRRYLPHAAGLSDADRA...RALSVLDH.....................ALARTAGGDGQphps.........pendsVRKEADALLEAHDVFQ.ATTPGLYAISELRFWLASGDRA.............gQTTMDAFASNLTALARREL.QQETAAVAV.ELALFGRRAEHFDRAFGS.HLAa........ldMVDALIIGGQATSPDDQIEALIRACYDHHLTTPLLRRLVSPEQCDEEALRRVLARMG......................................AGGAAD.A.PKGGAgpdddgdrva.................................veegarglgapG.-------------------Gggededrr.............................rgpggqgpETWGDIATQAAADVRERRRLYADRLTKRSLASLGRCVREQRGELEKMLRVSVHGEVLPATFAAVANGFAARARFCALT-AGAGtv....idNRSAPGVFDAHRFMRASLLRHQVDPALLPSITHRFFELVNGPLFDHSTHSFAQPPNTALYYSVENVGLLPHLKEELARFIMG............AGGS..gADWAVSEFQRFYCF......DG..ISGITPTQRAA.............
F0UXE9_9BETA/3-681               ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AECTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALTAYS......R...HPD.........RAAFYRTVL...RLD..-HCDRHHTVELRFTD.SVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCTQLLALLRRLCGISPVARQEAYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLELTERIPrlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGVTIQQLNVYHH.LCRVLMNTI.SRHLYGEDVEDIFALGEK.VLA...........GEERMFVGSVFAAPSRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKRILEEIRrplpdgtggdgp.............ergtsrhpqmhpkT-----.-.----Gsrteeeesmegtgt.........................yghngssrfrgrgrrG.-------------------Aaggaatlsqtp.......................rgeeehealdpLDARSRVHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKAQERLTTKLIDVNLVGPVCLDFLSKMMNGFIYRSRYGQDREM--L........DVGQSLTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHAKDDLVKCAEG............TVYP...SEWMVVKYMSFFNF......SE..CQDLNVLQKEM.............
Q5Y917_9ALPH/1-195               ...................rg-----------------------------..--..----------------------------.---------------------------------......-...---.........---------...---..---------------.---------------------------------------------------------------.-----------------------------------...-------------------------...--------.....................-----------..................----------------.----------------------..............-------------------.---------.------------------.---...........---------------------------------------------------------......................................------.-.-----......................................................-.--------------------.............................................------------ETEERKRAYAARLSRRSFLNLSKCVEKQRAFLDKMLSVNVWGQFLLEAAVRTRNGFSRRARFLERVTGFGGev....rdKRHCRTDYDARQFVRNALLRHEVDPALLSELVNRFYELINGPYFTHAYHVFAQPHNTPLYFSVENVGLLPHIKNELASFMLI............RNHR...-EWMVSEYKEFYKFppvcdpEK..TGALNDLQRL-a............
B3UXZ2_MUHV1/5-660               ....................t-LQKLCVVCSKCNECAMDVECLKYCDPNI..VS..MDSTAFRRNGVMVIHLYRTLYPALVSQN.AVQTSVLTLYMEMLLQGLYDTMREIDMALTDFG......T...HRD.........RQRYYRRVL...KLD..-SCNRHESITITFAP.ELALTIDLATLNDVERLLCKINCVYGAVDASQGVAVCRRLLSLLARLCDICPVAGPEIYRETV.TCFQCYEELMAVPNQGRSINRRMQGLLCDHITIK-...KVLVQLDMDAQTVEQDMGDIAIRAPsvkGIIRAIKS.....................LASFSPASYA-..................YINDAEEALRGYNLFS.EIPDRIYSLSDYTYWSKTS---..............EAIVRHVGITMRQLNVSHS.LWKTLRTEL.SRYHYGEDLEDVFTLGEG.RFG...........GDERIYVGSIFAAPGKVVDMITSMSIKSFENNPLFNRL-HESNEIYAKIKSLIEEIRgvgdgpa.......................agaaasraE-----.-.----Aasgaga.........................................ggeegagA.---AAGRGN----------Tggdegagtt...........................tamssalecGDPLLRVHDVNKEVNVRKRAYLKKVSEMGYNKVMACIRNQEHLVTKLVNVNLVGTVCLEAVSKIMNGFLSRQRSITEAETYP-........DVAESLGYDEHLYVINNLVHKRLPSELLPQLGQQIYRFINGPMFTHYLDRHPLPYNVNMAYACDNAGILPHVKEDLVRCADG............TVVP...SDWMTVGYMGFFRF......AD..IRELNDLQKMV.............
G1EUP2_BHV4/1-605                .....................MARELAAVYSQVFDLSFKTSLLTFCDPRH..--..IDLGAFQRNKKRLKLLIDALYSHLVEQN.RTECSCLSLELEHLIINTYITMQKLETCLNE--......-...NIY.........EKDYFTMLH...-LS..DLCCFHKTVNLCFYG.DCVIPISLSIINDIEIFFSRLNSVFYCISGNNALEGLEETINFLGTLRNISPIPLPDLYLPSI.SCMNCLNETSILPNQGENVFTIMNSINCTHVATPVapePVQGLFENELMHLNIPVDGTDNK--...--------.....................VQLETSDTR--..................IQNASIEAIDQHNIFE.KVSQHILEISNLIYWNSGHSN-..............DQSPKLSCSQMATLIQHET.RMASHRQKVaSHLALTTPPIHFFDSYRA.Y--...........PIESLFCGGIFYSIMDNIQALKQDCSTTFLAKSNYKTIMERKNELYVRLNNLLAPSH......................................TKEGDI.D.KPNTS......................................................-.----IKQARTHTIGETTSE-.............................................--------QIFSDAAARKNNYLQKVTTEGLKKITDCLETQGKIMCNTLTLRTWGMVTYKEAAILKNHFMIRKRFIALPQWHHN........YTAINELYESSKFIKNSLYVQKLSQEHIDSITLQFYSLITGPLVEGP-DFFPSPPNILLANCLDAAKVMPHHKMLISEVIWP............SMEP...KDWIDAEFNAFYNI......TG..-KTLNSVQQC-a............
Q806A0_CHV1/85-743               ....................a-RQKLLALFGQVQTYVFQLELLRRCDPRI..GR..GKLAALKLNALQVRAVRRRLRPGLAAQA.RAFLTPLSVTLELLLEYAQREGERLLGCLEAFGe...ggE...EGD.........VAAFFVESM...GLA..RPCPYHQPIRLETYG.GC-VDMELCFLHDVENFLKQLNYCHLITPPRGAIAALERVRAFLVGAVGSGLVVPPEISDPSH.PCAVCFEELCVTANQGATIARRLADRICNHVTQQA...QVRLDDNELRRYLPHASGFSEAARA...RALRVLDQ.....................ALERAAAGEAQgrap..........adesARREADALLEAHDVFQ.ATTPGLYAISELRFWLASGDRA.............hQSTMDAFADNLTELARREL.RHETAVAAV.ELALFGRRAEHFERAFGD.RLAa........ldMVDALLVGGQATSPEDQIEALIRACYDHHLTTPLLRRLVNPEQSDEEALRRVLARLG......................................GGRRDA.G.EGEDGa...................................................agE.-AGEGAAAPEAGRGDGREDG............................................pESWADVAGRAAADVRERRRLYADRLTKRSLASLGRCVREQRGELEKMLRVSVHGEVLPATFAAVSNGFAARVRFCDLTAAA-Gtv....vdNRAAPGVFDAHRFMRASLLRHHVDPALLPSITHRFFELVNGPLFDHATHSLAQPPNTALYYSVENVGLLPHLKEELARFIMG............AGGA..gTEWAVSEFQKFYSF......DG..ISGITPTQRAA.............
C8CFA5_HCMV/5-695                ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpegeaihlrgreamsgtgttlmtasnsS-----.-.----Nssthsqrn.....................................nggggrargG.GKKAVGGGANGQDGDGSENGlrvrncd...............................ehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGDQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
Q8JYD4_9GAMA/1-595               .....................MTQYLAALYSQIYGVCLDVSILEYCDPSA..--..VDKCTLLKIKNKIEDIYDTVFDYLILQN.RSDSSCLSLELEHLLVNVRDRLHVILGALGD--......-...---.........SKQYFSRLH...-LE..HKCNFHETINIHFYN.GCSVEVKLNLINDVEVFLKKLNSVFYCITSEKAILCLQNVLHFLRKLRGISPVAPPDCYTSSL.PCLECFKEITMIPNQGKSIQEMLVNFDCPHICRPLnsePVQGLFENELKHAGVNVTFDMKE--...--------.....................CPTDEAPTRK-..................IMEESLKCLEDHNIFT.DIPKQIWEISNLIYWNSAEQQ-..............TTDKHCQCSQLTKILQRNA.KMNRYRRIL.------FKDNHFFDTYAP.Q--...........SIELLFCGSLYSSTDDVIRALKCDCSATFMEQPKFQSMFHKRNELFTRLSNLLYENT......................................SNGVDE.N.TTSGR......................................................-.---NIDVIRIEGMKESSNE-.............................................--------QILEEARLRKEAYLHKVSKDGMKKLQACLDSHSSILKNMLTLRVWGSTIYKEASLVLNHFLFRQKWLSDAIWM--........TDGENSLFENCKFIKNSLYATNLSREHLDKLKHLFYSLINGPLTSTD-DLFPIPQNVKLAHCLDSVNAMPHHKMMLVNMIHC............QLEP...KDWIDLKFNNFYTI......TQ..-HGLNNIQYEC.............
TRM1_HHV7J/3-611                 ....................s-LQSLCVLCSRLSECALELECLRFCDPVT..LI..PDMTNFRKNGVVIIHLFKTLFAELCHQN.FNCASPVTIYLQILLKAMYNQVLLLDASIHQFL......L...DND.........KQKYFENIF...QLN..-ECKQHLKLDLALNN.YLTFSVDISTINDIEKLLCKMNCIFGLISPLDGINACSQIIEFLTILCGVCVVMKPEVFSETT.TCLKCYEELSLVPNQGKSIRKRLAGKFCNHLTET-...HMVSNLEKNVDIIEKDLDFSTKQYGlvkEYMAKITN.....................IFQQQLYSKPP..................HLQEAENTLINFDLFS.KIPDTIYSLSEFTYWSKIS---..............ESVIQKASITLNQLNLCHS.LYADLQNEI.SKFLYGETIQDVFNFNEE.NVT...........NDDKLYIGSRFISPCRLVDIITNVSIKNLEEDPVFTKL-AEEDEIQTKIKTLLNELE......................................NSAHET.V.PKKYV......................................................-.---------T----------.............................................-HSMTQDHNLQQEIHIRKKAYYQKISESGYSKVMLCIKEQEALINKLMNINILGNHIFESLSKMMNAFANRQLQSLEN-----........FSADPFTYDDHLYIKNNLLSKKLPQELLPNLSQEMYRLLTGPLSNYHTASFPLSSNISMAYACDVADFLPHMKEDLAKCVEG............TIYP...ENWMLCTYNKFFNF......DG..LHNINDMQRQM.............
H2A1B9_MUHV1/5-660               ....................t-LQKLCVVCSKCNECAMDVECLKYCDPNI..VS..MDSTAFRRNGVMVIHLYRTLYPALVSQN.AVQTSVLTLYMEMLLQGLYDTMREIDMALTDFG......T...HRD.........RQRYYRRVL...KLD..-SCNRHESITITFAP.ELALTIDLATLNDVERLLCKINCVYGAVDASQGVAVCRRLLSLLARLCDICPVAGPEIYRETV.TCFQCYEELMAVPNQGRSINRRMQGLLCDHITIK-...KVLVQLDMDAQTVEQDMGDIAIRAPsvkGIIRAIKS.....................LASFSPASYA-..................YINDAEEALRGYNLFS.EIPDRIYSLSDYTYWSKTS---..............EAIVRHVGITMRQLNVSHS.LWKTLRTEL.SRYHYGEDLEDVFTLGEG.RFG...........GDERIYVGSIFAAPGKVVDMITSMSIKSFENNPLFNRL-HESNEIYAKIKSLIEEIRgvgdgpa.......................agaaasraE-----.-.----Aasgaga.........................................ggeegagA.---AAGRGN----------Tggdegagtt...........................tamssalecGDPLLRVHDVNKEVNVRKRAYLKKVSEMGYNKVMACIRNQEHLVTKLVNVNLVGTVCLEAVSKIMNGFLSRQRSITEAETYP-........DVAESLGYDEHLYVINNLVHKRLPSELLPQLGQQIYRFINGPMFTHYLDRHPLPYNVNMAYACDNAGILPHVKEDLVRCADG............TVVP...SDWMTVGYMGFFRF......AD..IRELNDLQKMV.............
O41929_MHV68/1-572               .....................MSKEVAVLYAQIYGLCMDLSLVPYMDPSS..--..LNLRSISNNYHKLCQIQKIIGGQLLENN.TQTPCALTLELEHLLCNAVELCKSVLS------......-...---.........HENTYDHVL...-CS..KQCVLDVSCLACFYG.GDTVDIPLDTINKIDMLFKKLNVTFYCTSFHQTLPLLRNVFAQLGKFRGVSPIPSPGIYDICQ.PCIQCLQQVEYLPNQGLSKDTLLRKTICNHVFPMVppePIDFAQVEESPC-------------...--------.....................AVSKPLEHDK-..................AVLARPQAMVEYNVFS.EPTSDVLQLSNLLYWTSCEQL-..............TTSSNIHCSNLSNIYTREN.KLLNASKQV.-----GSLCHRSLRKYTP.S--...........PFELLFTGGLVTEHSKIVAALKDDCTSSFLKKTNYADSLKHKNEMFASLQSLLTGSQ......................................PSQKLT.Q.ENAPQ......................................................-.--------------QKNPE-.............................................-------KGFAYDAHKRKEAYFKKLADEGLKRLTNSLDTNIGNLEKLLGIRIWGQSVYAELAKLLNHFLIRKFLVQNATST--........DWTVEEAREKSQFIKSILYGHSINREHIQSLGSVYYKLLNGPLIKER-GLFKLPINILLAQSLDAAEVLPHQKIAMCFDVTN............LKSP...KDWIDVQFNQFYNF......LP..NTHLAGVQEQA.............
TRM1_ALHV1/1-596                 .....................MGQYLAALYSQIYGLCLDVSLVEFCKPTS..--..LCLTKIADACNKVHKIHEYVSASLLQQN.SLEACALSLELSHLLENLKTRLFFIYHALLD--......-...---.........NPTYFSKLH...SSV..GLCDLHKKLNVQFYN.ECGIEVNLTLINDIERFLSRLNCVFYCLSSSSALLALKEALTFLGQLRGISPVPRTDIYITSS.SCLECVLETSVVPNQGETLNELLLNHNCHHLVERVppePIKGLFESELQNLGLKVHIATDT--...--------.....................IEQSVGKHEA-..................VLQESLAYLKAHTIFN.NTPKQVLELSNLLYWNSGQNQ-..............PSDSGVKCSELSKIWSREN.ELQKYRPKL.---NNGEPPGHFFDLHSP.Q--...........GTELLFCGGIFSSTHDTITALKQDCSNTFMKQTRLTGVAKRQNELFMRLSNILYGEE......................................VPTKPK.Q.TESAL......................................................-.--------KTCDQSDASKN-.............................................--------QVLQEAELRKEAYLNKLSKEGFRKLQACLSTHEEMLNSQLSLKIWGSVVYKQSATLLNHFLFRQSWVTQASLPPS........VNGSPEQFENSKFIKSSLYVKSLSREYLSTLRLHFFALITGPLTTQE-GLFPSPPNVQLAHCLEAAHFMPHQKMLLNEMIKP............TMEP...QDWICSNFNEFYTI......HE..-TDLNGVQYEC.............
A1BLZ9_9GAMA/1-598               .....................MSQYMAALYSQIYGLCLDVSLLEYCDPSS..--..LHVGNIADTCNKVHRICDIVLSPLLEQN.RQEACALSLELSHLLINLRARLLYIYQALLD--......-...---.........PSSYFSKLH...STV..RLCNLHKRIAVNFYN.KCSVDINLTLLNDVEQFLSRLNCVFYCLSASDALQAMEGILEFVQHLRGISPIPPTNLYIVSS.PCLECLTETSVLPNRGETVKEMMVNHHCYHLVQQVppePIQGLFESELRHLGASIDFASTT--...--------.....................SEASHSEQGA-..................LLQESLAYLKDHTIFN.STSKQILELSNLIYWNASQQQ-..............PGEADVKCSELSKILQRET.DLHKYRAFC.---SQNRALTHYFDLYRP.S--...........HIEILFCAGVFSSTDDTIGALKKDCSNTFMKQSKLASLTKKQNELFNRLSCILYGGA......................................AAPSPQ.D.KPETS......................................................-.------ALQACSKFDASKN-.............................................--------QVLQEAAVRKDAYLNKLSKEGFKRLQECLHLHEEVLNSQLSLKIWGSALYKHYASLLNHFLFRQRWVASAELPPS........VNRSXEQFENSKFVKNSLFATNLSREHLSTLRLQFFSLINGPLTSHK-GLFPVPQNVQLAYCLDAANFMPHQKMLLNDMIKA............SMEP...RDWICSNFNEFYTI......YE..-TDLNSIQYEC.............
Q69374_ILTV/1-180                .....................-----------------------------..--..----------------------------.---------------------------------......-...---.........---------...---..---------------.---------------------------------------------------------------.-----------------------------------...-------------------------...--------.....................-----------..................----------------.----------------------..............-------------------.---------.------------------.---...........---------------------------------------------------------......................................------.-.-----......................................................-.--------------------.............................................-----------------------KLSARSFSNLDRCIKIQRAELEKLMRVNIYGETLPVMYVTLKNAFLARRAFLDIVCAEESlhskilriDQNDGRAYDWHQYIRSSITRYQIDQTMLPRLTNRFFEILSGPLFKHHKERFPQPPNTSIYFSVENVGLLPHLKEELANFTKR............HRSC...-DWMTSEFRRFYNF......AG..ISNSTAIQRAA.............
B9VXM5_HCMVT/5-695               ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpegeaihlrgreamsgtgttlmtasnsS-----.-.----Nssthsqrn.....................................nggggrargG.GKKAVGGGANGQDGDGSENGlrvrncd...............................ehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGDQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
O39232_9GAMA/1-78                .....................-----------------------------..--..----------------------------.---------------------------------......-...---.........---------...---..---------------.---------------------------------------------------------------.-----------------------------------...-------------------------...--------.....................-----------..................----------------.----------------------..............-------------------.---------.------------------.---...........---------------------------------------------------------......................................------.-.-----......................................................-.--------------------.............................................-----------------------------------------------------------------------------------........---------------------------------QFYGLITGPLTRQS-DLFPGPANVVLAQCFEAAGMLPHHKMLVSEMIWP............QIQP...KDWIDQTFNRFYQL......PE..-GDLNAVQKSA.............
TRM1_HHV6U/3-612                 ....................s-LQSLCVLCARLNECALDLECLKFCDPVI..VL..SDMANFKKNGIVILHLYQTFFEGIKEQN.LLCASALTVYMQVLLKAMYEQVLLLDAALESFM......V...DQD.........RKKYFEKVL...CLR..-RCAETLSINISLNN.GVEFIVQLSTLNDIEQLISKINSVYALLLPQEGLQICGKIIDLLTIMCGACMVAKPESYLETK.TCMKCYEELTLTPNQGKSLRRRLHGKFCNHLTEQ-...KAFFNIEKNIETIEKDLGEAILNYGtvqSVATEIKK.....................IFKQQRSAESL..................HVSDAEKTLKKYNIFS.KVPDVIYSLSEFTYWSKIS---..............ETIVRNVAITLQQLNSCHT.LYKQLQNDV.SLYLYGEVSEDFLALSEN.LLT...........HDERLYVGSIYVSPSRLIDLVTGLSIKNLEESPIFKRL-AEEDEVQHKIKSLLHDIR......................................DPQTTE.T.PGRLN......................................................-.-------------------T.............................................INCMLQTHNLQQEVLARKKAYFQKVSESGYNRVMACIREQESLINKVVSVNVYGNFIFEALSKIMNGFVLRKMYLDGS-----........FRVDSCTYDEHLYIKNNLMPKKLPLELLPDLSEIMYTLLTGPLSDFHKSAYPLPANISMAYGCDHAEMLPHMKEDLARCIEG............TIHP...SVWMVCEYNEFFNF......SG..VTDVNDMQKKM.............
G8XUD2_9BETA/3-640               ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNI..LL..AESSPFKRNAVAITRLYRRIYPELVKQN.HVQTSLLSLYMEVSLQALYEDTEILDRALKKYS......Q...NLD.........RMEYYRTIL...RLD..-SCERHHVVELKFTD.GVKCSVQLGTLNEVERFLCKMNCVYAMLSPEHGLEVCSQLLRLLRCLCGISPVACPEVYADEV.TCAHCYEELTVVPNQGRSLNKRLQGLLCNHIAVH-...RPSTQSDINIQTVEQDLAEYVPRIPklaGLVGTIKS.....................LFSSSSVSHS-..................YIHEAEEALKEYNLFT.DIPERIYSLSDFTYWSRTS---..............EMLVKRVDTTINQLNMYHS.LCRLLMNEL.SRYMYGEEVVDIFVLGEK.ELS...........GEERLFVGSIFAAPNKIIDLITSMSIQAFEDNPAFNKL-HANNEMYSKIKSLLEEIR......................................RPAEDE.A.VEKRMggp................................................dseE.DEEAAAAAVEEADSNRALEY.............................................GDPRVLMHNITREVNVRKRAYLQKVSEAGYNKVIACIKTQEKLTNKLIDVNLVGTTCLDFMSKMMNGFIERNKYKDDAN-V-R........DVCESLTYDEHLYVVNNLIHKKLPVESLPSLGQQIYRLCSGPLFTHCQDRYPMSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TINP...HEWMTVKYMCFFNF......DH..CDDLNALQKEM.............
G3G952_9ALPH/2-638               ....................a-ERRLVAVLGQVQTYVFQLEMLKRCDPAV..VR..ELAPRVKLNALMCRYLARRL--PLEAQ-.---TTPLTCALRLALAYARAEGDRVLGALAA--......A...GDD.........AEAYFERTM...G--..GACRFHARVALDTYG.GR-VETELQFLHDAENLLKQLNYCHLITPHAVD---LSAVDEFLARTIGGGLVVPPELYDPAQ.PCAVCFEELCVTANQGEATHRRLLGCVCDHLTRQL...AVRVDPEDVAKNLPHVHGLDEARRG...RALAALAA.....................VDAAEAREAEAastaaaga..eagdagetARRRADALLDAHDVFR.PASRRLYAVSELQFWLASTNQA..............VRALDLFTHNLDDLERRER.RAEVRAAAV.ELALFGRRPEHFDRARAArELD...........IIDGLLVGGCAASPDERLEALIRACYDHHMSTPMLRML-DPDRANRDALERLLEGGD......................................DADADG.G.AAGGA......................................................D.AGDGGVGDEDGPGAPPPADA.............................................VAWADLPAAALRDAERRRRLYADRLSRRSAASLAQCVREQRRELEKTLRVNVYGDALLHTYVAVAAGFRARRAFCEAA-ARAGt.....vvDERETGCFDAHSFMKATVQRHPVDAALLPALTHKFFELVNGPLFAHDTHAFAQPPNTALYFAVENVGLLPHLKEELARFMVA............R---...-DWCVSEFRGFYRF......QT..-AGVTATQRQA.............
F0J884_9BETA/3-635               ....................l-LQKLCVVCSKCNEYAMELECLKYCDPSV..LL..VESSPFKRNAAAIGYLYRKVYPEVVQQN.RTQTSLLTLYMEMILKALYEDTELLERALMAYS......R...RPD.........RMEYYRTVL...RLD..-RCDHHHTVELTFTE.NVKFSVALGTLNDIERFLCKMNYVYAILSPETGMEVCSQLLQLLRRLCGISPVARQEAYVEGT.TCAQCYEELTIVPNQGRSLNKRLQGLLCNHIAVY-...RPSSQCDVNIQTVEQDLSELKERIPslpGVLSALRN.....................LFSSSSGYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHH.LCRALMNAI.SRHLYGEDVEDIFVVGER.LLL...........GEERLFVGSVFAAPSRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKRILEEIR......................................RPVADG.K.TEAML......................................................ArGQEPVTSSSSTSDDDGPLEC.............................................RDARSRMHNVTREINVRKRAYLQKVSEVGYGKVIRCIKSQERLTSKLIDVNLIGTVCLDFMSKLMNGFIYRTQYNHDE-NIT-........DVCNVFTYDEHLYVVNNLVHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVHP...SEWMVVKYMGFFNF......ND..CEDLNALQKEM.............
Q80BQ7_SHV2/1-592                .....................MAQHLAAVYSQIYGLTLDVSILTFVDPAH..--..INWRTVTKNTEKINKIYLQIMPLLHNQN.NIESTSLSVELQHLLHNLKIVLDTFSAHLSD--......-...---.........YNTYFDNIH...SLS..APCSRHKSIVFQFYN.NCCVSVKMCIINDIEIFLKRLSSVFYCIRSCDALRGINHVIDFLGHLRGVSPIPLPDTYLSNI.PCIYCLNEHMMLPNQGESLQSLMMSVNCKHVCKQLnpePIQGMFENELLQRHIIVESSKQK--...--------.....................EHTQTCSIDNQ..................IRDASLSKLNQHTIFE.NISAPVLELSNLIYWSSGAHK-..............KCANIENTSEMAKLLSYEA.KMQNYRKYI.-----CKNSIHFFDKYKP.Y--...........PIESIFCGGIFSSVDDTVKSLKSDCSLAFMKRANYQQLIKKQNELFVRLNKILQGED......................................AVCHAA.S.AVPLS......................................................-.----------DKAAIVNPD-.............................................--------QVLHDAHARKDAYLQKVTKDGLKSLYTCLETQGAVLSNTLSMRVWGGAVYDEIVKLKNHFLFRDQFISLN-WIHC........EADSVSGFENSKYIKNLIYSQKLSSEHISSLTLQFYKLITGPLSQNV-SFFPLPLNIALAHCLDAAGALPHHKLLITEMIWP............SIEP...KDWVSQTYNKFYTI......TS..-TDLNSIQKEV.............
D3YRZ5_HCMVO/5-695               ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpegeaihlrgreamsgtgttlmtasnsS-----.-.----Nssthsqrn.....................................nggggrargG.-------------------Gkkvvgggvngqdgdgs............englrvrncdehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGDQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
A7X7K2_9BETA/3-642               ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LA..AESSPFKRNALAIAYLYRKIYPEVVRQN.RTQTSLLTLYMEMILKALYEDTELLDRALKAYC......R...RPD.........RMEYYRTIL...RLD..-RCDRHHTVELTFTE.TVKFSVTLATLNDIERFLCKMNYVYAILAPETGLEVCSQLLQLLRRLCGVSPVACQEAYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIVVH-...RPSSQCDVNIQTVEQDLLDLTPRIPslpGVLTALKN.....................LFSSSSVYHS-..................YIQEAEEALREYNLFT.DIPARIYSLSDFTYWSRTS---..............EVIVKRVGISIQQLNVYHH.LCRVLMNSL.SNHLYGEDVEDIFVVGEK.LLS...........REERLFVGSVFAAPSRIIDLITSLSIQAFEGNPVFNKL-HESNEMYTKIKCILEEIR......................................RPVPDG.A.AGEAG......................................................A.GSASRGQDRPNTSNNSDAQNeddd.....................................fldwRDARTRMHNVTREVNMRKRAYLQKVSEVGYAKVIRCIKSQERLTSKLIDVNLIGTVCLDFISKLMNGFIYRTQYLDNPDLV--........DVAQLLSYDEHLYVVNNIIHKSLPAESLPLLGQQIYQLCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHIKDDLVKCAEG............TVYP...SEWMVVKYQGFFNF......SD..CQDLNMLQKEM.............
F5HC79_HCMVM/5-695               ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpegevihlrgreamsgtgttlmtasnsS-----.-.----Nssthsqrn.....................................nggggrargG.GKKAVGGGANGQDGDGSENGlrvrncd...............................ehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGNQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
O40914_HHV8/1-607                .....................MAKELAAVYADVSALAMDLCLLSYADPAT..--..LDTKSLALTTGKFQSLHGTLLPLLRRQN.AHECSGLSLELEHLLENVADALATLGVCT---S......R...KLS.........PEEHFSLLH...-LD..TTCNKHRSVRFNFYG.NWALELKLSLINDVEIFFKRLSSVFYCIGSGSALEGLGEVLRFVGKLRGISPVPGPDLYVSNL.PCLECLQEVCLTPNQGTSLQAMLPDTACSHICTPAcgePVRGLFENELKQLGLQTPESIPTTP...--------.....................CQSRVRQDDE-..................IRQSSLMAVGDHHIFG.EVTRSVLEISNLIYWSSGHSDA..............TCDGDRDCSHLASLFTHEA.DMHKRRVDLaGCLGERGTPKHFFDCFRP.D--...........SLETLFCGGLFSSVEDTIESLQKDCSSAFYQQVNYTTALQKQNEFYVRLSKLLAAGQ......................................LNLGKC.S.TESCP......................................................-.-----SEARRQLVGGGKPE-.............................................--------EVLRDAKHRQELYLQKVARDGFKKLSDCIRHQGHILSQTLGLRLWGSVIYNEASALQNHFLHRAQFISLP-WQDL........TVDCPTRFENSKYIKNSLYCQRLGREHVEILTLEFYKLITGPLSKRH-TLFPSPPNVTLAQCFEAAGMLPHQKMMVSEMIWP............SIEP...KDWIEPNFNQFYSF......EN..-QDINHLQKRA.............
G8H194_9BETA/3-643               ....................l-LQKLCVVCSKCNEYAMELECLKYCDPSV..LL..AESSPFKKNALAIAYLYRRIYPELVRQN.RTQTSLLSLYMEMILKALYEDTELLDRALKAYS......R...RQD.........RAEYYRTVL...RLD..-RCDRHHTVELTFTD.NVKFSVTLATLNDIERFLCKMNYVYAILSPESGLEVCSQLLQLLRRLCGVSPVACQEAYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIVVH-...RPSSQCDVNIQTVEQDLTELTQRIPslsGVLTALKN.....................LFSSSSVYHS-..................YIQEAEEALREYNLFT.DIPARIYSLSDFTYWSRTS---..............EVIVKRVGISMQQLNVYHH.LCRVLMNVL.SRYLYGEDVEDIFVLGEK.LLS...........REQRLFVGSVFAAPSRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKCLLDEIR......................................RPVPDG.G.AAVAEgvg................................................aaiR.GQDPQNTSSN---------Ggppded.................................nefldyMDARTRIHNVTREVNIRKRAYLQKVSEVGYAKVIRCIKSQERLTSKLIDVNLIGTVCLDFISRLMNGFIYRTRYRDNPDV--V........DVSQVLSYDEHLYVVNNIIHKSLPVESLPLLGQQIYQLCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHIKDDLVKCAEG............TVYP...SEWMVVKYQGFFDF......SS..CGDLNMLQKEM.............
F8RG58_HHV1/11-682               ....................a-RQKLLALLGQVQTYVFQIELLRRCDPHI..GR..GKLPQLKLNALQVRALRRRLRPGLEAQA.GAFLTPLSVTLELLLEYAWREGERLLGSLETFA......T...AGD.........VAAFFTETM...GLA..RPCPYHQRVRLDTYG.GT-VHMELCFLHDVENFLKQLNYCHLITPSRGATAALERVREFMVGAVGSGLIVPPELSDPSH.PCAVCFEELCVTANQGATIARRLADRICNHVTQQA...QVRLDANELRRYLPHAAGLSDADRA...RALSVLDH.....................ALARTAGGDGQphps.........pendsVRKEADALLEAHDVFQ.ATTPGLYAISELRFWLASGDRA.............gQTTMDAFASNLTALARREL.QQETAAVAV.ELALFGRRAEHFDRAFGS.HLAa........ldMVDALIIGGQATSPDDQIEALIRACYDHHLTTPLLRRLVSPEQCDEEALRRVLARMG......................................AGGAAD.A.PKGGAgpdddgdrva.................................veegarglgapG.-------------------Gggededrr.............................rgpggqgpETWGDIATQAAADVRERRRLYADRLTKRSLASLGRCVREQRGELEKMLRVSVHGEVLPATFAAVANGFAARARFCALT-AGAGtv....idNRSAPGVFDAHRFMRASLLRHQVDPALLPSITHRFFELVNGPLFDHSTHSFAQPPNTALYYSVENVGLLPHLKEELARFIMV............AGGS..gADWAVSEFQRFYCF......DG..ISGITPTQRAA.............
H8ZRN0_ILTV/5-673                ..................tql---RLMALAGQLQTLLFQIDILKRCDPEI..LLqkRLRSRIKHNALMALYIHSLLSNELSMQV.NYRLTLQTYCVWLWLRRACSEIAALCNEIDKYS......V...LKD.........RKCFFEATL...GYGkgFICPLHAEVQLQLYGmSSIISKELVLINDVENFMKQLNYCHCVVSCKNAIEALNTIDEFLVLSSGGSLVAAPDTYDHGQ.PCYVCLEELSVTANQGETIYRRLGYKICDHLTRQF...PVNVSTDDLKRHLPFLRDVDPEKLK...NVLSNETR.....................IEAENHVEAGRtls............sspGESEASKILNKYDVFT.EPPGPVYQLSELQYWLASGKRTpsgve...sqtttsQSVLKQLDKDLSELFKRAE.DFEQECIRL.ERTLFEKVHAHFHRVAQA.ELIsp......qhsLVDTLITGVLATSPDTEIAALIKACYDHHLSLPLFRRLRNPEKVDTDALEELVEKLR......................................GSDKET.Q.PVTEG......................................................T.STSDLTANLRGTIERDEDS-.............................................--IEVLLKKAERDLDVRQKNYVEKLSARSFSNLDRCIKIQRAELEKLMRVNIYGETLPVMYVTLKNAFLARRAFLDIVCAEESlhskilriDQNDGRAYDWHQYIRSSITRYQIDQTMLPRLTNRFFEILSGPLFKHHKERFPQPPNTSIYFSVENVGLLPHLKEELANFTKR............HRSC...-DWMTSEFRRFYNF......AG..ISNSTAIQRAA.............
Q9WT24_HHV6H/3-612               ....................s-LQSLCVLCARLNECALDLECLKFCDPVI..VL..SDMANFKKNGIVILHLYQTFFEGIKEQN.LLCASALTVYMQVLLKAMYEQVLLLDAALESFM......V...DQD.........RKKYFEKVL...CLK..-RCAEHLSINISLNN.GVEFIVQLSTLNDIEQLISKINSVYALLLPQEGLQICGKIIDLLTIMCGACMVAKPESYLETK.TCMKCYEELTLTPNQGKSLRKRLHGKFCNHLTEQ-...KAFFNIEKNIETIEKDLGEAILNYGtiqSVVTEIKK.....................IFKQQRSAESL..................HVSDAEKTLKKYNIFS.KVPDVIYSLSEFTYWSKIS---..............ETIVRNVAITLQQLNSCHT.LYKQLQNDV.SLYLYGEVSEDFLALSEN.LLT...........HDERLYVGSIYVSPSRLIDLVTGLSIKNLEESPIFKRL-AEEDEVQHKIKSLLHDIR......................................DPQTTE.T.PGRLN......................................................-.-------------------T.............................................INCMLQTHNLQQEVLARKKAYFQKVSESGYNRVMACIREQESLINKVVSVNVYGNFIFEALSKIMNGFVLRKMYLDGS-----........LRVDSCTYDEHLYIKNNLMPKKLPLELLPDLSEIMYTLLTGPLSDFHKSAYPLPANISMAYGCDHAEMLPHMKEDLAKCIEG............TIHP...RVWMVCEYNEFFNF......SG..VTDVNDMQKKM.............
PRTP_PSHV1/39-768                .....................TTRRLLAVAGQLQTLLFQIELLKRCDPEVlvKR..ALRAKIKHNALMVLYLHSRLAGDLAAQA.AHRLTVGIYCLWMWLRRACSEAAALANEIDTYA......T...YRD.........KDRFFSATM...NLSpgGTCRLHSLVGLSLYGrTQDVTRELGLINDAENLLKQINYCHLIVSTESAEAALVGVDEFLTATVGGGMVASPETYDHTQ.PCCICLDELSVTANQGDTIYKRLGYSVCDHLVKQV...KVNVTPDDVLRHMPFLNSVDANTLR...GAIDKLRGssggevgggrrlagvvptgcrAEVGRSEQEDGapagd.......dradleHEARASRILDSYDVFT.EAPGPVYRLSELRYWLASGKAAgaktrgscahathqATVLQKLDTDLSAMFARAE.TFERECRSA.EREIFGTSFAHFHRHVAS.KIAsvrgvggggeaLIDKLLAGSPATAPEAEIETLISSCYSHHMSLPLFSRLGNPEKADTDALVEILKSYR......................................DQTRPR.A.DKAGGraedgag.......................................dcddegypG.AADATRRGQRDWIGRVRVDTaava.....................................deheDKVKKLLDRAERDLTTRRKNYAERLSARSFSNLDRCVKNQRAELEKLLRVNVYGAALPAMYVELKNGFLARQAFMKAVTSDESqhirrcrlAREDVEGYEQHQYVRSALMRTSLDPAALPHLASRFYELVSGPMFRRHVERFPQPPNTSLYFTVENVGLLPHLKEELASFTRT............YAHA...-EWMVSEFREFYDF......SG..ISGVSETQRAA.............
TRM1_TUHV2/3-652                 ....................t-LQRLCVVCSKCNECAMELECLKYCDPAI..VL..VDSAPFKRNALTVVHLYRRLCPALAEQNaRYQASLITLYLEMLLRCLYEDVLLVDEALGEFE......R...HGD.........RQRYYRRVL...RLD..-RCACHDTLEVTFTE.RIRLTVDVATLNEVERLLCKINCVYGVLEPTRGLELCRRLLSLMGRLCGISPVAAPEAYVENL.TCLQCYEELAAVPNQGRSILKRLRGLLCDHLTVR-...KSLVQLETGIQTMEQDIVETVGSRPrlsSLLELLKG.....................LSSSAAVSHA-..................YISEAEDTLRRYNLFT.DIPPRIYSLSDFTYWSKTS---..............EVIVQRVNVTVQQLNMYHS.LCRTLRNEL.GQYLYGDRVEDLFTLSEA.QLG...........EDERLYVGSIYAAPERIVDLMTSLSLQSFENNPVFNKL-HENNEIYSKIRSLLEEIRrpld.............................gagtrGAAAAT.A.AGARG......................................................A.AEGTGGAAAAG--------Gaaaaage..............................aaggpfqcGDPAARAHDVVREVHVRKKAYLQKVSELGYNRVMQCIKGQEKLIKKLVNVNLLGTVCFEVLAKVINGFIRRRAYLERVDGVV-........DVDRLLQYDDHLYVVNNLVHRRLPAESLPALGQEFYRFVNGPVFQHHADRYPLPYNIDMAYACDNAGMLPHLKEDLVRLAEG............TVAP...SEWMVAPYRRFFDL......GA..ALDLNELQK--gf...........
Q69093_HHV2/1-76                 .....................-----------------------------..--..----------------------------.---------------------------------......-...---.........---------...---..---------------.---------------------------------------------------------------.-----------------------------------...-------------------------...--------.....................-----------..................----------------.----------------------..............-------------------.---------.------------------.---...........---------------------------------------------------------......................................------.-.-----......................................................-.--------------------.............................................-----------------------------------------------------------------------------------........--------------------------------------VNGPLFDHSTHSFAQPPNTALYYSVENVGLLPHLKEELARFIMG............AGGS..gADWAVSEFQKFYCF......DG..VSGITPTQRAA.............
Q9DGW3_MEHV1/18-677              ....................a-RQKLLAVWGQIQSYLFQIEILKRCDPVV..GM..RMINRLKLNVLMIRYLEKKLLPGWKEQE.DISITPITYGVWSAIRRARLEGEVLLSALCDYV......V...EGN.........TRNFFVKSM...SLQ..GVCPYHVVAELDTYG.GP-VTTEIKFLHDVENVLKQLNYCHLIINSRSVGRFMASIDKYLLKTLGSGSIVPPELYDPSQ.PCSVCFEELCVTANSGDSAHKRIVGKMCDHVTKQM...ILRVDPDDMVAHLPHATYILPDKLA...VATTALNH.....................INNPNINDTVStnv...........spdsVSQAAMVALDAHNVFL.PASGDLYAISELQFWTASSGRKas.........hpqGNTIDSFADNLEQVVAKER.LFDLRSSVI.ETALFDKRMNHFERIFSD.EIEq........mnTADRLLLGGRTAAPDDIIEALIKACYDHHLSAPLLKRLLYPDEAAHDALKSTLETLT......................................SRSVRQ.D.SAPKT......................................................S.ESTGDTTQVTPRDAHRSLSDar.........................................gdVEWLELVRAASADAARRRKMYAERLTKRSLASLDKCITEQRKELEKILRVNVYGEVLIDSYVAIFNGFRSRRGLLEAVQTRFAnv....idNRRGDEAFDAYRFMQTALLKHKIDPAMLPSLTHKFFQLVNGPLFNHDVHRFAQPSNTALYFSVENVGLLPHLKEEMARFMLQ............CNNT...SSWIISKFRGFYDF......GG..VDNITTAHRMA.............
Q2F7U7_HCMV/5-695                ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpeg..........eaihlrgreamsetG-----.-.----Ttlttasnssnssi...........................hnqrnngvggrargG.-------------------Gkkvvgggvngqdgdgs............englrvrncdehealdlVDARSCIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGDQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
Q2VSN0_9GAMA/1-598               .....................MSQYMAALYSQIYGLCLDVSLLEYCDPSS..--..LHVGNIADTCNKVHRICDIVLSPLLEQN.RQEACALSLELSHLLINLRARLLYIYQALLD--......-...---.........PSSYFSKLH...STV..RLCNLHKRIAVNFYN.KCSVDINLTLLNDVEQFLSRLNCVFYCLSASDALQAMEGILEFVQHLRGISPIPPTNLYIVSS.PCLECLTETSVLPNRGETVKEMMVNHHCYHLVQQVppePIQGLFESELRHLGASIDFASTT--...--------.....................SEASHSEQGA-..................LLQESLAYLKDHTIFN.STSKQILELSNLIYWNASQQQ-..............PGEADVKCSELSKILQRET.DLHKYRAFC.---SQNRALTHYFDLYRP.S--...........HIEILFCAGVFSSTDDTIGALKKDCSNTFMKQSKLASLTKKQNELFNRLSCILYGGA......................................AAPSPQ.D.KPETS......................................................-.------ALQACSKFDASKN-.............................................--------QVLQEAAVRKDAYLNKLSKEGFKRLQECLHLHEEVLNSQLSLKIWGSALYKHYASLLNHFLFRQRWVASAELPPS........VNRSAEQFENSKFVKNSLFATNLSREHLSTLRLQFFSLINGPLTSHR-GLFPVPQNVQLAYCLDAANFMPHQKMLLNDMIKA............SMEP...RDWICSNFNEFYTI......YE..-TDLNSIQYEC.............
TRM1_SHV21/1-592                 .....................MAQHLAAVYSQIYGLTLDVSILTFVDPAH..--..INWKTVTKNTEKINKIYLQIMPLLHNQN.NIESTSLSVELQHLLHNLKIVLETFSAHLSD--......-...---.........YNMYFENIH...SLS..APCSRHKSIVFQFYN.NCCVSVKMCIINDIEIFSKRLSSVFYCIRSCDALRGINHVIDFLGHLRGVSPIPLPDTYLSNI.PCIYCLNEHMMLPNQGESLPSLMMCVNCKHVCKQLnpePIQGMFENELLQRHIIVESNKQK--...--------.....................EQNQTCSIDNQ..................IRDASLSKLNQHTIFE.NISAPVLELSNLIYWSSGAHK-..............KCANVENTSEMAKLLSYEA.KMQNYRKYI.-----CKNSTHFFDKYKP.Y--...........PIESIFCGGIFSSVDDTVKSLKSDCSLAFMKRANYQQLIKKQNELFVRLNKILQGED......................................TVSHAA.S.AVPLS......................................................-.----------DKATIVNPD-.............................................--------QVLHDAHARKDAYLQKVTKDGLKSLYTCLETQGAVLSNTLSMRVWGGAVYDEIVKLKNHFLFRDQFISLD-WIHC........ETDSVTGFENSKYIKNLIYSQKLSSEHISSLTLQFYKLITGPLSQNV-SFFPLPSNIALAHCLDAAGALPHHKLLLTEMIWP............SIEP...KDWVSQTYNKFYTI......TS..-TDLNSIQKEA.............
Q8V6I6_9BETA/1-82                ....................g-----------------------------..--..----------------------------.---------------------------------......-...---.........---------...---..---------------.---------------------------------------------------------------.-----------------------------------...-------------------------...--------.....................-----------..................----------------.----------------------..............-------------------.---------.------------------.---...........---------------------------------------------------------......................................------.-.-----......................................................-.--------------------.............................................-----------------------------------------------------------------------------------........--------------------------------QKIYHLLIGPVITHHRDTFPLPFNIDMAYSCDNANILPHVKENLVKCIES............NIGP...GQWMVSSYNGFFDF......SD..SNDINEMQRKM.............
Q8UZD4_9GAMA/1-603               ....................m-SGLLAAAYSQVYALAVELSVCARLDPRS..--..LDGEAVARNAGLLAELDALLLPRLRRQN.DRACSALSLELAHLLENSRRAVAALLVGS----......-...---.........-------GP...GIS..PPAPLRAAYAVEFYG.GHRADVSLYLINDIEILMKRINSVFYCMSHSMGLESLDRALELLGRFRGVSPIPDPRLYITSV.PCWRCVGELMVLPNHGTPSTAEGARVSCNHLAVPVnsePVSGLFENEVRQAGLGHLLAAEGKE...RPAGPEEG.....................TVSGPGPRE--..................-AEGAARELDNYSVFS.TVPPEVAELSELLYWNSGSHAIg...........stGKGEGCGHSRLSALFAREG.RLARARRAC.EEALAGAPLTHLFDSVAP.R--...........ATERLFCGGVYSSSGDAVEALKADCAAAFTSNPQYRAILQKRNELYTRLNRAMQRLN......................................RSEGEE.G.PEASP......................................................-.-----GVPLAGAP-------.............................................---REPGSNALSDALKRKEQYLRQVASEGLARLQSCLAQQSETLTETLCLRVWGDVVYWEMACLRNHFLYRRAFVSGP-WEDR........RVGEGAAFENSKYIKTHLFTQTLSAEHLHALTHSLYTFITGPLAEER-GLFPPPSNVALARCCDAAGTLPHQKVFLTSLIWP............GIEP...SDWIETSFNSFYSV......PE..-GSLASSQQ--ll...........
Q91HJ1_ILTV/1-447                .....................-----------------------------..--..----------------------------.---------------------------------......-...---.........---------...---..---------------.---------------------------------------------------------------.-------------------------------TRQF...PVNVSTDDLKRHLPFLRDVDPEKLK...NVLSNETR.....................IEAENHVEAGRtls............sspGESEASKILNKYDVFT.EPPGPVYQLSELQYWLASGKRTpsgve...sqtttsQSVLKQLDKDLSELFKRAE.DFEQECIRL.ERTLFEKVHAHFHRVAQA.ELIsp......qhsLVDTLITGVLATSPDTEIAALIKACYDHHLSLPLFRRLRNPEKVDTDALEELVEKLR......................................GSDKET.Q.PVTEG......................................................T.STSDLTANLRGTIERDEDS-.............................................--IEVLLKKAERDLDVRQKNYVEKLSARSFSNLDRCIKIQRAELEKLMRVNIYGETLPVMYVTLKNAFLARRAFLDIVCAEESlhskilriDQNDGRAYDWHQYIRSSITRYQIDQTMLPRLTNRFFEILSGPLFKHHKERFPQPPNTSIYFSVENVGLLPHLKEELANFTKR............HRSC...-DWMTSEFRRFYNF......AG..ISNSTAIQRAA.............
Q69094_HHV2/42-78                ..............asswarg-----------------------------..--..----------------------------.---------------------------------......-...---.........---------...---..---------------.---------------------------------------------------------------.-----------------------------------...-------------------------...--------.....................-----------..................----------------.----------------------..............-------------------.---------.------------------.---...........---------------------------------------------------------......................................------.-.-----......................................................-.--------------------.............................................-----------------------------------------------------------------------------------........----------------------------------------------------------------------------------............-ASG...ADWAVSEFQKFYCF......DG..VSGITPTQRAA.............
H2A294_MUHV1/5-659               ....................t-LQKLCVVCSKCNECAMDVECLKYCDPNI..VS..MDSTAFRRNGVMVIHLYRTLYPALVSQN.AVQTSVLTLYMEMLLQGLYDTMREIDMALTDFG......T...HRD.........RQRYYRRVL...KLD..-SCNRHESITITFAP.ELALTIDLATLNDVERLLCKINCVYGAVDASQGVAVCRRLLSLLARLCDICPVAGPEIYRETV.TCFQCYEELMAVPNQGRSINRRMQGLLCDHITIK-...KVLVQLDMDAQTVEQDMGDIAIRAPsvkGIIRAIKS.....................LASFSPASYA-..................YINDAEEALRGYNLFS.EIPDRIYSLSDYTYWSKTS---..............EAIVRHVGITMRQLNVSHS.LWKTLRTEL.SRYHYGEDLEDVFTLGEG.RFG...........GDERIYVGSIFAAPGKVVDMITSMSIKSFENNPLFNRL-HESNEIYAKIKSLIEEIRgvgdgpa........................agaaasrA-----.-.----Eaasga............................................gaggeE.GAAAAGRGNTGGD------Egagttta...............................mssalecGDPLLRVHDVNKEVNVRKRAYLKKVSEMGYNKVMACIRNQEHLVTKLVNVNLVGTVCLEAVSKIMNGFLSRQRSITEAETYP-........DVAESLGYDEHLYVINNLVHKRLPSELLPQLGQQIYRFINGPMFTHYLDRHPLPYNVNMAYACDNAGILPHVKEDLVRCADG............TVVP...SDWMTVGYMGFFRF......AD..IRELNDLQKMV.............
Q8B407_9GAMA/1-594               .....................MTQYLAALYSQIYGFCLDVSILEYCDPTS..--..VEKNALMMIANKIEKINDTVLDYLILQN.QTDSSCLSLELEHLLTNLRDRLRTMLALWDC--......-...---.........PEQYYNHLH...-LA..PDCAFHEKIVVDFYN.ECRVEIPMILVNDVEAFFKKLNSVFYCITSEKAISCLQICLQFLKKLRGISPVASPDVYVSSL.PCLECFKEVSMIPNQGKTVHEMLVNSDCPHICKPLnsePIQGLFENELRHAGMNVEFDANE--...--------.....................VLTDGSEMK--..................IMEESLNCLQHHNIFT.EIPKQIWELSNLIYWNSSEH--..............AVSDKPQCSQLTKILQRNA.KMHMLRHSM.-----LRGNVHFFDTCSP.Q--...........SIELLFCGSIYSSADDMIKALKSDCSTTFLKQPQFQSMLHKQNELFTRLSKLLYDKI......................................SNKKEA.S.STDN-......................................................-.--ADTEVMRVEGMKESSNN-.............................................--------QIWEEAKLRKDAYLQKVTKEGMKKLQACLDAHGTVLKNALTLRVWGVTIYKEASILLNHFLFRHRWVSDSIWM--........TDGTNNMFEDSKFIKNSLYSTNLSKEHLDNLKLLFFSLVNGPLTSLD-DMFPIPENVKLAHCLDVANAMPHHKMMLVDMIHP............KLEP...KDWIDLNFNNFYTI......NQ..-HGLNNIQYEC.............
TRM1_HHV11/11-682                ....................a-RQKLLALLGQVQTYVFQIELLRRCDPHI..GR..GKLPQLKLNALQVRALRRRLRPGLEAQA.GAFLTPLSVTLELLLEYAWREGERLLGSLETFA......T...AGD.........VAAFFTETM...GLA..RPCPYHQRVRLDTYG.GT-VHMELCFLHDVENFLKQLNYCHLITPSRGATAALERVREFMVGAVGSGLIVPPELSDPSH.PCAVCFEELCVTANQGATIARRLADRICNHVTQQA...QVRLDANELRRYLPHAAGLSDADRA...RALSVLDH.....................ALARTAGGDGQphps.........pendsVRKEADALLEAHDVFQ.ATTPGLYAISELRFWLASGDRA.............gQTTMDAFASNLTALARREL.QQETAAVAV.ELALFGRRAEHFDRAFGS.HLAa........ldMVDALIIGGQATSPDDQIEALIRACYDHHLTTPLLRRLVSPEQCDEEALRRVLARMG......................................AGGAAD.A.PKGGAgpdddgdrva.................................veegarglgapG.-------------------Gggededrr.............................rgpggqgpETWGDIATQAAADVRERRRLYADRLTKRSLASLGRCVREQRGELEKMLRVSVHGEVLPATFAAVANGFAARARFCALT-AGAGtv....idNRSAPGVFDAHRFMRASLLRHQVDPALLPSITHRFFELVNGPLFDHSTHSFAQPPNTALYYSVENVGLLPHLKEELARFIMG............AGGS..gADWAVSEFQRFYCF......DG..ISGITPTQRAA.............
F8RFB3_HHV1/11-682               ....................a-RQKLLALLGQVQTYVFQIELLRRCDPHI..GR..GKLPQLKLNALQVRALRRRLRPGLEAQA.GAFLTPLSVTLELLLEYAWREGERLLGSLETFA......T...AGD.........VAAFFTETM...GLA..RPCPYHQRVRLDTYG.GT-VHMELCFLHDVENFLKQLNYCHLITPSRGATTALERVREFMVGAVGSGLIVPPELSDPSH.PCAVCFEELCVTANQGATIARRLADRICNHVTQQA...QVRLDANELRRYLPHAAGLSDADRA...RALSVLDH.....................ALARTAGGDGQphps.........pendsVRKEADALLEAHDVFQ.ATTPGLYAISELRFWLASGDRA.............gQTTMDAFASNLTALARREL.QQETAAVAV.ELALFGRRAEHFDRAFGS.HLAa........ldMVDALIIGGQATSPDDQIEALIRACYDHHLTTPLLRRLVSPEQCDEEALRRVLARMG......................................AGGAAD.A.PKGGAgpdddgdrva.................................veegarglgapG.-------------------Gggededrr.............................rgpggqgpETWGDIATQAAADVRERRRLYADRLTKRSLASLGRCVREQRGELEKMLRVSVHGEVLPATFAAVANGFAARARFCALT-AGAGtv....idNRSAPGVFDAHRFMRASLLRHQVDPALLPSITHRFFELVNGPLFDHSTHSFAQPPNTALYYSVENVGLLPHLKEELARFIMG............AGGS..gADWAVSEFQRFYCF......DG..ISGITPTQRAA.............
TRM1_ELHVK/3-620                 ....................k-LQLLGVVFAKVNECSLELSCVRYCDPNL..LL..TKRKEFLHNAFVCKYLCDSLLSELQHFS.CTNGLTACKHLAIILENLCEHFYVINKALCSFE......I...HKD.........HQQYYRTLF...DVD..-QCSLHDPIKISFVN.KQDLEITLTDFNEIERFLCKLNLIFPLIDARSGMRIISQIYDRLRKFTGISPLARLEFYKSACgGCYLCYEELQMTPNNGSSVQKRLNGVLCEHVTYTK...DLVFQENEYLEVLREDLKRDNLLREdmrTELDDMKK.....................ILSNKKERGF-..................YVPEAEQLLHRYDVFTdDIPNYIYTLSDLTYWSKTS---..............EKIIKTMNMTMQQLNVYNN.NMIKLKRSI.SRALNDIEVRDCFDVFEK.VVD...........KRHCMFLGSMFTSSAKIISLLATQCLTAFEEKAVFERL-NECDALCSTVNTILERLK......................................SASGDG.K.EGITK......................................................-.-----------QDFQ-----.............................................ADELIKGYNVSDEVSVRKKTYLNKVADKGYSKIVASLSTEERSIKKLIDINFLGTLCIDMMVKLEKMFYKRSQIGQMVENGV-........HLLALCNYDNHLYIRNNLSRQSISTENVNGVIQHILSFLCGPIFTHRHDIFPMPPNIDMAYACDNANVLPHRKEELMQCVND............ITSV...HGWSISSYNTFFKI......DS..-VDLNTAHAH-v............
Q2F7S7_HCMV/5-695                ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRVLMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpegeaihlrgreamsgtgttlmtasnsS-----.-.----Nssthsqrn.....................................nggggrargG.GKKAVGGGANGQDGDGSENGlrvrncd...............................ehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGDQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
Q69325_SHV2/1-70                 .....................------AVYSQIYGLTLDVSILTFVDPAH..--..INWKTVTKNTEKINKIYLQIMPLLHNQN.NIESTSLSVELQHLLHNL---------------......-...---.........---------...---..---------------.---------------------------------------------------------------.-----------------------------------...-------------------------...--------.....................-----------..................----------------.----------------------..............-------------------.---------.------------------.---...........---------------------------------------------------------......................................------.-.-----......................................................-.--------------------.............................................-----------------------------------------------------------------------------------........----------------------------------------------------------------------------------............----...--------------......--..-----------k............
G9IX93_HHV3/5-661                ....................i-NRTLLVLLGQVYTYIFQVELLRRCDPRV..AC..RFLYRLAANCLTVRYLLKLFLRGFNTQL.KFGNTPTVCALHWALCYVKGEGERLFELLQHFK......T...RFGygetkdsncIKDYFVSAF...NLK..-TCQYHHELSLTTYG.GY-VSSEIQFLHDIENFLKQLNYCYIITSSREALNTLETVTRFMTDTIGSGLIPPVELFDPAH.PCAICFEELCITANQGETLHRRLLGCICDHVTKQV...RVNVDVDDIIRCLPYIPDVPDIKRQ...SAVEALRT.....................LQTKTVVNPMGaknd..........tfdqTYEIASTMLDSYNVFK.PAPRCMYAISELKFWLTSNSTEg............pQRTLDVFVDNLDVLNEHEK.HAELTAVTV.ELALFGKTPIHFDRAFSE.ELGs........ldAIDSILVGNRSSSPDSQIEALIKACYAHHLSSPLMRHISNPSHDNEAALRQLLERVG......................................CEDDLT.K.EASDS......................................................-.--ATASECDLNDDSSITFAV.............................................HGWENLLSKAKIDAAERKRVYLEHLSKRSLTSLGRCIREQRQELEKTLRVNVYGEALLQTFVSMQNGFGARNVFLAKV-SQAGci....idNRIQEAAFDAHRFIRNTLVRHTVDAAMLPALTHKFFELVNGPLFNHDEHRFAQPPNTALFFTVENVGLFPHLKEELAKFMGG............VVGS...-NWLLSPFRGFYCF......SG..VEGVTFAQRLA.............
B7FEH4_9ALPH/15-678              ....................a-RQRLLAIFGQVQAYIFQVEMLKRCDPSA..LQ..PLVGSLKLNALTVRMLRRKLGGALIEQA.QHQQTPLACALTMALEYAEVEGERVLRAVDDVN......L...AG-.........AEGFFRATM...RLD..EPCEYHVRVHLDTYG.GP-IDAEVQFLHDAENFLKQLNYCHLITGFGAGLDALDSVARFLTRTVGSGIVVPPELCDPTH.PCSVCFEELCVTANQGEAVHRRLLECTCDHITRQM...AVRVANIDIARHLPHALSVASERRA...AAEAALRA.....................LEARRAQGHNGksag..........aedpTQLVASRLLEAHHVFK.PASRCLYAVSELKFWLASTKHGdm..........ghPRAIDTFTENLETLDKQEK.FFHLQAATV.ELALFGRTLDHFDRLFAD.QLLg........ldVIDGMLVGSCAVSPDDHIEALIKACYTHHMSAPLLQRLTDPDTSNREALKQLLGRIG......................................VETDDG.A.GELGDaldvdld........................................nlggappV.----------------NSTPcgddal................................cqtvpeeRPWDKLLERATADASQRRRMYAERLSKRSIASLGRCVREQRRELEKTLRVNVYGEVLLHTYVSSYNGFCARRGFCAAV-SRAGti....idNRSSTSAFDSHQFMKAALLRHPIDQSLMPSITHKFFELINGPVFDNAGHNFAQPPNTALYYSVENVGLLPHLKEELARFMIT............AAKG...-DWSISEFQRFYCF......EG..VTGVTATQRLA.............
Q2F7R6_HCMV/5-695                ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpege.......aihlrgreamsgtgttL-----.-.----Ttgsnssnssihs..............................qrnnggggrargG.GKKAVGGGANGQDGDGSENGlrvrncd...............................ehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGDQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
Q04459_HSVA1/1-160               .....................-----------------------------..--..----------------------------.---------------------------------......-...---.........---------...---..---------------.---------------------------------------------------------------.-----------------------------------...-------------------------...--------.....................-----------..................----------------.----------------------..............-------------------.---------.------------------.---...........---------------------------------------------------------......................................------.-.-----......................................................-.--------------------.............................................------------------------------------------ELDKMLRVSVYGELLPAAYAAVHNGFVARARFRRDV-ARAGtv....idNRGAAAVFDAHRFMRASLLRHQVDPAVLPSLTHRFFELVNGPMFDHHSHGFALPPNTALYYSVENVGLLPHLKEELARFMMT............AAAPagsADWAVSEFQRFYSF......DE..TSGITPTQRAA.............
PRTP_GAHVM/20-683                ....................a-TQKLFAIWGQIQSYLFQVELLKRCDPTV..GV..RMINRLKLNVLMIYYLEKKMVPALKEQR.EMNLTPLTYGLWLALRRAKLEGELLLDALCEFK......D...GGN.........LRDFFRKSM...SMC..GDCPYHSTVELDTYG.GK-VSTEIKFLHDVENVLKQLNYCHLILKADTVENFMVSLDNYLLKTLGSGSVVPPELYDPSQ.PCSVCFEELCVTANSGDSTHKRIVRKICDHITKQI...NIRVNSDDMVTHLPHATYVPDDKRT...TAQTALDV.....................IQSTMRDTTTEnds............nisVSKAAAAALDAHNVFL.PASGDLYAISELQFWIASSGRKlh.........qprGNTVESFADNLEALVSKER.LFDLRTSIV.ETAVFDRRMDHFERVFAQ.EIEh........mnAADRLLLGGRAAAPDDIIEALIKACYDHHMSAPLLKRLLYPDEAAHDALKTVLERVS......................................SHCIGN.D.IQCQD......................................................G.DGTCGERMNETGHFRTNDSFamst....................................tslghDEWLEMVKSASSDVARRRKMYAERLTKKSLASLDKCITEQRHELEKMLRVNVYGEVLIDSYTALFNGFRSRKRLLEAVKNCCAni....idNRNSDDAFDAHRFMQTSLLKHRIDPAMLPSLTHKFFQLVNGPMFSHDRHRFAQPSNTALYFSVENVGLLPHLKEEMARFMFH............SSRK...TDWTVSKFRGFYDF......ST..IDNVTAAHRMA.............
Q8QS32_9BETA/3-681               ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AECTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALTAYS......R...HPD.........RAAFYRTVL...RLD..-HCDRHHTVELRFTD.SVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCTQLLALLRRLCGISPVARQEAYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLELTERIPrlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGVTIQQLNVYHH.LCRVLMNTI.SRHLYGEDVEDIFALGEK.VLA...........GEERMFVGSVFAAPSRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKRILEEIRrplpdgtggdgp.............ergtsrhpqmhpkT-----.-.----Gsrteeeesmegtgt.........................yghngssrfrgrgrrS.-------------------Aaggaatlsqap.......................rgeeehealdpLDARSRVHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKAQERLTTKLIDVNLVGPVCLDFLSKMMNGFIYRSRYGQDREM--L........DVGQSLTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHAKDDLVKCAEG............TVYP...SEWMVVKYMSFFNF......SE..CQDLNVLQKEM.............
F8RF36_HHV1/11-682               ....................a-RQKLLALLGQVQTYVFQIELLRRCDPHI..GR..GKLPQLKLNALQVRALRRRLRPGLEAQA.GAFLTPLSVTLELLLEYAWREGERLLGSLETFA......T...AGD.........VAAFFTETM...GLA..RPCPYHQRVRLETYG.GT-VHMELCFLHDVENFLKQLNYCHLITPSRGATAALERVREFMVGAVGSGLIVPPELSDPSH.PCAVCFEELCVTANQGATIARRLADRICNHVTQQA...QVRLDANELRRYLPHAAGLSDADRA...RALSVLDH.....................ALARTSGGDGQphps.........pendsVRKEADALLEAHDVFQ.ATTPGLYAISELRFWLASGDRA.............gQTTMDAFASNLTALARREL.QQETAAVAV.ELALFGRRAEHFDRAFGS.HLAa........ldMVDALIIGGQATSPDDQIEALIRACYDHHLTTPLLRRLVSPEQCDEEALRRVLARMG......................................AGGAAD.A.PKGGAgpdddgdrga.................................veegtrglgapG.-------------------Gggededrr.............................rgpggqgpETWGDIATQAAADVRERRRLYADRLTKRSLASLGRCVREQRGELEKMLRVSVHGEVLPATFAAVANGFAARARFCALT-AGAGtv....idNRSAPGVFDAHRFMRASLLRHQVDPALLPSITHRFFELVNGPLFDHSTHSFAQPPNTALYYSVENVGLLPHLKEELARFIMG............AGGS..gADWAVSEFQRFYCF......DG..ISGITPTQRAA.............
F0UXF4_9BETA/1-47                .....................-----------------------------..--..----------------------------.---------------------------------......-...---.........---------...---..---------------.---------------------------------------------------------------.-----------------------------------...-------------------------...--------.....................-----------..................----------------.----------------------..............-------------------.---------.------------------.---...........---------------------------------------------------------......................................------.-.-----......................................................-.--------------------.............................................-----------------------------------------------------------------------------------........------------------------------------------------------------------GVLPHAKDDLVKCAEG............TVYP...SEWMXVKYMSFFNF......SD..CEDLNVLQKEM.............
TRM1_HHV6Z/3-612                 ....................s-LQSLCVLCARLNECALDLECLKFCDPVI..VL..SDMANFKKNGIVILHLYQTFFEGIKEQN.LLCASALTVYMQVLLKAMYEQVLLLDAALESFM......V...DQD.........RKKYFEKVL...CLK..-RCAEHLSINISLNN.GVEFIVQLSTLNDIEQLISKINSVYALLLPQEGLQICGKIIDLLTIMCGACMVAKPESYLETK.TCMKCYEELTLTPNQGKSLRKRLHGKFCNHLTEQ-...KAFFNIEKNIETIEKDLGEAILNYGtiqSVVTEIKK.....................IFKQQRSAESL..................HVSDAEKTLKKYNIFS.KVPDVIYSLSEFTYWSKIS---..............ETIVRNVAITLQQLNSCHT.LYKQLQNDV.SLYLYGEVSEDFLALSEN.LLT...........HDERLYVGSIYVSPSRLIDLVTGLSIKNLEESPIFKRL-AEEDEVQHKIKSLLHDIR......................................DPQTTE.T.PGRLN......................................................-.-------------------T.............................................INCMLQTHNLQQEVLARKKAYFQKVSESGYNRVMACIREQESLINKVVSVNVYGNFIFEALSKIMNGFVLRKMYLDGS-----........IRVDSCTYDEHLYIKNNLMPKKLPLELLPDLSEIMYTLLTGPLSDFHKSAYPLPANISMAYGCDHAEMLPHMKEDLARCIEG............TIHP...SVWMVCEYNEFFNF......SG..VTDVNDMQKKM.............
Q2F7R0_HCMV/5-695                ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpegeaihlrgreamsgtgttlmtasnsS-----.-.----Nssthsqrn.....................................nggggrargG.GKKAVGGGANGQDGDGSENGlrvrncd...............................ehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGDQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
TRM1_EBVB9/105-709               ....................m-SGLLAAAYSQVYALAVELSVCTRLDPRS..--..LDVAAVVRNAGLLAELEAILLPRLRRQN.DRACSALSLELVHLLENSREASAALLAPGRK--......-...---.........----GTRVP...PLR..---TPSVAYSVEFYG.GHKVDVSLCLINDIEILMKRINSVFYCMSHTMGLESLERALDLLGRFRGVSPIPDPRLYITSV.PCWRCVGELMVLPNHGNPSTAEGTHVSCNHLAVPVnpePVSGLFENEVRQAGLGHLLEAEEKA...RPGGPEEG.....................A---------Vpgp............grpEAEGATRALDTYNVFS.TVPPEVAELSELLYWNSGGHAIg...........atGQGEGGGHSRLSALFARER.RLALVRGAC.EEALAGARLTHLFDAVAP.G--...........ATERLFCGGVYSSSGDAVEALKADCAAAFTAHPQYRAILQKRNELYTRLNRAMQRLG......................................RGEEEA.S.RESPE......................................................-.------VPRPAGAREPGPS-.............................................--------GALSDALKRKEQYLRQVATEGLAKLQSCLAQQSETLTETLCLRVWGDVVYWELARMRNHFLYRRAFVSGP-WEDR........RAGEGAAFENSKYIKTHLFTQTLSSEHLHALTHSLYTFITGPLAEES-GLFPPPSNVALARCCDAAGTLPHQKAFLTSLIWP............GIEP...SDWIETSFNSFYSV......PG..-GSLASSQQ--il...........
O39274_EHV4/15-676               ....................a-RQRLLAIFGQVQAYIFQVEILKRCDPSA..LQ..PLIGALKLNALTIRKLKRKLGGALMEQA.RHQQTPLACALAMALEYAHVEGERVLRAADNVT......I...VG-.........AEGFFRATM...KLD..DPCEYHVRVHLETYG.GP-IDAEVQFLHDAENFLKQLNYCHLITGFGAGLAALENVASFLTRTVGSGIVVPPELCDPTH.PCSVCFEELCVTANQGEAVHRRLLECTCDHITRQM...SVRVANIDIARHLPHALSVSVERRA...AAEAALKA.....................LEARRVSGHNKndn...........tedpTHLVASRLLEAHNVFK.PASRCLYAVSELKFWLASAKHCde..........gpPRAIDTFTENLETLNKQEK.FFHLQAATV.ELALFGRTFDHFERIFAD.SLIg........ldVIDGMLVGSCAVSPDDYIEALIKACYTHHMSTPLLQRLTDPDTSNREALKQLLGRIG......................................VETNSG.S.AELGGnleid...........................................ldtmgcN.PQVN-TPSDEGALGKPVSEE.............................................RPWDKLFERASADASQRRRMYAERLSKRSLASLGRCVREQRKELEKTLRVNVYGDVLLHTYVLSYNGFCARRGFCEAVS-GAGti....idNRSSTSSFDSHQFMKAALLRHPIDQSLMPSITHKFFELINGPVFDNAGHNFAQAPNTALYYSVENVGLLPHLKEELARFMVT............AAKG...-DWSISEFQRFYCF......EG..VTGVTATQRLA.............
Q04234_HCMV/5-695                ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpegeaihlrgreamsgtgttlmtasnsS-----.-.----Nssthsqrn.....................................nggggrargG.GKKAVGGGANGQDGDGSENGlrvrncd...............................ehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGDQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
Q5ZR68_9ALPH/2-655               ....................d-SRETVALVSRLNAFLFQLELLKRCDPEAvvVS..PLRRSLKLNCLMVAYLRDRLEVPVKEQN.RTEADYALYSLGLALTSACREAGRCWQLLEEFE......R...NRD.........KRAFFRGAM...GLD..VPCPYHVETELRAYG.DVRVTKQLSTVNDAENLLKQVNYIHTVVPEAAAAELFARIDEFFSETLANGPVAAFEAYDESA.PCAVCFEELCVTANQGQSVYKRLADRACDHLATRY...QVHVDEDDLLKNLPYAGGHAPQRLN...ALCEDLRR.....................ARREAQDERQRtengc.......saaesaVMDETERLLNSFDVFC.NVPPAVYKMSELKFWLLAGSGD..............ETAIDLYGRRLADLEEKDA.LLARQEALT.SLRLFGVRLTHFHDLFPP.A-D...........PMEKVAVGSPRLPPETRMVALINAFYARAADVPLFRRLRETGERNTEALRKVLLQIR......................................SGETAE.E.ESDDG......................................................-.-----RDTAVGESFRSQNES............................................lRDLEELERRVRGETEERKRAYAARLSRRSFLNLSKCVEKQRAFLDKMLSVNVWGQFLLEAAVRTRNGFSRRARFLERVTGFGGev....rdKRHCRTDYDARQFVRNALLRHEVGPALLSELVNRFYELINGPYFTHAYHVFAQPHNTPLYFSVENVGLLPHIKNELASFMLI............RNHR...-EWMVSEYKEFYKFppvcdpEK..TGALNDLQRL-a............
TRM1_HHV1F/11-677                ....................a-RQKLLALLGQVQTYVFQIELLRRCDPHI..GR..GNAPPTEAERASGAGAAASSEAGPGGPA.GAFLTPLSVTLELLLEYAWREGERLLGSLETFA......T...AGD.........VAVFFTETM...GLA..RPCPYHQRVRLDTYG.GT-VHMELCFLHDVENFLKQLNYCHLITPSRGA-TALERVREFMVGAVGSGLIVPPELSDPSH.PCAVCFEELCVTANQGATIAAAWRTVSVTTSPSRR...RCGWTPTSVRRYLPHAAGLSDADRA...GALRVGPCagpd............rggrrA---------Appva..........endsVRKEADALLEAHDVFQ.ATTPGLYAISELRFWLASGDRA.............gQTTMDAFASNLTALA-REL.QQETAAVAV.ELALFGRRAEHFDRAFGS.HLAa........ldMVDALIIGGQATSPDDQIEALIRACYDHHLTTPLLRRLVSPEQCDEEALRRVLARMG......................................AGAGGP.K.GGAGP......................................................D.DDGDRVAVEEGARGLGAPGGggedeaps.............................prargtgpETWGDIATQAAADVRERRRLYADRLTKRSLASLGRCVREQRGELEKMLRVSVHGEVLPATFAAVANGFAARALLAALT-AGAGtv....idNRSAPGVFDAHRFMRASLLRHQVDPALLPSITHRFFELVNGPLFDHSTHSFAQPPNTALYYSVENVGLLPHLKEELARFIMG............AGGS..gADWAVSEFQRFYCF......DG..ISGITPTQRAA.............
G8XTC8_SCMVC/3-644               ....................l-LQKLCVVCSKCNEYAMELECLKYCDPSV..LL..AESSPFKRNALAIAYLYRRIYPEVVRQN.RTQTSLLSLYLEMILKALYEDTELLDRALKAYS......R...RPD.........RMEYYRTIL...RLD..-RCDRHHTVELTFTE.HVKFSVNLATLNDIERFLCKMNYVYAILSPETGLEVCSQLLQLLRRLCGVSPVACQEAYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIVVH-...RPSSQCDVNIQTVEQDLLELTQRIPslpGVLTALKN.....................LFSSSSVYHS-..................YIQEAEEALKEYNLFT.AIPARIYSLSDFTYWSRTS---..............EVIVKRVGISIQQLNVYHH.LCRVLMNAL.SRHLYGEDVEDIFVVGEK.ALS...........REERLFVGSVFAAPSRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKCLLDEIR......................................RPAADG.G.AAAAEagg...............................................gsaiR.-------GQDPQSTSS---Sngnqde................................dndfldyMDARTRIHNVTREVNIRKRAYLQKVSEVGYAKVINCIKSQERLTSKLIDVNLIGTVCLDFISKLMNGFIYRTQYQENPDIV--........DVAQVLSYDEHLYVVNNIIHKSLPVESLPLLGQQIYQLCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHIKDDLVKCAEG............TVYP...SEWMVVKYQGFFDF......SN..CGDLNMLQKEM.............
F0J8A1_9BETA/3-643               ....................l-LQKLCVVCSKCNEYAMELECLKYCDPSV..LL..AESSPFKKNALAIAYLYRRIYPELVRQN.RTQTSLLSLYMEMILKALYEDTELLDRALKAYS......R...RQD.........RAEYYRTVL...RLD..-RCDRHHTVELTFTD.NVKFSVTLATLNDIERFLCKMNYVYAILSPESGLEVCSQLLQLLRRLCGVSPVACQEAYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIVVH-...RPSSQCDVNIQTVEQDLTELTQRIPslsGVLTALKN.....................LFSSSSVYHS-..................YIQEAEEALREYNLFT.DIPARIYSLSDFTYWSRTS---..............EVIVKRVGISMQQLNVYHH.LCRVLMNVL.SRYLYGEDVEDIFVLGEK.LLS...........REQRLFVGSVFAAPSRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKCLLDEIR......................................RPVPDG.G.AAAAEgvg................................................aaiR.GQDPQSTSSNGG-------Apdedn...................................efldyMDARTRIHNVTREVNIRKRAYLQKVSEVGYAKVIRCIKSQERLTSKLIDVNLIGTVCLDFISRLMNGFIYRTRYRDNPDV--V........DVSQVLSYDEHLYVVNNIIHKSLPVESLPLLGQQIYQLCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHIKDDLVKCAEG............TVYP...SEWMVVKYQGFFDF......SS..CGDLNMLQKEM.............
Q9QH64_ILTV/5-251                ..................tql---RLMALAGQLQTLLFQIDILKRCDPEI..LLqkRLRSRIKHNALMALYIHSLLSNELSMQV.NYRLTLQTYCVWLWLRRACSEIAALCNEIDKYS......V...LKD.........RKCFFEATL...GYGkgFICPLHAEVQLQLYGmSSIISKELVLINDVENFMKQLNYCHCVVSCKNAIEALNTIDEFLVLSSGGSLVAAPDTYDHGQ.PCYVCLEELSVTANQGETIYRRLGYKICDHLTRQF...PVNVSTDDLKRHLPFLRD-------...--------.....................-----------..................----------------.----------------------..............-------------------.---------.------------------.---...........---------------------------------------------------------......................................------.-.-----......................................................-.--------------------.............................................-----------------------------------------------------------------------------------........----------------------------------------------------------------------------------............----...--------------......--..-----------vdp..........
Q2F7U5_HCMV/5-695                ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpegeaihlrgreamsgtgttlmtasnsS-----.-.----Nssthsqrn.....................................nggggrargG.-------------------Gkkvvgggvngqdgdgs............englrvrncdehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHRDQD--VV........DVGDQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
Q2F7R3_HCMV/5-695                ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEXCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpegeai....hlrgreamsgtgttlmtA-----.-.----Snssnssxhxq.................................rnnggggrargG.GKKAVGGGXNGQDGDGSENGlrvrncd...............................ehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGDQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
Q5Y918_9ALPH/1-195               ...................rg-----------------------------..--..----------------------------.---------------------------------......-...---.........---------...---..---------------.---------------------------------------------------------------.-----------------------------------...-------------------------...--------.....................-----------..................----------------.----------------------..............-------------------.---------.------------------.---...........---------------------------------------------------------......................................------.-.-----......................................................-.--------------------.............................................------------ETEERKRAYAARLSRRSFLNLSKCVEKQRAFLDKMLSVNVWGQFLLEAAVRTRNGFSRRARFLERVTGFGGev....rdKRHCRTDYDARQFVRNALLRHEVDPALLSELVNRFYELINGPYFTHAYHVFAQPHNTPLYFSVENVGLLPHIKNELASFMLI............RNHR...-EWMVSEYKEFYKFppvcdpEK..TGALNDLQRL-a............
Q5Y916_9ALPH/1-195               ...................rg-----------------------------..--..----------------------------.---------------------------------......-...---.........---------...---..---------------.---------------------------------------------------------------.-----------------------------------...-------------------------...--------.....................-----------..................----------------.----------------------..............-------------------.---------.------------------.---...........---------------------------------------------------------......................................------.-.-----......................................................-.--------------------.............................................------------ETEERKRAYAARLSRRSFLNLSKCVEKQRAFLDKMLSVNVWGQFLLEAAVRTRNGFSRRARFLERVTGFGGev....rdKRHCRTDYDARQFVRNALLRHEVDPALLSELVNRFYELINGPYFTHAYHVFAQPHNTPLYFSVENVGLLPHIKNELASFMLI............RNHR...-EWMVSEYKEFYKFppvcdpEK..TGALNDLQRL-a............
Q2F7S9_HCMV/5-695                ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpeg..........eaihlrgreamsgtG-----.-.----Ttlttasnssnssi...........................hnqrnngvggrargG.-------------------Gkkvvgggvngqdgdgs............englrvrncdehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGDQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
H9DV05_9ALPH/16-694              ....................a-RQRLLATFGQLQTYIFQIELLKRCDPDV..ILggETLRNLKLNAMMVRYLEKHINTGFVKQA.EIYLTPMTYALHLSLRYAKKEGESVLAAIESYR......L...HGN.........IRKFFSDTM...GLA..GDCPYHRGVSLRTYG.GE-VRTEIKFLHDVENILKQLNFCHLITPVDEAESFFDALDGFLSLTIGSGFVVPPQLFDPSH.PCSVCFEELCVTANQGEAIHRRMANKICDHITKQI...RVRIDREEILRHVPYIAGVDPERKR...AALAALEA.....................IGQSMRNTDSSyn..............qtTIDTADAILEAHNVFL.PASKRLYAISELRYWLASGSIGntdn.....qtsmmSGTISAFAANLDLLAEREC.RLDLETAAV.ELALFNRTMMHFDKAYAD.NMAe........ldVIDCLLLGSRSASPDDQIEALIRACYDHHMSAPLLRRLADPDKANEDALRKVLERAS......................................KMNSQN.N.GSNRGgdnlqtkntlgi..............................itessdssdtdeD.EQRKSITQRYDLNTNIR---.............................................NTWEDLIRRVDEDTRERRKLYSEKLTKRSLASLDRCVREQRRELEKTLRINVFGETLLSTFVAAYNGFRSRAGVLTKVINAAGtv....idNRNWDGAFDAHRFMRTSLLRQSIDPAMLPSLTHKFFELVNGPLFCHDRHIFAQPPNTPLYFSVENVGLLPHLREELARFMVT............PRGA...-DWTTSTFQGFYDF......SG..IEGVTAAQRLA.............
TRM1_EHV1B/6-669                 ....................a-RQRLLAIFGQVQAYIFQVEMLKRCDPSA..LL..PLVGSLKLNALTIRMLRRKLGGALIEQA.QHQQTPLACALTMALEYAEVEGERVLRAVDDVN......L...AG-.........PEGFFRATM...RLD..EPCEYHVRVHLDTYG.GP-IDAEVQFLHDAENFLKQLNYCHLITGFEAGLDALESVARFLTRTVGSGIVVPPELCDPTH.PCSVCFEELCVTANQGEAVHRRLLECTCDHITRQM...AVRVANIDIARHLPHALSVASERRA...AAEAALRA.....................LEARRVQGHNGksag..........tedpTQQVASRLLESHHVFK.PASRCLYAVSELKFWLASTKHGdm..........gqPRAIDTFTENLETLDKQEK.FFHLQAATV.ELALFGRTLDHFDRLFAD.QLLg........ldVIDGMLVGSCAVSPDDHIEALIKACYTHHMSAPLLQRLTDPDTSNREALKQLLGRIG......................................VDTDDG.A.GELGDaldvdld........................................nlggappV.NST----------------Pcgedal................................crtvseeRPWDKLLERATADASQRRRMYAERLSKRSIASLGRCVREQRRELEKTLRVNVYGEVLLHTYVSSYNGFCARRGFCAAV-SRAGti....idNRSSTSAFDSHQFMKAALLRHPIDQSLMPSITHKFFELINGPVFDNAGHNFAQPPNTALYYSVENVGLLPHLKEELARFMIT............AAKG...-DWSISEFQRFYCF......EG..VTGVTATQRLA.............
Q2F7R2_HCMV/5-695                ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpegeaihlrgreamsgtgttlmtannsS-----.-.----Nssthsqrn.....................................nggggrargG.GKKAVGGGANGQDGDGSENGlrvrncd...............................ehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGDQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
A8B020_9BETA/3-643               ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LA..AESSPFKRNALAIAYLYRKIYPEVVRQN.RTQTSLLTLYMEMILKALYEDTELLDRALKAYC......R...RPD.........RMEYYRTIL...RLD..-RCDRHHTVELTFTE.TVKFSVTLATLNDIERFLCKMNYVYAILAPETGLEVCSQLLQLLRRLCGVSPVVCQEAYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIVVH-...RPSSQCDVNIQTVEQDLLDLTPRIPslpGVLTALKN.....................LFSSSSVYHS-..................YIQEAEEALREYNLFT.DIPARIYSLSDFTYWSRTS---..............EVIVKRVGISIQQLNVYHH.LCRVLMNSL.SNHLYGEDVEDIFVVGEK.LLS...........REERLFVGSVFAAPSRIIDLITSLSIQAFEGNPVFNKL-HESNEMYTKIKCILEEIR......................................RPVPDG.A.AGEAG......................................................A.GSASRGQDRLNTSNNNSDAQnedd....................................dfldwRDARTRMHNVTREVNMRKRAYLQKVSEVGYAKVIRCIKSQERLTSKLIDVNLIGTVCLDFISKLMNGFIYRTQYLDNPDLV--........DVAQLLSYDEHLYVVNNIIHKSLPAESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHIKDDLVKCAEG............TVYP...SEWMVVKYQGFFNF......SD..CQDLNMLQKEM.............
G8H984_HHV1/11-682               ....................a-RQKLLALLGQVQTYVFQIELLRRCDPHI..GR..GKLPQLKLNALQVRALRRRLRPGLEAQA.GAFLTPLSVTLELLLEYAWREGERLLGSLETFA......T...AGD.........VAAFFTETM...GLA..RPCPYHQRVRLDTYG.GT-VHMELCFLHDVENFLKQLNYCHLITPSRGATAALERVREFMVGAVGSGLIVPPELSDPSH.PCAVCFEELCVTANQGATIARRLADRICNHVTQQA...QVRLDANELRRYLPHAAGLSDADRA...RALSVLDH.....................ALARTAGGDGQphps.........pendsVRKEADALLEAHDVFQ.ATTPGLYAISELRFWLASGDRA.............gQTTMDAFASNLTALARREL.QQETAAVAV.ELALFGRRAEHFDRAFGS.HLAa........ldMVDALIIGGQATSPDDQIEALIRACYDHHLTTPLLRRLVSPEQCDEEALRRVLARMG......................................AGGAAD.A.PPGGAgpdddgdrva.................................veegarglgapG.-------------------Gggededrr.............................rgpggqgpETWGDIATQAAADVRERRRLYADRLTKRSLASLGRCVREQRGELEKMLRVSVHGEVLPATFAAVANGFAARARFCALT-AGAGtv....idNRSAPGVFDAHRFMRASLLRHQVDPALLPSITHRFFELVNGPLFDHSTHSFAQPPNTALYYSVENVGLLPHLKEELARFIMG............AGGS..gADWAVSEFQRFYCF......DG..ISGITPTQRAA.............
TRM1_HCMVA/5-695                 ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpegeaihlrgreamsgtgttlmtasnsS-----.-.----Nssthsqrn.....................................nggggrargG.-------------------Gkkvvgggvngqdgdgs............englrvrncdehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGDQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
F0UXF9_9BETA/1-47                .....................-----------------------------..--..----------------------------.---------------------------------......-...---.........---------...---..---------------.---------------------------------------------------------------.-----------------------------------...-------------------------...--------.....................-----------..................----------------.----------------------..............-------------------.---------.------------------.---...........---------------------------------------------------------......................................------.-.-----......................................................-.--------------------.............................................-----------------------------------------------------------------------------------........------------------------------------------------------------------GVLPHAKDDLVKCAEG............TVYP...SEWMXVKYMSFFNF......SD..CEDLNVLQKEM.............
Q77L98_TUHV1/3-652               ....................t-LQRLCVVCSKCNECAMELECLKYCDPAI..VL..VDSAPFKRNALTVVHLYRRLCPALAEQNaRYQASLITLYLEMLLRCLYEDVLLVDEALGEFE......R...HGD.........RQRYYRRVL...RLD..-RCACHDTLEVTFTE.RIRLTVDVATLNEVERLLCKINCVYGVLEPTRGLELCRRLLSLMGRLCGISPVAAPEAYVENL.TCLQCYEELAAVPNQGRSILKRLRGLLCDHLTVR-...KSLVQLETGIQTMEQDIVETVGSRPrlsSLLELLKG.....................LSSSAAVSHA-..................YISEAEDTLRRYNLFT.DIPPRIYSLSDFTYWSKTS---..............EVIVQRVNVTVQQLNMYHS.LCRTLRNEL.GQYLYGDRVEDLFTLSEA.QLG...........EDERLYVGSIYAAPERIVDLMTSLSLQSFENNPVFNKL-HENNEIYSKIRSLLEEIRrpld.............................gagtrGAAAAT.A.AGARG......................................................A.AEGTGGAAAAG--------Gaaaaage..............................aaggpfqcGDPAARAHDVVREVHVRKKAYLQKVSELGYNRVMQCIKGQEKLIKKLVNVNLLGTVCFEVLAKVINGFIRRRAYLERVDGVV-........DVDRLLQYDDHLYVVNNLVHRRLPAESLPALGQEFYRFVNGPVFQHHADRYPLPYNIDMAYACDNAGMLPHLKEDLVRLAEG............TVAP...SEWMVAPYRRFFDL......GA..ALDLNELQK--gf...........
Q6X240_9ALPH/34-716              ....................a-RQRMLAIFGQVQTYNFQLALLGRCDPAV..AR..RHLDAVKLNALMVRWLRRRLGGALRAQA.RVRLTPLTYALDLALDHAAAESDALLAAAGA--......-...AGT.........PAEFFARTM...GLE..GACRFHRRARLALYG.GETIDIEIQFLHDVENFLKQLNFAHLLASAEAALAALADVDAFLRATVAAGGVAPPELHDPAQ.PCLVCFEELCVTANQGESVGRRLALCTCDHVTRQL...RVRTELCDVSQYLPHLQGVPRARLA...AAAAALEA.....................LEAPAAAGARRepppaasgppggagdggsVREAAASVLDAHHVFR.PAPRWLYAVSELQFWMSSSARGe...........atASAVAAFAGNLEALAAREA.RHRLQVAAA.ELALFGRSPEHFDRAIAD.GLAr........ldGVDCLLVGSAAVAPDERLEALIRACYDHHMSASLIRRLTRPDQRNEDALRELLRRAA......................................AGEEGG.E.DGADS......................................................-.GEEGGGADDDGGDGDGAGGGnggagpagga........................dggagagddgpAGWAALAARARADADVRRQRYAERLSKRSMDSLGRCIRDQRRELEKTLRVSVYGDVLLNVYVAVHNGFCARRAFRAAL-AGAGtv....vdNRASDATFDAHRFMKEALLRHAVDPATWPALTHQFFDLVNGPLFDGSAHNFAQPPNTALYFSVENVGLLPHLKEELAAFMLA............AAGG...-GWVVSDFQRFFCF......ASarARGVTAAQRLA.............
Q9YTQ6_ATHV3/1-592               .....................MAQHLAAVYSQIYGFTLDVSVLTFVDPSH..--..INRKIFTNNMQKINKIYLQIMPLLQDQN.NVESTSLSVELQHLLTNLKTMLDIILKHLTN--......-...---.........YETYFDNIH...SLS..TPCSKHKLIVFQFYN.NCSVSVRMCIINDIEIFLKRLSSVFYCIRAHDATYGLNKVIDFLGHLRGISPIPLPDTYLSNI.PCIYCLWEHMMLPNQGESLQSMMTSVNCTHVCNQLnpePVQGMFENELLQRHIIVDTQKPK--...--------.....................EPTQQCSINDK..................IRDETLSKLSHHTIFE.NTSAPVLELSNLIYWSSGTHT-..............KCTNIENTSEIVKLLSHET.KMQNYRKYI.-----CKKSTHFFDKYKP.Y--...........SIETIFCGGIFNSVDETVKSLKSDCSLAFMKRANYQQLIKKQNELFVRLNNILKGED......................................TSETST.P.PVPIS......................................................-.----------EKAAAVNPE-.............................................--------QVINDAHARKDAYLQKVTKDGLKSLYACLDTQGAVLSNTLSMRVWGCAVYDEIVKLKNHFLFRDQFISLD-WIHL........EEESVSGFENSKYIKNLIYSQKLSSEHISSLTLQFYQLITGPLSQNV-SYFPLPPNIALAHCLDAAGALPHHKLLITEMIWP............TIEP...KDWVSQTYNKFYTI......TS..-GDLNNIQKEV.............
Q777A8_EBVB9/105-709             ....................m-SGLLAAAYSQVYALAVELSVCTRLDPRS..--..LDVAAVVRNAGLLAELEAILLPRLRRQN.DRACSALSLELVHLLENSREASAALLAPGRK--......-...---.........----GTRVP...PLR..---TPSVAYSVEFYG.GHKVDVSLCLINDIEILMKRINSVFYCMSHTMGLESLERALDLLGRFRGVSPIPDPRLYITSV.PCWRCVGELMVLPNHGNPSTAEGTHVSCNHLAVPVnpePVSGLFENEVRQAGLGHLLEAEEKA...RPGGPEEG.....................A---------Vpgp............grpEAEGATRALDTYNVFS.TVPPEVAELSELLYWNSGGHAIg...........atGQGEGGGHSRLSALFARER.RLALVRGAC.EEALAGARLTHLFDAVAP.G--...........ATERLFCGGVYSSSGDAVEALKADCAAAFTAHPQYRAILQKRNELYTRLNRAMQRLG......................................RGEEEA.S.RESPE......................................................-.------VPRPAGAREPGPS-.............................................--------GALSDALKRKEQYLRQVATEGLAKLQSCLAQQSETLTETLCLRVWGDVVYWELARMRNHFLYRRAFVSGP-WEDR........RAGEGAAFENSKYIKTHLFTQTLSSEHLHALTHSLYTFITGPLAEES-GLFPPPSNVALARCCDAAGTLPHQKAFLTSLIWP............GIEP...SDWIETSFNSFYSV......PG..-GSLASSQQ--il...........
F0J897_9GAMA/1-610               ....................m-SGLLAAAYSQVYALAVELSVCRYLDPRS..--..LDADTTAHNTALLAELNATLLPCLQWQN.DRACTALSLELAHLLKNAWEVSKMLLRRVRA--......-...--G.........PGSQCSATP...NP-..---SPNQTYSVEFYG.NYTVDVSLYLINDIEIFLRRINSVFYCMSYIMGLKGLNRALGLLGQFRGISPIPDPRLYVTSV.PCWRCIGELMVLPNHGNPSTSNAAHVRCSHVSVPVnpePVSGLFENEVRQLGLQHLLEGEKAT...---ESESG.....................VCTRSDASAG-..................-SEGAMHELDVYSVFS.AIPPEVAELSELLYWNSGGNSPg............lTREEESGNSRLSSLFAKEQ.RLRRARRAC.EATLVGAPHTHLFDSEMP.R--...........ATERLFCSGVYSSTGDVVEALKADCAAAFTSNPQYQAIIQKRNELYTRLNKAMQRLH......................................HRQDEI.E.AATET......................................................-.----------HPYAAIVQD-.............................................RDPLSTPRNAFADALKRKEQYLRQVASEGLSKLQSCLSQQSETLTENLCLRVWGDVVYQEMASMRNHFLYREAFVNRP-WEDM........RVPTATAFENSKYIKTHLFIQTLSAEHLHALTHNLYTFITGPLAEEH-GLFPLPSNVALARCCDAAGTLPHQKVFFTSLIWP............GIEP...SDWIETSFNSFYNV......RD..-VSLAKSQQ--il...........
Q8AZ07_9GAMA/1-594               .....................MTQHLAALYSQIYGVCLDVSILEYCDPSG..--..VDKCALLNTKNKIEDIYDTVFDYLILQN.RSDSSSLSLELEHLLANVRDRLHVILGALGD--......-...---.........SNQYFSRLH...-LE..CKCNFHERIKMHFYN.GCSIEVKMNLINDVEVFFKKLNSVFYCIPAEKAILCLQNVLHFLRKLRGISPVAPPDCYISSI.PCLECFKEITMIPNQGKSIQEMLVNFDCPHICRPLnsePVQGLFENELKHTGVNVTLDMKE--...--------.....................CPTDGASTLK-..................IMEESLKCLEDHNIFT.EIPKQMWEISNLIYWNSAE--E..............TTEKHCQCSQLTKILQRNA.KMNQYRRIL.------FKDNHFFDTCHP.Q--...........SIELLFCGSLYSSTDDVIRALKCDCSATFMEQPKFQSMFHKRNELFTRLSNLLYENT......................................TGGDDD.H.ITSSM......................................................-.---NSDVIRIEGMKESSNE-.............................................--------QILEEARLRKEAYLHKVSKDGMKKLQACLDAHSNILKNILTLRVWGSTIYKEASLVLNHFLFRQRWVSDSTWM--........TDGGNTLFENSKFIKNSLYATNLSREHLDKLKLLFYSLINGPLTSTD-DLFPIPQNVKLAHCLDSVNAMPHHKMMLVNMIHC............QLEP...KDWIDLKFNNFYTI......TQ..-HTLNNIQYEC.............
F0UXF7_9BETA/3-685               ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNI..LL..AECTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALTAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELRFTD.SVRFSVTLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEAYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTARIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPDRIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHH.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALA...........GEERMFVGSVFAAPSRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKRILEEIRrplpdgtggdg...............pegeatrlrgreT-----.-.----Aagsaasgmsat...............................sgrgtgsmnhstR.-------------------Sqrsrgragggadsgsen...........ggsslirgcdehealdaLDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKAQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYDQDQN--VL........DVGHQLTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHAKDDLVKCAEG............TVYP...SEWMVVKYMSFFNF......SD..CEDLNVLQKEM.............
Q8B413_9GAMA/1-594               .....................MTQYLAALYSQIYGFCLDVSILEYCDPTS..--..VEKNALMMIANKIEKINDTVLDYLILQN.QTDSSCLSLELEHLLTNLRDRLRTMLALWDC--......-...---.........PEQYYNHLH...-LA..PDCAFHEKIVVDFYN.ECRVEIPMILVNDVEAFFKKLNSVFYCITSEKAISCLQICLQFLKKLRGISPVASPDVYVSSL.PCLECFKEVSMIPNQGKTVHEMLVNSDCPHICKPLnsePIQGLFENELRHAGMNVEFDANE--...--------.....................VLTDGSEMK--..................IMEESLNCLQHHNIFT.EIPKQIWELSNLIYWNSSEH--..............AVSDKPQCSQLTKILQRNA.KMHMLRHSM.-----LRGNVHFFDTCSP.Q--...........SIELLFCGSIYSSADDMIKALKADCSTTFLKQPQFQSMLHKQNELFTRLSKLLYDKI......................................SNKKEA.S.STDN-......................................................-.--VDTEVMRVEGMKESSNN-.............................................--------QIWEEAKLRKDAYLQKVTKEGMKKLQACLDAHGTVLKNALTLRVWGVTIYKEASILLNHFLFRHRWVSDSIWM--........TDGTNNMFEDSKFIKNSLYSTNLSKEHLDNLKLLFFSLVNGPLTSLD-DMFPIPENVKLAHCLDVANAMPHHKMMLVDMIHP............KLEP...KDWIDLNFNNFYTI......NQ..-HGLNNIQYEC.............
Q69261_9ALPH/1-265               .....................-----------------------------..--..----------------------------.---------------------------------......-...---.........---------...---..---------------.---------------------------------------------------------------.-----------------------------------...-------------------------...--------.....................-----------..................----------------.----------------------..............-------------------.---------.------------------.---...........----------------------------------LQRLTDPDTSNREALKQLLGRIG......................................VDTDDG.A.GELGDaldvdld........................................nlggappV.NST----------------Pcgedal................................crtvseeRPWDKLLERATADASQRRRMYAERLSKRSIASLGRCVREQRRELEKTLRVNVYGEVLLHTYVSSYNGFCARRGFCAAV-SRAGti....idNRSSTSAFDSHQFMKAALLRHPIDQSLMPSITHKFFELINGPVFDNAGHNFAQPPNTALYYSVENVGLLPHLKEELARFMIT............AAKG...-DWSISEFQRFYCF......EG..VTGVTATQRLA.............
TRM1_HHV2H/15-682                ....................a-RQKLLALLGQVQTYVFQLELLRRCDPQI..GL..GKLAQLKLNALQVRVLRRHLRPGLEAQA.AAFLTPLSVTLELLLEYAWREGERLLGHLETFA......T...TGD.........VSAFFTETM...GLA..RPCPYHQQIRLQTYG.GD-VRMELCFLHDVENFLKQLNYCHLITPPSGATAALERVREFMVAAVGSGLIVPPELSDPSH.PCAVCFEELCVTANQGATIARRLADRICNHVTQQA...QVRLDANELRRYLPHAAGLSDAARA...RALCVLDQ.....................ALARTAAGGGAragpp.......padsssVREEADALLEAHDVFQ.ATTPGLYAISELRFWLASGDRA.............rHSTMDAFADNLNALAQREL.QQETAAVAV.ELALFGRRAEHFDRAFGG.HLAa........ldMVDALIIGGQATSPDDQIEALIRACYDHHLTTPLLRRLVSPEQCDEEALRRVLARLG......................................AGGATGgA.EEEEP......................................................R.AAAEEGGRRRGAGTPASEDGergpe..................................pgaqgpESWGDIATRAAADVRERRRLYADRLTKRSLASLGRCVREQRGELEKMLRVSVHGEVLPATFAAVANGFAARARFCALT-AGAGtv....idNRAAPGVFDAHRFMRASLLRHQVDPALLPSITHRFFELVNGPLFDHSTHSFAQPPNTALYYSVENVGLLPHLKEELARFIMG............AGGS..gADWAVSEFQKFYCF......DG..VSGITPTQRAA.............
B3UXI8_MUHV1/5-660               ....................t-LQKLCVVCSKCNECAMDVECLKYCDPNI..VS..MDSTAFRRNGVMVIHLYRTLYPALVSQN.AVQTSVLTLYMEMLLQGLYDTMREIDMALTDFG......T...HRD.........RQRYYRRVL...KLD..-SCNRHESITITFAP.ELALTIDLATLNDVERLLCKINCVYGAVDASQGVAVCRRLLSLLARLCDICPVAGPEIYRETV.TCFQCYEELMAVPNQGRSINRRMQGLLCDHITIK-...KVLVQLDMDAQTVEQDMGDIAIRAPsvkGIIRAIKS.....................LASFSPASYA-..................YINDAEEALRGYNLFS.EIPDRIYSLSDYTYWSKTS---..............EAIVRHVGITMRQLNVSHS.LWKTLRTEL.SRYHYGEDLEDVFTLGEG.RFG...........GDERIYVGSIFAAPGKVVDMITSMSIKSFENNPLFNRL-HESNEIYAKIKSLIEEIRgvgdgpa.......................agaaasraE-----.-.----Aasgaga.........................................ggeegagA.---AAGRGN----------Tggdegagta...........................tamssalecGDPLLRVHDVNKEVNVRKRAYLKKVSEMGYNKVMACIRNQEHLVTKLVNVNLVGTVCLEAVSKIMNGFLSRQRSITEAETYP-........DVAESLGYDEHLYVINNLVHKRLPSELLPQLGQQIYRFINGPMFTHYLDRHPLPYNVNMAYACDNAGILPHVKEDLVRCADG............TVVP...SDWMTVGYMGFFRF......AD..IRELNDLQKMV.............
Q9WRU0_9GAMA/1-599               .....................MARELAALYAQLSALAVDLSLVIFADPRS..--..IDGARILKTKTQIENLNRDLLPLLREQN.SVETSSLSLEVEHLAKNIEDKLGELERSLRQ--......-...RYS.........SREHFETLH...-LR..PECHYHSTVTFQFYG.GGLIDVNMCLINDVELLCKRLGSVFYCIGANEALSGLNRVLTFLSTLRGISPIPHPDLYVTSV.PCVQCLREIELVPNQGSSLLAVLADRHCDHLCKKVraePIHGLFETELSQLGLKVTKRSDA--...--------.....................TQHGVRSSADQ..................LRESSLAAIQDHNIFK.RVSASIMELSNLIYWNAGQTGL..............QTGTENECSQMARLLTHEA.DMHEHRALI.---TPKLSATHFYDCFRP.D--...........PIESLFCGGLFNSIDDTINALSRDCSVTFFQQANYTNVMRKQNELFTRLNSILRQGS......................................AGSQKP.A.TPSEP......................................................-.--------RTTTVAATA---.............................................------ASDVIKDAQYRKEQYMKKVARDGFKKLTECLQTQSAVLANALCMRVWGGVAYGEASELVNHFLLRRRFVALP-WEAR........CRSDQILFENSKYIKNSLYSQRLSREHVEIITLQFYGLITGPLTRQS-DLFPGPANVALAQCFEAAGMLPHHKMLVSEMIWP............QIQP...KDWIDQTFNRFYQL......PE..-GDLNAVQKSA.............
G9IVT9_HHV3/5-661                ....................i-NRTLLVLLGQVYTYIFQVELLRRCDPRV..AC..RFLYRLAANCLTVRYLLKLFLRGFNTQL.KFGNTPTVCALHWALCYVKGEGERLFELLQHFK......T...RFVygetkdsncIKDYFVSAF...NLK..-TCQYHHELSLTTYG.GY-VSSEIQFLHDIENFLKQLNYCYIITSSREALNTLETVTRFMTDTIGSGLIPPVELFDPAH.PCAICFEELCITANQGETLHRRLLGCICDHVTKQV...RVNVDVDDIIRCLPYIPDVPDIKRQ...SAVEALRT.....................LQTKTVVNPMGaknd..........tfdqTYEIASTMLDSYNVFK.PAPRCMYAISELKFWLTSNSTEg............pQRTLDVFVDNLDVLNEHEK.HAELTAVTV.ELALFGKTPIHFDRAFSE.ELGs........ldAIDSILVGNRSSSPDSQIEALIKACYAHHLSSPLMRHISNPSHDNEAALRQLLERVG......................................CEDDLT.K.EANDS......................................................-.--ATASECDLNDDSSITFAV.............................................HGWENLLSKAKIDAAERKRVYLEHLSKRSLTSLGRCIREQRQELEKTLRVNVYGEALLQTFVSMQNGFGARNVFLAKV-SQAGci....idNRIQEAAFDAHRFIRNTLVRHTVDAAMLPALTHKFFELVNGPLFNHDEHRFAQPPNTALFFTVENVGLFPHLKEELAKFMGG............VVGS...-NWLLSPFRGFYCF......SG..VEGVTFAQRLA.............
B3F8Y4_9ALPH/16-694              ....................a-RQRLLATFGQLQTYIFQIELLKRCDPDV..ILggETLRNLKLNAMMVRYLEKHINTGFVKQA.EIYLTPMTYALHLSLRYAKKEGESVLAAIESYR......L...HGN.........IRKFFSDTM...GLA..GDCPYHRGVSLRTYG.GE-VRTEIKFLHDVENILKQLNFCHLITPVDEAESFFDALDGFLSLTIGSGFVVPPQLFDPSH.PCSVCFEELCVTANQGEAIHRRMANKICDHITKQI...RVRIDREEILRHLPYIAGLDPERKR...AALAALEA.....................IGQRMRNTDSSyn..............qtTIDTADAILEAHNVFL.PASKRLYAISELRYWLASGSIGntdn.....qtsmmSGTISAFAANLDLLAEREC.RLDLETAAV.ELALFNRTMMHFDKAYAD.NMAe........ldVIDCLLLGSRSASPDDQIEALIRACYDHHMSAPLLRRLADPDKANEDALRKVLERAS......................................KMNSQN.N.GSNRGgdnlqtkntlgi..............................itessdssdtdeD.EQRKSITQRYDLNTNIR---.............................................NTWEDLIRRVDEDTRERRKLYSEKLTKRSLASLDRCVREQRRELEKTLRINVFGETLLSTFVASYNGFRSRAGVLTKVINAAGtv....idNRNWDGAFDAHRFMRTSLLRQSIDPAMLPSLTHKFFELVNGPLFCHDRHIFAQPPNTPLYFSVENVGLLPHLREELARFMVT............PRGA...-DWTTSTFQGFYDF......SG..IEGVTAAQRLA.............
Q2F7T4_HCMV/5-695                ....................l-LQKLCVVCSKCNEYAMELECLKYCDPNV..LL..AESTPFKRNAAAIVYLYRKIYPEVVAQN.RTQSSLLTLYLEMLLKALHEDTALLDRALMAYS......R...QPD.........RAAFYRTVL...RLD..-RCDRHHTVELQFTD.NVRFSVSLATLNDIERFLCKMNYVYGILAPEAGLEVCAQLLELLRRLCGISPVARQEVYVEGT.TCAQCYEELTIIPNQGRSLNKRLQGLLCNHIAVH-...RPSSQSDVNIQTVEQDLLDLTTRIPhlaGVLSALKS.....................LFSSSSAYHS-..................YIQEAEEALREYNLFT.DIPERIYSLSDFTYWSRTS---..............EVIVKRVGITIQQLNVYHQ.LCRALMNGI.SRHLYGEDVEDIFVLGEK.ALD...........GEERMFVGSVFAAPNRIIDLITSLSIQAFEDNPVFNKL-HESNEMYTKIKHILEEIRrplpdgtggdgpegeaihlrgreamsgtgttlmtasnsS-----.-.----Nssthsqrn.....................................nggggrargG.GKKAVGGGANGQDGDGSENGlrvrncd...............................ehealdlVDARSRIHNVTREVNVRKRAYLQKVSEVGYGKVIRCIKTQERLTSKLIDVNLVGPLCLDFISKLMNGFLYRSQYHQDQD--VV........DVGDQFTYDEHLYVVNNLIHKSLPVESLPLLGQQIYELCNGPLFTHCTDRYPLSHNVDMAYACDNAGVLPHVKDDLVKCAEG............TVYP...SEWMVVKYMGFFNF......SD..CQDLNVLQKEM.............
#=GC seq_cons                    ....................h.hQ+LhslhupsppashplEhL+hCDPpl..hh..tc.sshKhNuhtlhhLh+plhPtlhtQs.ptp.o.LolhLchlLcthhc-sthL.tuLtsat......t...t.D.........httaappsh...tLs....CshHpplpLphhs.ss.hshpLshLpDlEpFLpphNasahlhsspsultshtplhphLtphsGhu.ls..Elas.up.sCh.CaEELslhsNQGcolp+RLtshlCsHlshp....pspsp.-s.hppl.pshh..stchs...tslsslct.....................l.upsss.ps...................hhp-ApthLctaslFp.shstplYulS-hpaW.tou.................pshhcths.slppLshhcp.hhcthhssl.phtLaGcpscch.thhtt.tls...........h.-plhlGuhhsuPschI-hlhphshpta.ssPlhp+L.p.ppp.hstl+plLpclp......................................s............s......................................................t...................................................................shtthhppstp-sphR+RtYhp+lSchuhuplh+Cl+pQcp.lpKhlcVNlhGplhhchhuplhNGFhhRppahpts...ss........shusthsaDtHhalhssLl++plssthLPtLspphacLlNGPLFsHspcpas.P.Nsshhaus-NsGlLPHlK--Ls+hh.u............ssts...s-WhVscaptFasF......ss..hpslsshQ+th.............
//
DBGET integrated database retrieval system