GenomeNet

Database: Pfam
Entry: Peptidase_C23
LinkDB: Peptidase_C23
Original site: Peptidase_C23 
#=GF ID   Peptidase_C23
#=GF AC   PF05379.7
#=GF DE   Carlavirus endopeptidase 
#=GF AU   Studholme DJ
#=GF SE   Manual
#=GF GA   25.00 25.00;
#=GF TC   26.00 25.40;
#=GF NC   24.50 22.70;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 80369284 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   7871721
#=GF RT   Autocatalytic processing of the 223-kDa protein of blueberry
#=GF RT   scorch carlavirus by a papain-like proteinase. 
#=GF RA   Lawrence DM, Rozanov MN, Hillman BI; 
#=GF RL   Virology 1995;207:127-135.
#=GF DR   INTERPRO; IPR008041;
#=GF DR   MEROPS; C23;
#=GF CC   A peptidase involved in auto-proteolysis of a polyprotein from
#=GF CC   the plant pathogen blueberry scorch carlavirus (BBScV)[1].
#=GF CC   Corresponds to Merops family C23. 
#=GF SQ   176
#=GS B6RTB0_9VIRU/802-889    AC B6RTB0.1
#=GS A0JHG2_9VIRU/1-82       AC A0JHG2.1
#=GS C7AGF6_9VIRU/1023-1110  AC C7AGF6.1
#=GS C0L9E8_9VIRU/943-1030   AC C0L9E8.1
#=GS A0JHH6_9VIRU/1-82       AC A0JHH6.1
#=GS B2KTB5_9VIRU/1051-1138  AC B2KTB5.1
#=GS Q0QBU6_9VIRU/971-1058   AC Q0QBU6.1
#=GS W6MY60_9VIRU/1001-1088  AC W6MY60.1
#=GS B3V090_9VIRU/990-1077   AC B3V090.1
#=GS A0JHG1_9VIRU/1-82       AC A0JHG1.1
#=GS A0JHG4_9VIRU/1-82       AC A0JHG4.1
#=GS I2E5K4_9VIRU/907-994    AC I2E5K4.1
#=GS C7AGE9_9VIRU/1024-1111  AC C7AGE9.1
#=GS G3GK38_9VIRU/1200-1287  AC G3GK38.1
#=GS B0LFB7_9VIRU/969-1056   AC B0LFB7.1
#=GS Q2VQN2_9VIRU/992-1079   AC Q2VQN2.1
#=GS A9CMG0_CVB/1095-1182    AC A9CMG0.1
#=GS Q0ILD8_9VIRU/1181-1268  AC Q0ILD8.2
#=GS E7DUD4_9VIRU/1201-1288  AC E7DUD4.1
#=GS C1KD72_9VIRU/1000-1087  AC C1KD72.1
#=GS E7DUC9_9VIRU/1199-1286  AC E7DUC9.1
#=GS Q1RNG5_9VIRU/1181-1268  AC Q1RNG5.1
#=GS B9UZ29_9VIRU/974-1061   AC B9UZ29.1
#=GS Q5L4G0_9VIRU/1081-1167  AC Q5L4G0.1
#=GS J7GS73_9VIRU/1018-1105  AC J7GS73.1
#=GS Q52W18_9VIRU/1181-1268  AC Q52W18.1
#=GS Q0VZD1_9VIRU/989-1076   AC Q0VZD1.1
#=GS Q8QXY8_9VIRU/934-1021   AC Q8QXY8.1
#=GS Q52W13_9VIRU/1181-1268  AC Q52W13.1
#=GS V5LXI8_9VIRU/1042-1129  AC V5LXI8.2
#=GS Q5GR23_9VIRU/1017-1104  AC Q5GR23.1
#=GS A6Q0U1_CVB/1088-1175    AC A6Q0U1.1
#=GS A8C5N0_9VIRU/1159-1246  AC A8C5N0.1
#=GS A0JHI1_9VIRU/1-82       AC A0JHI1.1
#=GS S5TEB8_9VIRU/1000-1087  AC S5TEB8.1
#=GS H6VXK8_9VIRU/1005-1091  AC H6VXK8.1
#=GS G9CHA8_9VIRU/934-1021   AC G9CHA8.1
#=GS A0JHH8_9VIRU/1-82       AC A0JHH8.1
#=GS G5CCW5_9VIRU/954-1041   AC G5CCW5.1
#=GS A0JHG0_9VIRU/1-82       AC A0JHG0.1
#=GS Q7TD32_9VIRU/990-1077   AC Q7TD32.1
#=GS Q4A3Q4_9VIRU/997-1084   AC Q4A3Q4.1
#=GS Q629J0_POPMV/1008-1095  AC Q629J0.1
#=GS A0JHH4_9VIRU/1-82       AC A0JHH4.1
#=GS RDRP_ASPVP/1199-1286    AC Q64962.1
#=GS B2CML7_9VIRU/987-1074   AC B2CML7.1
#=GS A0JHG3_9VIRU/1-82       AC A0JHG3.1
#=GS G4V4X6_9VIRU/1181-1268  AC G4V4X6.1
#=GS W6JBD7_9VIRU/1039-1126  AC W6JBD7.1
#=GS S5RD17_9VIRU/869-956    AC S5RD17.1
#=GS S5RZU7_9VIRU/869-956    AC S5RZU7.1
#=GS T2B4S9_9VIRU/1181-1268  AC T2B4S9.1
#=GS Q17UV0_CVB/1085-1172    AC Q17UV0.1
#=GS A0JHI2_9VIRU/2-67       AC A0JHI2.1
#=GS Q9IH80_9VIRU/1051-1138  AC Q9IH80.1
#=GS Q14QP7_CVB/1088-1175    AC Q14QP7.1
#=GS A0JHH1_9VIRU/1-82       AC A0JHH1.1
#=GS A0JHF8_9VIRU/1-82       AC A0JHF8.1
#=GS Q4A3R1_9VIRU/999-1086   AC Q4A3R1.1
#=GS A6Q0U7_CVB/1087-1174    AC A6Q0U7.1
#=GS V5LXB2_9VIRU/1042-1129  AC V5LXB2.2
#=GS W0LLV7_9VIRU/869-956    AC W0LLV7.1
#=GS B5TRQ1_9VIRU/979-1065   AC B5TRQ1.1
#=GS M9QSD3_9VIRU/1040-1127  AC M9QSD3.1
#=GS G3XFX9_9VIRU/974-1061   AC G3XFX9.1
#=GS M9QR65_9VIRU/1040-1127  AC M9QR65.1
#=GS I1W5T2_9VIRU/999-1086   AC I1W5T2.1
#=GS A8CLZ0_9VIRU/1199-1286  AC A8CLZ0.1
#=GS Q70Z42_9VIRU/990-1077   AC Q70Z42.1
#=GS A0JHI0_9VIRU/1-82       AC A0JHI0.1
#=GS O91901_9VIRU/1181-1268  AC O91901.1
#=GS Q8UZK2_9VIRU/862-949    AC Q8UZK2.2
#=GS V5LXE5_9VIRU/1042-1129  AC V5LXE5.2
#=GS A0JHF9_9VIRU/1-82       AC A0JHF9.1
#=GS A0JHH5_9VIRU/1-82       AC A0JHH5.1
#=GS E5GB05_9VIRU/990-1077   AC E5GB05.1
#=GS W6J954_9VIRU/1050-1137  AC W6J954.1
#=GS K4MWA4_9VIRU/1198-1285  AC K4MWA4.1
#=GS K4HX60_9VIRU/1039-1126  AC K4HX60.1
#=GS V9HWY7_LSV/974-1061     AC V9HWY7.1
#=GS A6Q0V3_CVB/1087-1174    AC A6Q0V3.1
#=GS E7DUC4_9VIRU/1200-1287  AC E7DUC4.1
#=GS W0LLW2_9VIRU/869-956    AC W0LLW2.1
#=GS I1W5T8_9VIRU/999-1086   AC I1W5T8.1
#=GS H6VV73_9VIRU/1005-1091  AC H6VV73.1
#=GS Q9E9R6_9VIRU/1001-1088  AC Q9E9R6.1
#=GS W0G6I8_9VIRU/1199-1286  AC W0G6I8.1
#=GS Q65652_9VIRU/991-1078   AC Q65652.1
#=GS Q9DJV1_9VIRU/1039-1126  AC Q9DJV1.1
#=GS K4MTI1_9VIRU/1055-1142  AC K4MTI1.1
#=GS A0JHH2_9VIRU/1-82       AC A0JHH2.1
#=GS A4ZWC5_9VIRU/1010-1097  AC A4ZWC5.1
#=GS A0JHG5_9VIRU/1-82       AC A0JHG5.1
#=GS O91632_9VIRU/1036-1123  AC O91632.1
#=GS K7RCS7_9VIRU/1181-1268  AC K7RCS7.1
#=GS A0JHG7_9VIRU/1-82       AC A0JHG7.1
#=GS Q17UV1_CVB/1084-1171    AC Q17UV1.1
#=GS A0JHH0_9VIRU/1-82       AC A0JHH0.1
#=GS A0JHH7_9VIRU/1-82       AC A0JHH7.1
#=GS C7B9H4_9VIRU/1052-1139  AC C7B9H4.1
#=GS E7DUB9_9VIRU/1200-1287  AC E7DUB9.1
#=GS A4V8J8_LSV/974-1061     AC A4V8J8.1
#=GS I2E5L0_9VIRU/905-992    AC I2E5L0.1
#=GS B5AMI8_9VIRU/979-1065   AC B5AMI8.1
#=GS A0JHI3_9VIRU/1-82       AC A0JHI3.1
#=GS Q91UJ3_9VIRU/1008-1095  AC Q91UJ3.1
#=GS Q70WL7_LSV/974-1061     AC Q70WL7.1
#=GS K4HRQ0_9VIRU/1038-1125  AC K4HRQ0.1
#=GS C1KD78_9VIRU/1000-1087  AC C1KD78.1
#=GS E0WN95_9VIRU/1181-1268  AC E0WN95.1
#=GS K0M7B2_9VIRU/1199-1286  AC K0M7B2.1
#=GS W6JAR5_9VIRU/1051-1138  AC W6JAR5.1
#=GS L7RZN1_9VIRU/891-978    AC L7RZN1.1
#=GS R4HZZ5_9VIRU/990-1077   AC R4HZZ5.1
#=GS B2KTC2_9VIRU/1051-1138  AC B2KTC2.1
#=GS M9PQ22_9VIRU/992-1079   AC M9PQ22.1
#=GS A0JHG9_9VIRU/1-82       AC A0JHG9.1
#=GS A0AAQ6_9VIRU/905-992    AC A0AAQ6.1
#=GS V5M029_9VIRU/1050-1137  AC V5M029.2
#=GS S5RFF1_9VIRU/864-951    AC S5RFF1.1
#=GS I1ZEE7_9VIRU/1000-1087  AC I1ZEE7.1
#=GS M9PQ39_9VIRU/934-1021   AC M9PQ39.1
#=GS Q7TD38_9VIRU/990-1077   AC Q7TD38.1
#=GS B9UZ23_9VIRU/974-1061   AC B9UZ23.1
#=GS X2KTS4_9VIRU/1010-1097  AC X2KTS4.1
#=GS E5KJF1_9VIRU/849-936    AC E5KJF1.1
#=GS H6VXL4_9VIRU/1005-1091  AC H6VXL4.1
#=GS V5LXA9_9VIRU/1050-1137  AC V5LXA9.2
#=GS W6JAS2_9VIRU/1050-1137  AC W6JAS2.1
#=GS Q993S7_9VIRU/807-892    AC Q993S7.1
#=GS S5S1L3_9VIRU/862-949    AC S5S1L3.1
#=GS Q9YP86_9VIRU/132-220    AC Q9YP86.1
#=GS F6KH09_9VIRU/934-1021   AC F6KH09.1
#=GS A0JHG8_9VIRU/1-82       AC A0JHG8.1
#=GS E3Q0A2_9VIRU/1200-1287  AC E3Q0A2.1
#=GS R4RRY0_9VIRU/1000-1087  AC R4RRY0.1
#=GS A0JHH3_9VIRU/1-82       AC A0JHH3.1
#=GS D7RJV8_LSV/974-1061     AC D7RJV8.1
#=GS H6VXL1_9VIRU/1005-1091  AC H6VXL1.1
#=GS Q67654_9VIRU/934-1021   AC Q67654.1
#=GS A7TZR7_9VIRU/1004-1091  AC A7TZR7.1
#=GS A3KL92_CVB/1091-1178    AC A3KL92.2
#=GS Q4F978_9VIRU/994-1081   AC Q4F978.1
#=GS S5RCZ6_9VIRU/869-956    AC S5RCZ6.1
#=GS S5RKI7_9VIRU/872-956    AC S5RKI7.1
#=GS V5LXC8_9VIRU/1050-1137  AC V5LXC8.2
#=GS I6YB60_9VIRU/968-1055   AC I6YB60.1
#=GS Q6RBY9_9VIRU/1008-1095  AC Q6RBY9.1
#=GS Q3HM15_9VIRU/957-1044   AC Q3HM15.2
#=GS Q4U0G5_9VIRU/959-1046   AC Q4U0G5.2
#=GS A0JHF7_9VIRU/1-82       AC A0JHF7.1
#=GS Q9E948_9VIRU/1201-1288  AC Q9E948.1
#=GS A1KWR5_LSV/974-1061     AC A1KWR5.1
#=GS RDRP_PVMR/991-1078      AC P17965.2
#=GS Q70M02_LSV/974-1061     AC Q70M02.1
#=GS RDRP_CLBVS/979-1065     AC Q91QZ3.1
#=GS G9CHA2_9VIRU/992-1079   AC G9CHA2.1
#=GS M9QSF7_9VIRU/1039-1126  AC M9QSF7.1
#=GS Q17UU9_CVB/1084-1171    AC Q17UU9.1
#=GS V5LXE8_9VIRU/1042-1129  AC V5LXE8.2
#=GS W6JAT2_9VIRU/1050-1137  AC W6JAT2.1
#=GS Q91BP7_9VIRU/955-1043   AC Q91BP7.1
#=GS L8E8Z2_9VIRU/1000-1087  AC L8E8Z2.1
#=GS B5AMJ0_9VIRU/979-1065   AC B5AMJ0.1
#=GS W8Q345_9VIRU/991-1078   AC W8Q345.1
#=GS B3VKH1_9VIRU/972-1059   AC B3VKH1.2
#=GS G3GK45_9VIRU/1200-1287  AC G3GK45.1
#=GS A8II53_9VIRU/1045-1132  AC A8II53.1
#=GS A0JHG6_9VIRU/1-82       AC A0JHG6.1
#=GS O91724_9VIRU/1181-1268  AC O91724.1
#=GS W6JBD2_9VIRU/1052-1139  AC W6JBD2.1
#=GS I6M3V6_9VIRU/968-1055   AC I6M3V6.1
#=GS Q17UV2_CVB/1084-1171    AC Q17UV2.1
#=GS Q2VQN8_9VIRU/991-1078   AC Q2VQN8.1
#=GS A0JHH9_9VIRU/1-82       AC A0JHH9.1
#=GS J9SK69_9VIRU/1181-1268  AC J9SK69.1
B6RTB0_9VIRU/802-889               .....e-NDCVITACAQALAREPEDVVKVLKDRLE.ESILEEIWNGEGVPFERMYLFFEALDIQAHCNRDGAQLVLNGGGKLARCFVIKEDHIE-f..
A0JHG2_9VIRU/1-82                  .....t-------AIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPHGKISALFDITNEHIR-h..
C7AGF6_9VIRU/1023-1110             .....v-ETCTIKALAECLKRREMDVLTFVSKAMG.HEFLESLVAGEGLTIEQFSGMANLLGINSVVEMNGEIFRFNEVGNVSGLFRFENGHAT-f..
C0L9E8_9VIRU/943-1030              ......RNDCVPRAIAEALGRSLREVFGVLSRKEN.SSLYALLGGSGGVDIDDLEDFFNLFDIRAYVDLDGKWYSLNPKGHLERHFNLNDGHMTF...
A0JHH6_9VIRU/1-82                  .....t-------AIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEVEVINPCGKISALFDITNEHIR-h..
B2KTB5_9VIRU/1051-1138             ......KEGCVIRAVSEFLKQNPTKILSVLSANCS.KDLLHELMSGLGIQEFFLEEIFSVFDINAEVSDGEKTRNLNPKGSRHAKFLAEQGHFSY...
Q0QBU6_9VIRU/971-1058              .....i-EGCTIKALADCVKRQEKEVFSVLAHSMG.REFLREVLEGKGVSLEQFATMCNTLDVRAVLELEEGTMLVNEVGRIEGYFSLLEGHA--vf.
W6MY60_9VIRU/1001-1088             ......RNNCVVRAIADGLNRLECEVQHVLERKCA.PVLLEDLRKGRGLEPMNLELVFSCFGVCALVDVGGRTVVYNEAGGTHMQFTLHDEHLSY...
B3V090_9VIRU/990-1077              ......RNGCVIESVALALGRRNADILAVVEXRCC.EEXVESVQAGLGLNLHHVEIVLRCFDIVGHCNLGDKEITLNAGGKMXFCFDISDEHMSF...
A0JHG1_9VIRU/1-82                  .....t-------AIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPCGKISALFDITNEHIR-h..
A0JHG4_9VIRU/1-82                  .....t-------AIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVVNPRGKISALFDITNEHIR-h..
I2E5K4_9VIRU/907-994               .....k-EDCAIVAVSETLNRRYQDVYRVLNREEN.SYILREMEEEKGVNLTTFERILSLFSIKGFCTVDGEIVVLNDGGNFEAYYCISEGHIS-k..
C7AGE9_9VIRU/1024-1111             ....ie--TCTIKALAECLKRREIDILTLVAKAMG.HEFLESLLAGTGLTIDQFSCMATLLGINSVVEMNGEVFRFNVEGNICGLFRFENGHAT-f..
G3GK38_9VIRU/1200-1287             ......VNGCVIRAIASALNRREVDVLAVLGKPAH.EDLFEEVAEGRGFSIFDLTRLFEIFSICGSVDTGRELIMVNENGRIPAEFSLEKEHLSH...
B0LFB7_9VIRU/969-1056              ....vs--ACSLIAISELLQRSLVEITKAAIRNMG.AAFEEELFKGKGVDLPTFTRLLQIFGIRGFLVKENETVEVNAEGTIPGKFKIEGDHIS-l..
Q2VQN2_9VIRU/992-1079              .....k-EMCVIKAIAEAVKRTPMDILAVALKRMG.ENFKEQICGGRGVMLDVFMALAKIFDVNACVLQGTEQLMINPKGRIKGLFRQTADHMSY...
A9CMG0_CVB/1095-1182               ......KNSCLLHAIAHALNRQFHEVLTVVERVLG.SCLSGETWVGQGIDVADLEFYFGLFDIRACVISGPSAATYNEEGRVVANFILSDGHIT-y..
Q0ILD8_9VIRU/1181-1268             .....l-NGCMITAIAAALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEIINPGGRISALFDITNEHIM-h..
E7DUD4_9VIRU/1201-1288             ......VNGCVIRAIASALGRREVDVLAVLGKPAH.EDLFDEVSEGRGFSIFDLSRLFEIFSICGSVDTGGELIMVNEGGRIPAEFSLEKEHLAH...
C1KD72_9VIRU/1000-1087             ......RNDCVLVAVASVLRRRVEEVLSILGAQLG.NEFLQDVLKGEGINRDKLAVVFKLFDICAHIHAEGEVFVINSEGRLHGTFNLSKDHIE-h..
E7DUC9_9VIRU/1199-1286             ......VNGCVIRAIASALGRREVDVLAILGKPAH.EDLFDEVSEGRGFSIFDLSRLFEIFSICGSVDTGGELIMVNENGRIPAEFSLEKEHLAH...
Q1RNG5_9VIRU/1181-1268             .....l-NGCMITAIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDVNGEIEVINPGGRISALFDITNEHIR-h..
B9UZ29_9VIRU/974-1061              ......RNDCVIVAGASALSRSVKDIYKVLMRREY.ALIFKQLCAGEGLSLMLLGQFFSIFDIHAYINFEGEHMEVNESGSLKRCFTVEQEHITH...
Q5L4G0_9VIRU/1081-1167             .....a-NDCCIRAVADALERPTEQVIEVLRCKGG.TDLMEEVTSGQGLELEHFEQVLTLFDICGVC-FGDFDTVLNEGGRLLFYFYVEDGHVE-h..
J7GS73_9VIRU/1018-1105             .....i-NDCLLKSIAEALGRPFRDVLRVVSTKGN.SMIYQDLINGDGVPKWLIERCFELFGIKGLVNWDGELTVVNPAGKFEHSFDLTGDHI--ey.
Q52W18_9VIRU/1181-1268             .....i-NGCMITAIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPNGKISALFDITNEHIR-h..
Q0VZD1_9VIRU/989-1076              ......RNGCVVQAIAAALGRREAEVLKVIETKGT.TELCQQLWVGDGLDLLLVELAFKCFSIVAHVNFGETESILNSDGTAHYQFSCSEGHIT-y..
Q8QXY8_9VIRU/934-1021              ......KNDCFVSAVAQTFSRDTNEMYRVLADKKF.DELTELLRLGCGLTIEDLEVGFKLLNIKAHIMKDGEYLQINDSGEINGFYSLTDEHL--va.
Q52W13_9VIRU/1181-1268             .....l-NGCMITAIASALGRREVDVLNYLCKPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPNGKISALFDITNEHIR-h..
V5LXI8_9VIRU/1042-1129             ......KEGCVVRAVSEFLKQNPTKILSVLSANCS.KELLHELMSGLGIQEFHLEEIFSIFDICAEVSDGTSSRVLNKKGSRAAKFVVDKDHFSF...
Q5GR23_9VIRU/1017-1104             .....a-NCCVPRAIAAAYKRSLSEILAVIREHCD.ESVSSEIWNGEGVNEMHMLLLFECFDIRADVVQQGVSTVFNEAGRVRFSFHLEDKHLTF...
A6Q0U1_CVB/1088-1175               .....i-NGCVVKAMASALNRKESEVMHVIEENCD.PMMVTSLWNGEGVDLGVFHSLLELFSIKALIFEGSREVLYNREGRFEASFEIKGDHIE-h..
A8C5N0_9VIRU/1159-1246             ......VNGCVVRAIASALGRREIDVLAVLGKPEH.RDLYEDACSGNGFCVYDLERLFEIFSIRARLDHQGSLICLNEDGKISAEFSLEKEHLI-h..
A0JHI1_9VIRU/1-82                  .....t-------AIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPRGKISALFDITNEHIR-h..
S5TEB8_9VIRU/1000-1087             ......RNDCVLVAVASVLRRRVGEVLSILGAQLG.NEFLQDVLKGEGINRDKLAVVFELFDICAHVHAEGEVFMINPEGRLHGTFNLSKDHIE-h..
H6VXK8_9VIRU/1005-1091             ......RNVCLIRALSKALNRGMQAIIAKLKTVNN.PFWSRFLSDGNGGSVEDCLAACEALGITVDLFVDGKCLVLGE-GAVRVSLALKDNHFSV...
G9CHA8_9VIRU/934-1021              ......KNDCFISAVAQTFSRDTNEMYKVLADKKF.DELTELLRLGCGLTLEDLEVGFKLLNIKAHINKDGEYLQINDSGEINGFYSLTDEHL--va.
A0JHH8_9VIRU/1-82                  .....t-------AIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEVEVINPHGKISALFDITNEHIR-h..
G5CCW5_9VIRU/954-1041              ......KSGCTFKALAKCLGRREQDVVATLSKQLG.QDFIDDTMKGQGLSLAQFSDMLKGLGISALVEVNGQHFQLHSEGAIKGAFRLVDGHAT-f..
A0JHG0_9VIRU/1-82                  .....t-------AISSALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPHGKISALFDITNEHIR-h..
Q7TD32_9VIRU/990-1077              ......RNGCVIESVAQALGRRNADILAVVEERCC.EEVVESVQAGLGLNLHHVEIVLQCFDIVGHCNLGDKEITLNAGGKMSFCFDISDEHMSF...
Q4A3Q4_9VIRU/997-1084              ......RNDCVLVAVASVLRRRVEEVLSILGAQLG.NEFLQDVLKGEGIDRDKLAVVFKLFDICAHIHAEGEVFVINSEGRLPGTFNLSKDHIE-h..
Q629J0_POPMV/1008-1095             ......KNDCVITATVEALGRSYADVFGVLSRVSN.SHILAEVNSGEGVSSFILEEYFKLFGIQASIIWDGELICLNEIGREKKAFEIVEGHMTH...
A0JHH4_9VIRU/1-82                  .....t-------AIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEVEVINPHGKISALFDITNEHIR-h..
RDRP_ASPVP/1199-1286               ......VNGCVIRAISSALNRREVDVLAVLGKPAH.EDLFEEVAEGRGFSIFDLTRLFEIFSICGSVDTGGELIMVNENGRIPAEFSLEKEHLAH...
B2CML7_9VIRU/987-1074              ......KNGCVITSVADGLGRKESEVQAVLEQQAA.PSLLDEIWSGLGLTQIGMELVFKCFDIAAHVVEEGKVALYNESGSLHLMFNMESGHLSF...
A0JHG3_9VIRU/1-82                  .....t-------AIAAALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEIINPGGRISALFDITNEHIR-h..
G4V4X6_9VIRU/1181-1268             .....l-NGCMITAIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPRGKISALFDITNEHIR-h..
W6JBD7_9VIRU/1039-1126             ......KEGCVVRAVSEFLKQNPTKILSVLSANCS.KELLHELMSGLGIQEFHLEEIFSIFDICAEVSDGVSSRVLNKKGSRAAKFIVDKDHFSF...
S5RD17_9VIRU/869-956               ......KNLCVVHAISKALRRRPDEIISVLSREDY.RDLYAELMQGQGLELARLELIFDIFSHTCFVQIGSELLEMNKEGNCCACFDLREQHI--ey.
S5RZU7_9VIRU/869-956               ......KNLCVVHAISKALRRRPDEVISVLSREDY.RDLYAELMQGQGLELARLELIFDIFSIHAFVQIGSELLEMNKEGNCCACFDLREQHI--ey.
T2B4S9_9VIRU/1181-1268             .....i-NGCMITAIASALGRREVDVLIYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPNGKISALFDITNEHIR-h..
Q17UV0_CVB/1085-1172               .....i-NGCVVKAMASALNRKESEVMHVIEENCD.PMMVTSLWNGEGVDLGVFHSLLELFSIKALIFEGSREVLYNREGRFEASFEIKGDHIE-h..
A0JHI2_9VIRU/2-67                  ....yl------------------------SRPST.NPIFDQLCRGGGLHIMYLAEAFEAFDICAKCDINGEIEVINPHGKISALFDITNEHIR-h..
Q9IH80_9VIRU/1051-1138             ......KEGCVIRAVSEFLKQNPTKILSVLSANCS.KDLLHELMSGLGIQEFFLEEIFSVFDINAEVSDGEKTRNLNPKGSRYAKFLAEQGHFSY...
Q14QP7_CVB/1088-1175               .....i-NGCVVKAMASALNRKESEVMHVIEENCD.PMMVTSLWNGEGVDLGVFHSLLELFSIKALIFEGSREVLYNREGRFEASFEIKGDHIE-h..
A0JHH1_9VIRU/1-82                  .....t-------AIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPRGKISALFDITNEHIR-h..
A0JHF8_9VIRU/1-82                  .....t-------AIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPNGKISALFDITNEHIR-h..
Q4A3R1_9VIRU/999-1086              ......RNDCVLVAVASVLRRRVEEVLSILGAQLG.NEFLQDVLKGEGIDRDKLAVVFKLFDICAHIHAEGEVFVINSEGRLPGTFNLSKDHIE-h..
A6Q0U7_CVB/1087-1174               .....i-NGCVVKAMASALNRKESEVMHVIEENCD.PMMVTSLWNGEGVDLGVFHSLLELFSIKALIFEGSREVLYNREGRFEASFEIKGDHIE-h..
V5LXB2_9VIRU/1042-1129             ......KEGCVVRAVSEFLKQNPTKILSVLSANCS.KELLHELMSGLGIQEFHLEEIFSIFDICAEVSDGTSSRVLNRKGSRAAKFIVDKDHFSF...
W0LLV7_9VIRU/869-956               ......KNLCVVHAISKALRRRPDEVISVLSREDY.RDLYAELMQGQGLELARLELIFDIFSIHAFVQIGSELLEMNKEGNCCACFDLREQHT--ey.
B5TRQ1_9VIRU/979-1065              ......KNTCLINAFSKAMKRSKQAIIAKLKTVNS.PFWSRYLSEGNGGSIEDCQSACEALDVTVDLNVNGKYVVLGK-GALRISMALKNNHFSV...
M9QSD3_9VIRU/1040-1127             ......KEGCVVRAVSEFLKQNPTKILSVLSANCS.KDLLHELMSGLGIQEFHLEEIFSIFDICAEVSDGASSRVLNKKGSRSAKFIVDKDHFSF...
G3XFX9_9VIRU/974-1061              ......RNDCVIVAGASALSRPVKDVYKVLMRREH.SLIFKQLCAGEGLSLMLLGQFFSIFDIHAYINFEGEHMEVNESGSLKRCFTVEQEHIAH...
M9QR65_9VIRU/1040-1127             ......KEGCVVRAVSEFLKQNPTKILSVLSANCS.KELLHELMSGLGIQEFHLEEIFSIFDICAEVSDGVSSRVLNKKGSRSAKFVVDKDHFSF...
I1W5T2_9VIRU/999-1086              ......VNDCLAVAIAAHLDRKVEDVINVLSKQMD.EASFMDLWCGKGVDVSFLPLIFEMFNIEALVTGKGEDILINAGAEFKGVYDIVEEHIT-y..
A8CLZ0_9VIRU/1199-1286             ......RNGCVHRAASSGPGRRAADLLAVLGNPAH.EKIFEEVADGRGFSIFDLTRLFEIFSICGSVDTGREFIKFNENGRISAELSFEKEHLA-r..
Q70Z42_9VIRU/990-1077              ......RNGCVIESVALALGRRNADILAVVEERCC.EEVVESVQAGLGLNLHHVEIVLQCFDIVGHCNLGDKEITLNAGGKMSFCFDISDEHMSF...
A0JHI0_9VIRU/1-82                  .....t-------AIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPRGKISALFDITNEHIR-h..
O91901_9VIRU/1181-1268             .....l-NGCMITAIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPCGKISALFDITNEHIR-h..
Q8UZK2_9VIRU/862-949               ......KNGCVIRAIAEFLNQKPAKVLSVISKECS.KELVEDIMSGLGVQPVHLKELFSFFDIAAEVRENGNSRLINAKGSRSATFQISDDHMTF...
V5LXE5_9VIRU/1042-1129             ......KEGCVVRAVSEFLKQNPTKILSVLSANCS.KELLHELMSGLGIQEFHLEEIFSIFDICAEVSDGVSSRVLNRKGSRAAKFVVDKDHFSF...
A0JHF9_9VIRU/1-82                  .....t-------AIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPRGKISALFDITNEHIR-h..
A0JHH5_9VIRU/1-82                  .....t-------AIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLTEAFEAFDICAKCDINGEIEVINPNGKISALFDITNEHIR-h..
E5GB05_9VIRU/990-1077              ......RNGCVIESVALALGRRNVDILAVVEERCC.EEVVGSVQAGLGLNLHHVEIVLQCFDIVGHCNLGDKEVTLNAGGKMSFCFDISDEHMSF...
W6J954_9VIRU/1050-1137             ......KEGCVIRAISEFLKQNPTKILSVLSANCS.KELLHELMSGLGVQEFFLEEIFKVFDICAEVSDGEKSRIINSKGSRSAKFTVEQDHFSF...
K4MWA4_9VIRU/1198-1285             .....l-NGCMITAIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPRGKISALFDITNEHIR-h..
K4HX60_9VIRU/1039-1126             ......KEGCVARAVSEFLRQNPTKILSVLSANCS.KELLAELMSGLGIQEFHLEEIFRVFDIKAEVCDGSELRIINKKGSREARFAVENDHFSY...
V9HWY7_LSV/974-1061                ....la--ACTIKALASCLDRRFTEVSSLLYKRLG.TDFMDNALAGQGMELETFREMLVELQICAVVEQAGGTIMLNDKGQTKGIFKFLDGH---aeh
A6Q0V3_CVB/1087-1174               .....i-NGCVVKAMASALNRKESEVMHVIEENCD.PMMVTSLWNGEGVDLGVFHSLLELFSIKALIFEGSREVLYNREGRFEASFEIKGDHIE-h..
E7DUC4_9VIRU/1200-1287             ......VNGCVIRAIASALGRREVDVLAVLGKPAH.EDLFDEVSEGRGFSIFDLSRLFEIFSICGSVDTGGELIMVNEGGRIPAEFSLEKEHLAH...
W0LLW2_9VIRU/869-956               ......KNLCVVHAISKALRRRPDEVISVLSREDY.RDLYAELMQGQGLELARLELIFDIFSIHAFVQIGSELLEMNKEGNCCACFDLREQHI--ey.
I1W5T8_9VIRU/999-1086              ......VNDCLPVAIAAHLDRKVEDVINVLSNQMD.EASFMDLWCGKGVDVSFLPLIFEMFNIEALVTGKGEDILINAGAEFKGVYDIVGEHIT-y..
H6VV73_9VIRU/1005-1091             ......RNVCLIRALSKALNRGMQAIIAKLKTVNN.PFWSRFLSDGNGGSVEDCLAACEALGITVDLFVDGKCLVLGE-GAVRVSLALKDNHFSV...
Q9E9R6_9VIRU/1001-1088             ......RNNCVVRAIADGLNRLECEVQHVLERKCA.PVLLEDLRKGRGLEPMNLELVFSCFGVCALVDVGGRTVVYNEGGGTHMQFTLYNEHLSY...
W0G6I8_9VIRU/1199-1286             ......VNGCVIRAISSALGRREVDVLAVLGKPAY.EDLFEEVAEGRGFSIFDLTRLFEIFSICGSVDTGGELIMVNENGKIPAEFSLEKEHLAH...
Q65652_9VIRU/991-1078              .....k-EMCVVKAIAQAVKRSPMDVLRVALKKMG.EDFKEQICRGKGVMLDVFMVLAKIFDVSACVLQGTEQIMINPKGRIKGLFRMTTDHLSY...
Q9DJV1_9VIRU/1039-1126             ......KEGCVIRAVSEFLRQNPTKILSVLSANCS.KELLAELMSGLGIQEFHLEEIFRVFDIKAEVCDGSELRVINKKGSREARFAVENDHFSY...
K4MTI1_9VIRU/1055-1142             ......KNGCVVRAVAACIGKKEIDVLSYLGRGEF.TDIYNQIMSGNGLSILDFERAFSMFGIKAFLETDGKVLEINSNGSIEGSFRLTDDHLE-f..
A0JHH2_9VIRU/1-82                  .....t-------AIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPRGKISALFDITNEHIR-h..
A4ZWC5_9VIRU/1010-1097             ......KNACVVRAVASALNRRCCEVLKVLDDAGD.LGEDSPLLSGQGVELAELEHYFALFGIAALVVTHTTSHQLNVQGAVPATFRLHDGHID-h..
A0JHG5_9VIRU/1-82                  .....t-------AIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEVEVINPRGKISALFDITNEHIR-h..
O91632_9VIRU/1036-1123             ......KEGCVIRAVSEFLKQNPTKILSVLSANCS.KELLAELMSGLGIQEFHLEEIFRVFDIKAEVCDGSELRIINKKGSREARFAVENDHFSY...
K7RCS7_9VIRU/1181-1268             .....i-NGCMITAIASALGRREVDVLNYLCKPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPNGKISALFDITNEHIR-h..
A0JHG7_9VIRU/1-82                  .....t-------AIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPNGKISALFDITNEHIR-h..
Q17UV1_CVB/1084-1171               .....i-NGCVVKAMASALNRKESEVMHVIEENCD.PMMVTSLWNGEGVDLGVFHSLLELFSIKALIFEGSREVLYNREGRFEASFEIKGDHIE-h..
A0JHH0_9VIRU/1-82                  .....t-------AIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPRGKISALFDITNEHIR-h..
A0JHH7_9VIRU/1-82                  .....t-------AIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPRGKISALFDITNEHIR-h..
C7B9H4_9VIRU/1052-1139             .....i-NGCVVKSIAETLNQTEAKILSVIGRPNN.RLILEGLVEGEGLNIEDLEAAFSVFGICARVSTERGVFTLNKEGNLHANYELKSGHI--my.
E7DUB9_9VIRU/1200-1287             ......VNGCVIRAIASALNRREVDVLAVLGKPAH.EDLFDEVSEGRGFSIFDLSRLFEIFSICGSVDTGGELIMVNEGGRIPAEFSLEKEHLAH...
A4V8J8_LSV/974-1061                ....la--ACTIKALASCLDRRFTEVSSLLYKRLG.TDFMDNALAGQGMELETFREMLVELQICAVVEQAGGTIMLNDKGQTKGIFKFLDGH---aeh
I2E5L0_9VIRU/905-992               .....k-EDCAIIAVSETLNRRYQDVYKVLNREEN.SSILREMEEEKGVSLTTFERILKIFSIKGFCIVDRETVLLNEGGNFEAYFCISEGHI--ek.
B5AMI8_9VIRU/979-1065              ......KNTCLIDAFSKAMKRSKQAIIAKLKTVNS.PFWSRYLSEGNGGSIEDCQSACEALDVTVDLNVSGKYVVLGK-GAFRISMALKDNHFSV...
A0JHI3_9VIRU/1-82                  .....t-------AIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPNGRMSALFDITNEHIR-h..
Q91UJ3_9VIRU/1008-1095             ......KNGCVIVAVAEAIGRTNAEVQQVLNDCCC.DGLLKEIWRGEGLQRNDMELVFKAFDIEAYVTENDDTRVYNASGTLRKNFKLVNSHLSY...
Q70WL7_LSV/974-1061                ....la--ACTIKALASCLDRRFTEVSSLLYKRLG.TDFMDNALAGQGMELETFREMLVELQICAVVEQAGGTIILNDKGQTKGIFKFLDGH---aeh
K4HRQ0_9VIRU/1038-1125             ......KEGCVIRAVSEFLKQNPTKILSVLSANCS.KELLAELMSGLGIQEFHLEEIFRVFDIKAEVCDGSELRVINKKGSREARFAVENDHFSY...
C1KD78_9VIRU/1000-1087             ......RNDCVLVAVASVLRRRVEEVLSILGAQLG.NEFLQDVLKGEGINRDKLAVVFRLFDICAHIHAEGEVFVINSEGRLHGTFNLSKDHIE-h..
E0WN95_9VIRU/1181-1268             .....l-NGCMITAIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPNGKISALFDITNEHIR-h..
K0M7B2_9VIRU/1199-1286             ......VNGCVIRAIASALSRREVDVLAVLGKPAH.EDLFEEVAEGRGFSIFDLTRLFEIFSICGSVDTGGELIMVNENGRIPAEFSLEKEHLAH...
W6JAR5_9VIRU/1051-1138             ......KEGCVIRAVSEFLKQNPTKILSVLSANCS.KDLLHELMSGLGIQEFFLEEIFSVFDINAEVSDGEKTRNLNPKGSRHAKFLAEQGHFSY...
L7RZN1_9VIRU/891-978               ......RNDCVLVAVASVLRRRIEEVLSILGAQLG.SEFLQDVLKGEGINRDQLAVVFKLFDICAHIHAESEEFIVNPEGRLHGTFNLSRDHIE-h..
R4HZZ5_9VIRU/990-1077              ......RNGCVIESVAQALGRRNADILAVVEERCC.EEVVESVQAGLGLNLHHVEIVLQCFDIVGHCNLGDKEITLNAGGKMSFCFDISDEHMSF...
B2KTC2_9VIRU/1051-1138             ......KEGCVIRAVSEFLKQNPTKILSVLSANCS.KDLLHELMSGLGIQEFFLEEIFSVFDINAEVSDGEKTRNLNPKGSRHAKFLAEQGHFSY...
M9PQ22_9VIRU/992-1079              .....t-NDCVLVALEHGLGRKRGDILKVLCRPQH.SDIFQIATGGVGLTLELLEPIFQCFQIDARVLCGSEVFTYPASGTFALDFELADGHLTF...
A0JHG9_9VIRU/1-82                  .....t-------AIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPRGKISALFDITNEHIR-h..
A0AAQ6_9VIRU/905-992               .....k-EDCAIIAVSETLNRRYQDVYKVLNREEN.SSILREMEEEKGVSLTTFERILKIFSIKGFCIVDRETVLLNEGGNFEAYFCISEGHI--ek.
V5M029_9VIRU/1050-1137             ......KEGCVIRAISEFLKQNPTKVLSVLSANCS.KELLHELMSGLGIQEFFLDEIFKVFDICAEVSDGEKSRILNANGSRSAKFTVEQDHFSF...
S5RFF1_9VIRU/864-951               ......KNLCVVHAISKALRRRPDEVISVLSREDY.RDLYAELMQGQGLELARLELIFDIFSHTCFVQIGSELLEMNKEGNCCACFDLREQHI--ey.
I1ZEE7_9VIRU/1000-1087             ......RNDCVLVAVASVLRRRSEEVLSILGAQLG.SEFLQDVLKGEGINRDQLAVVFKLFDICAHIHAESEAFVVNPDGRLHGTFNLSKDHIE-h..
M9PQ39_9VIRU/934-1021              ......KNDCFISAVAQTFSRDVNEMYKVLADKKF.DEITELLRLGCGLTLEDLEVGFKLLNIKAHINKDGEYLQINDSGEINGFYSLTDEHL--va.
Q7TD38_9VIRU/990-1077              ......RNGCVIESVAQALGRRNADILAVVEERCC.EEVVESVQAGLGLNLHHVEIVLQCFDIVGHCNLGDKEITLNAGGKMSFCFDISDEHMSF...
B9UZ23_9VIRU/974-1061              ......RNDCVIVAGASALSRPVKDVYKVLMRREH.SLIFKQLCAGEGLSLMLLGQFFSIFDIHAYINFEGEHMEVNESGSLKRCFTVEQEHIAH...
X2KTS4_9VIRU/1010-1097             ......KNSCVIRAIASAMNRECHEVLKVLEESGD.LEEGSLLLSGLGVELAELEHFFSLFGIAALVEAGGTEHRLNETGPVPAYFKLENAHIE-h..
E5KJF1_9VIRU/849-936               ......KNLCVVSAVAEALSRTEGDVIEVLKRPDY.QDLAESVMCGQGVRVEDLESIFRVFSIKALVSFGDKDLILNPDGNCCACFKLENNHLSY...
H6VXL4_9VIRU/1005-1091             ......RNVCLIRALSKALNRGMQAIIAKLKTVNN.PFWSRFLSDGNGGSVEDCLAACEALGITVDLFVDGKCLVLGE-GAVRVSLALKDNHFSV...
V5LXA9_9VIRU/1050-1137             ......KEGCVIRAVSEFLKQNPTKVLSVLSANCS.KELLHELMSGLGIQEFFLEEIFSIFDICAEVSDGETSRTLNKKGSRSAKFIVDHDHFSY...
W6JAS2_9VIRU/1050-1137             ......KEGCVIRAVSEFLKQNPTKILSVLSANCS.KELLHELMSGLGIQEFFLEEIFSIFDICAEVSDGQTSRTLNKKGSRAAKFIVDNDHFSY...
Q993S7_9VIRU/807-892               ......KNICVVKCISKIIKRPCFYVMRRIYN-AC.RHIYHELQEGHGLDITFLGELFNSLGLHVQVHIDGDIFEFGSVGPIS-EVIIENNHMS-i..
S5S1L3_9VIRU/862-949               ......KNLCVVHAISKALRRRPDEVISVLSREDY.RDLYAELMQGQGLELARLELIFDIFSIHAFVQIGSELLEMNKEGNCCACFDLREQHI--ey.
Q9YP86_9VIRU/132-220               .....i-NSCVIDAISKAVDIPPLNVQRMISSQESlHSEYERLSSGKSFDLLGLESLMTFFNIGAEVQENGHKFILSENGSRARSFILENNHIE-f..
F6KH09_9VIRU/934-1021              ......KNDCFVSAVAQTFSRDTNEMYRVLAHKKF.EELTELLRLGCGLTLEDLEVGFKLLNIKAHIKKDGEYLQINDSGEINGFYSLTDEHL--vs.
A0JHG8_9VIRU/1-82                  .....t-------AIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINEEIEVINPNGKISALFDITNEHIR-h..
E3Q0A2_9VIRU/1200-1287             ......VNGCVIRAISSALNRREVDVLAVLGKPAH.EDLFEEVAEGRGFSIFDLTRLFEIFSSCGSVDTGGELIMVNENGKIPAEFSLEKEHLAH...
R4RRY0_9VIRU/1000-1087             ......RNDCVLVAVASVLRRRVEEVLSILGAQLG.AEFLQDVLKGEGIDRDLLAVVFKLFDICAHVHSESEVFVINPDGRLQGTFNLSKDHIE-h..
A0JHH3_9VIRU/1-82                  .....t-------AIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPRGKISALFDITNEHIR-h..
D7RJV8_LSV/974-1061                ....la--ACTIKALASCLDRRFTEVSSLLYKRLG.TDFMDNALAGQGMELETFREMLVELQICAVVEQAGGTIILNDKGQTKGIFKFLDGH---aeh
H6VXL1_9VIRU/1005-1091             ......RNVCLIRALSKALNRGMQAIIAKLKTVNN.PFWSRFLSDGNGGSVEDCLAACEALGITVDLFVDGKCLVLGE-GAVRVSLALKDNHFSV...
Q67654_9VIRU/934-1021              ......KNDCFVSAVAQTFSRDTNEMYRVLADKKF.DELTELLRLGCGLTLEDLEIGFRLLNIKAHINKDGEYLLINETGEINGFYALTEEHL--va.
A7TZR7_9VIRU/1004-1091             ......KNDCALLAVAETLGRTKREVTEVVCKAKH.GGLLRSMRTGEGLKVELLGELFKIFSIKALVKCNGQLHRLNPEGKILGHYRLEDGHIQ-v..
A3KL92_CVB/1091-1178               .....i-NGCVVKAMASALNRKESEVMHVIEENCD.PMMVTSLWNGEGVDLGVFHSLLELFSIKALIFEGSREVLYNREGRFEASFEIKGDHIE-h..
Q4F978_9VIRU/994-1081              ......KNGCVITAVAKLLGRRDMDILAVLEREAS.RELCFEIWRGAGVSMASIQSVFAIFDIRGVVKGQENTTVLNAQGAFEGLFSLKDDHLE-y..
S5RCZ6_9VIRU/869-956               ......KNLCVVHAISKALRRRPDEVISVLSREDY.RDLYAELMQGQGLELARLELIFDIFSHTCFVQIGSELLEMNKEGNCCACFDLREQHI--ey.
S5RKI7_9VIRU/872-956               mccscy---------IQALRRRPDEVISVLSREDY.RDLYAELMQGQGLELARLELIFDIFSIHAFVQIGSELLEMNKEGNCCACFDLREQHI--ey.
V5LXC8_9VIRU/1050-1137             ......KEGCVIRAISEFLKQNPTKVLSVLSANCS.KELLHELMSGLGIQEFFLEEIFKVFDICAEVSDGEKSRILNANGSRSAKFTVEQDHFSF...
I6YB60_9VIRU/968-1055              ......RNNCVLRAIGQALKRSEVEVLKVVNVKCT.EALVGKIWEGEGVGLDELDLVFSCFDIRAIVHRGNEQFVLNEQGKVVKSFSATDDHLE-y..
Q6RBY9_9VIRU/1008-1095             ......KNDCVITATVEALGRSYADVFGVLSRVSN.SHILAEVNSGEGVSSFILEEYFKLFGIQASIIWDGELICLNEIGREKKAFEIVEGHMTH...
Q3HM15_9VIRU/957-1044              .....v-EACVLRAISELLGRRIQDVQKVVHGKLG.KDFEEWLLSGEGIDSGRLPQIFECFDIKAFVYDGETALVMNEGGTTTGVFELSDKHLS-l..
Q4U0G5_9VIRU/959-1046              .....v-EACVLRAISELLGRRIQDVQKVVHGKLG.KDFEEWLLSGEGIDSGRLPQIFECFDIKAFVYDGETALVMNEGGTTPGVFELSDKHLS-l..
A0JHF7_9VIRU/1-82                  .....t-------AIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVVNPRGKISALFDITNEHIR-h..
Q9E948_9VIRU/1201-1288             ......VNGCVIRAIASALGRREVDVLAVLGKPAH.EDLFEEVAEGRGFSIFDLTRLFEIFSICGSVDAGGELIMVNENGRIPAEFSLEKEHLAH...
A1KWR5_LSV/974-1061                ....la--ACTIKALASCLDRRFTEVSSLLYKRLG.TDFMDNALAGQGMELETFREMLVELQICAVVEQAGGTIILNDKGQTKGIFKFLDGH---aeh
RDRP_PVMR/991-1078                 ......RNGCVIESVAQALGTRNADILAVVEERCC.EEVVESVQAGLGLNLHHVEIVLQCFDIVGHCNLGDKEITLNAGGKMPFCFDISDEHMSF...
Q70M02_LSV/974-1061                ....la--ACTIKALASCLDRRFTEVSSLLYKRLG.TDFMDNALAGQGMELETFREMLVELQICAVVEQAGGTMILNDKGQTKGIFKFLDGH---aeh
RDRP_CLBVS/979-1065                ......KNTCLINAFSKAMKRSKQAIIAKLKTVNS.PFWSRYLSEGNGGSIEDCQSACEALDVTVDLNVNGKCVVLGK-GALRISMALRNNHFSV...
G9CHA2_9VIRU/992-1079              .....t-NDCVLIALEQGLGRKRGDILKVLSRPQH.SDIFQIATGGVGLTLELLEPIFQCFQIDARVLCGSEVFTYPTSGTFALDFELADGHLSF...
M9QSF7_9VIRU/1039-1126             ......KEGCVIRAVSEFLRQNPTKILSVLSANCS.KELLAELMSGLGIQEFHLEEIFRVFDIKAEVCDGSELRIINKKGSREARFAVENDHFSY...
Q17UU9_CVB/1084-1171               .....i-NGCVVKAMASALNRKESEVMHVIEENCD.PMMVTSLWNGEGVDLGVFHSLLELFSIKALIFEGSREVLYNREGRFEASFEIKGDHIE-h..
V5LXE8_9VIRU/1042-1129             ......KEGCVVRAVSEFLKQNPTKILSVLSANCS.KELLHELMSGLGIQEFHLEEIFSIFDICAEVSDGTSSRVLNRKGSRAAKFIVDKDHFSF...
W6JAT2_9VIRU/1050-1137             ......KEGCVIRAISEFLKQNPTKVLSVLSANCS.KELLHELMSGLGIQEFFLEEIFKVFDICAEVSDGEKSRILNANGSRSAKFTVEQDHFSF...
Q91BP7_9VIRU/955-1043              .....i-NSCVMEPISKAVDIPPLNVQRMISSQESlHSEYERLSSGKSFDLLGLESLMTFFNIGAEVQENGHKFILNENGSRARSFILENNHIE-f..
L8E8Z2_9VIRU/1000-1087             ......RNDCVLVAVASVLQRRVEEVLSILGAQLG.NEFLQDVLKGEGIDRDKLAVVFELFDICAHIHAEGEVFVINSEGRLHGTFNLSKDHIE-h..
B5AMJ0_9VIRU/979-1065              ......KNTRLIDAFSKAMKRSKQAIIAKLKTVNS.PFWSRYLSEGNGGSIEDCQSACEALDVTVDLNVNGKCVVLGK-GAFRISMALKNNHFSV...
W8Q345_9VIRU/991-1078              ......RNGCVIESVALALGRRNADILAVVEERCC.EEVVESVQAGLGLNLHHVEIVLQCFDIVGHCNLGDKEVTLNVDGKMSFCFDISDEHMSF...
B3VKH1_9VIRU/972-1059              ...vel---CTIRAISQAVKRTDKDVLVVLLQSLG.DNFEKELLEGKGVQMDMFLQMLEVFDIAGMVESQAGTHLYNAQGAIKCNFKCSGNHI--ey.
G3GK45_9VIRU/1200-1287             ......VNGCVIRAIASALNRREVDVLAVLGKPAH.EDLFEEIAEGRGFSIFDLTRLFEIFSICGSVDTGGELIMVNENGRIPAEFSLEKEHLSH...
A8II53_9VIRU/1045-1132             ......KNNCLVRAIAVSLNRKTSEVLKVLEEGSC.VGSVGTLWRGEGVALEDLDFYFDRFGINAMVEFEGKAYNFNETGHLPAAFTLKDGHIE-f..
A0JHG6_9VIRU/1-82                  .....t-------AIASALGRREVDVLNYLCKPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPNGKISALFDITNEHIR-h..
O91724_9VIRU/1181-1268             .....l-NGCMITAISSALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPHGKISALFDITNEHIR-h..
W6JBD2_9VIRU/1052-1139             ......KEGCVIRAISEFLKQNPTKVLSVLSANCS.KELLHELMSGLGIQEFFLEEIFKVFDICAEVSDGEKSRIINSKGSRSAKFTVEQDHFSF...
I6M3V6_9VIRU/968-1055              ......RNNCVLRAIGQALKRSEAEVLKVVNVKCT.EALVGKIWEGEGVGLDELELVFSCFDIRAIVHRGNEQFVLNEQGKVVKSFSATDDHLE-y..
Q17UV2_CVB/1084-1171               .....i-NGCVVKAMASALNRKESEVMHVIEENCD.PMMVTSLWNGEGVDLGVFHSLLELFSIKALIFEGSREVLYNREGRFEASFEIKGDHIE-h..
Q2VQN8_9VIRU/991-1078              .....k-EMCVVKAIAQAVKRSPMDVLAVALKKMG.EDFKEQICSGKGVMLDVFMALAKIFDVSACVLQGTDQIMINPKGRIKGLFRMTSDHLSY...
A0JHH9_9VIRU/1-82                  .....t-------AIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPRGKISALFDITNEHIR-h..
J9SK69_9VIRU/1181-1268             .....l-NGCMITAIASALGRREVDVLNYLCRPIT.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPRGKISALFDITNEHIR-h..
#=GC seq_cons                      .......ssCllpAlApALsR+.s-VLslLscsss.pclhc-LhpGtGlshhhLpphFchFsIsAplshsuchhllNtpGphsutFslps-Hlp....
//
DBGET integrated database retrieval system