GenomeNet

Database: Pfam
Entry: Peptidase_C23
LinkDB: Peptidase_C23
Original site: Peptidase_C23 
#=GF ID   Peptidase_C23
#=GF AC   PF05379.6
#=GF DE   Carlavirus endopeptidase 
#=GF AU   Studholme DJ
#=GF SE   Manual
#=GF GA   25.00 25.00;
#=GF TC   33.70 43.10;
#=GF NC   24.50 22.00;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   7871721
#=GF RT   Autocatalytic processing of the 223-kDa protein of blueberry
#=GF RT   scorch carlavirus by a papain-like proteinase. 
#=GF RA   Lawrence DM, Rozanov MN, Hillman BI; 
#=GF RL   Virology 1995;207:127-135.
#=GF DR   INTERPRO; IPR008041;
#=GF DR   MEROPS; C23;
#=GF CC   A peptidase involved in auto-proteolysis of a polyprotein from
#=GF CC   the plant pathogen blueberry scorch carlavirus (BBScV)[1].
#=GF CC   Corresponds to Merops family C23. 
#=GF SQ   125
#=GS A9CMG0_CVB/1094-1182    AC A9CMG0.1
#=GS A0JHH5_9VIRU/1-82       AC A0JHH5.1
#=GS A0JHG2_9VIRU/1-82       AC A0JHG2.1
#=GS Q4A3Q4_9VIRU/996-1084   AC Q4A3Q4.1
#=GS A0JHH6_9VIRU/1-82       AC A0JHH6.1
#=GS Q0QBU6_9VIRU/970-1058   AC Q0QBU6.1
#=GS E5GB05_9VIRU/989-1077   AC E5GB05.1
#=GS Q70Z42_9VIRU/989-1077   AC Q70Z42.1
#=GS Q17UV0_CVB/1084-1172    AC Q17UV0.1
#=GS Q70M02_LSV/973-1061     AC Q70M02.1
#=GS E7DUC4_9VIRU/1199-1287  AC E7DUC4.1
#=GS G3GK38_9VIRU/1199-1287  AC G3GK38.1
#=GS A0JHG1_9VIRU/1-82       AC A0JHG1.1
#=GS H6VXL1_9VIRU/1004-1091  AC H6VXL1.1
#=GS G9CHA2_9VIRU/991-1079   AC G9CHA2.1
#=GS A6Q0V3_CVB/1086-1174    AC A6Q0V3.1
#=GS A0JHI2_9VIRU/1-67       AC A0JHI2.1
#=GS Q9DJV1_9VIRU/1038-1126  AC Q9DJV1.1
#=GS A0JHG4_9VIRU/1-82       AC A0JHG4.1
#=GS Q52W18_9VIRU/1180-1268  AC Q52W18.1
#=GS Q9E9R6_9VIRU/1000-1088  AC Q9E9R6.1
#=GS A0JHH2_9VIRU/1-82       AC A0JHH2.1
#=GS B9UZ29_9VIRU/973-1061   AC B9UZ29.1
#=GS C7B9H4_9VIRU/1051-1139  AC C7B9H4.1
#=GS Q14QP7_CVB/1087-1175    AC Q14QP7.1
#=GS A0JHG5_9VIRU/1-82       AC A0JHG5.1
#=GS C1KD78_9VIRU/999-1087   AC C1KD78.1
#=GS RDRP_PVMR/990-1078      AC P17965.2
#=GS Q4U0G5_9VIRU/958-1046   AC Q4U0G5.2
#=GS Q67654_9VIRU/933-1021   AC Q67654.1
#=GS Q52W13_9VIRU/1180-1268  AC Q52W13.1
#=GS A0JHG7_9VIRU/1-82       AC A0JHG7.1
#=GS H6VXK8_9VIRU/1004-1091  AC H6VXK8.1
#=GS A0JHH0_9VIRU/1-82       AC A0JHH0.1
#=GS C1KD72_9VIRU/999-1087   AC C1KD72.1
#=GS A0JHH7_9VIRU/1-82       AC A0JHH7.1
#=GS RDRP_ASPVP/1198-1286    AC Q64962.1
#=GS A7TZR7_9VIRU/1003-1091  AC A7TZR7.1
#=GS C0L9E8_9VIRU/942-1030   AC C0L9E8.1
#=GS B5TRQ1_9VIRU/978-1065   AC B5TRQ1.1
#=GS O91901_9VIRU/1180-1268  AC O91901.1
#=GS B0LFB7_9VIRU/968-1056   AC B0LFB7.1
#=GS Q2VQN2_9VIRU/991-1079   AC Q2VQN2.1
#=GS A1KWR5_LSV/973-1061     AC A1KWR5.1
#=GS A4ZWC5_9VIRU/1009-1097  AC A4ZWC5.1
#=GS Q17UV1_CVB/1083-1171    AC Q17UV1.1
#=GS B2CML7_9VIRU/986-1074   AC B2CML7.1
#=GS A8II53_9VIRU/1044-1132  AC A8II53.1
#=GS B5AMI8_9VIRU/978-1065   AC B5AMI8.1
#=GS A0JHI3_9VIRU/1-82       AC A0JHI3.1
#=GS B6RTB0_9VIRU/801-889    AC B6RTB0.1
#=GS Q3HM15_9VIRU/956-1044   AC Q3HM15.2
#=GS Q9E948_9VIRU/1200-1288  AC Q9E948.1
#=GS Q4F978_9VIRU/993-1081   AC Q4F978.1
#=GS E7DUB9_9VIRU/1199-1287  AC E7DUB9.1
#=GS Q17UU9_CVB/1083-1171    AC Q17UU9.1
#=GS Q2VQN8_9VIRU/990-1078   AC Q2VQN8.1
#=GS A0JHI1_9VIRU/1-82       AC A0JHI1.1
#=GS A3KL92_CVB/1090-1178    AC A3KL92.2
#=GS A0JHG9_9VIRU/1-82       AC A0JHG9.1
#=GS A0AAQ6_9VIRU/904-992    AC A0AAQ6.1
#=GS D2Z042_9VIRU/1015-1103  AC D2Z042.1
#=GS RDRP_CLBVS/978-1065     AC Q91QZ3.1
#=GS E5KJF1_9VIRU/848-936    AC E5KJF1.1
#=GS Q65652_9VIRU/990-1078   AC Q65652.1
#=GS B2KTC2_9VIRU/1050-1138  AC B2KTC2.1
#=GS Q7TD38_9VIRU/989-1077   AC Q7TD38.1
#=GS Q9YP86_9VIRU/131-220    AC Q9YP86.1
#=GS B9UZ23_9VIRU/973-1061   AC B9UZ23.1
#=GS A0JHH8_9VIRU/1-82       AC A0JHH8.1
#=GS A0JHG0_9VIRU/1-82       AC A0JHG0.1
#=GS A8C5N0_9VIRU/1158-1246  AC A8C5N0.1
#=GS G3GK45_9VIRU/1199-1287  AC G3GK45.1
#=GS A0JHH4_9VIRU/1-82       AC A0JHH4.1
#=GS F6KH09_9VIRU/933-1021   AC F6KH09.1
#=GS A0JHG8_9VIRU/1-82       AC A0JHG8.1
#=GS A0JHG3_9VIRU/1-82       AC A0JHG3.1
#=GS B3VKH1_9VIRU/971-1059   AC B3VKH1.2
#=GS A0JHH3_9VIRU/1-82       AC A0JHH3.1
#=GS Q5L4G0_9VIRU/1080-1167  AC Q5L4G0.1
#=GS G5CCW5_9VIRU/953-1041   AC G5CCW5.1
#=GS Q6RBY9_9VIRU/1007-1095  AC Q6RBY9.1
#=GS O91724_9VIRU/1180-1268  AC O91724.1
#=GS Q0VZD1_9VIRU/988-1076   AC Q0VZD1.1
#=GS Q629J0_POPMV/1007-1095  AC Q629J0.1
#=GS C7AGF6_9VIRU/1022-1110  AC C7AGF6.1
#=GS Q4A3R1_9VIRU/998-1086   AC Q4A3R1.1
#=GS A0JHF7_9VIRU/1-82       AC A0JHF7.1
#=GS E7DUC9_9VIRU/1198-1286  AC E7DUC9.1
#=GS A6Q0U1_CVB/1087-1175    AC A6Q0U1.1
#=GS Q9IH80_9VIRU/1050-1138  AC Q9IH80.1
#=GS D7RJV8_LSV/973-1061     AC D7RJV8.1
#=GS A0JHH1_9VIRU/1-82       AC A0JHH1.1
#=GS A0JHF8_9VIRU/1-82       AC A0JHF8.1
#=GS Q5GR23_9VIRU/1016-1104  AC Q5GR23.1
#=GS E7DUD4_9VIRU/1200-1288  AC E7DUD4.1
#=GS Q8QXY8_9VIRU/933-1021   AC Q8QXY8.1
#=GS A6Q0U7_CVB/1086-1174    AC A6Q0U7.1
#=GS Q91BP7_9VIRU/954-1043   AC Q91BP7.1
#=GS Q8UZK2_9VIRU/861-949    AC Q8UZK2.2
#=GS G3XFX9_9VIRU/973-1061   AC G3XFX9.1
#=GS G9CHA8_9VIRU/933-1021   AC G9CHA8.1
#=GS Q993S7_9VIRU/806-892    AC Q993S7.1
#=GS C7AGE9_9VIRU/1023-1111  AC C7AGE9.1
#=GS H6VV73_9VIRU/1004-1091  AC H6VV73.1
#=GS B3V090_9VIRU/989-1077   AC B3V090.1
#=GS O91632_9VIRU/1035-1123  AC O91632.1
#=GS Q1RNG5_9VIRU/1180-1268  AC Q1RNG5.1
#=GS G4V4X6_9VIRU/1180-1268  AC G4V4X6.1
#=GS A0JHG6_9VIRU/1-82       AC A0JHG6.1
#=GS Q17UV2_CVB/1083-1171    AC Q17UV2.1
#=GS Q0ILD8_9VIRU/1180-1268  AC Q0ILD8.2
#=GS E3Q0A2_9VIRU/1199-1287  AC E3Q0A2.1
#=GS H6VXL4_9VIRU/1004-1091  AC H6VXL4.1
#=GS B2KTB5_9VIRU/1050-1138  AC B2KTB5.1
#=GS A8CLZ0_9VIRU/1198-1286  AC A8CLZ0.1
#=GS Q91UJ3_9VIRU/1007-1095  AC Q91UJ3.1
#=GS A0JHI0_9VIRU/1-82       AC A0JHI0.1
#=GS E0WN95_9VIRU/1180-1268  AC E0WN95.1
#=GS A4V8J8_LSV/973-1061     AC A4V8J8.1
#=GS A0JHH9_9VIRU/1-82       AC A0JHH9.1
#=GS A0JHF9_9VIRU/1-82       AC A0JHF9.1
#=GS B5AMJ0_9VIRU/978-1065   AC B5AMJ0.1
#=GS Q7TD32_9VIRU/989-1077   AC Q7TD32.1
#=GS Q70WL7_LSV/973-1061     AC Q70WL7.1
A9CMG0_CVB/1094-1182               ...PKNSCLLHAIAHALNRQFHEVLTVVERVLG.SCLSGETWVGQGIDVADLEFYFGLFDIRACVISGPSAATYNEEGRVVANFILSDGHITY..
A0JHH5_9VIRU/1-82                  ...-------TAIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLTEAFEAFDICAKCDINGEIEVINPNGKISALFDITNEHIRH..
A0JHG2_9VIRU/1-82                  ...-------TAIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPHGKISALFDITNEHIRH..
Q4A3Q4_9VIRU/996-1084              ...PRNDCVLVAVASVLRRRVEEVLSILGAQLG.NEFLQDVLKGEGIDRDKLAVVFKLFDICAHIHAEGEVFVINSEGRLPGTFNLSKDHIE-h.
A0JHH6_9VIRU/1-82                  ...-------TAIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEVEVINPCGKISALFDITNEHIRH..
Q0QBU6_9VIRU/970-1058              .pi--EGCTIKALADCVKRQEKEVFSVLAHSMG.REFLREVLEGKGVSLEQFATMCNTLDVRAVLELEEGTMLVNEVGRIEGYFSLLEGHA--vf
E5GB05_9VIRU/989-1077              ...LRNGCVIESVALALGRRNVDILAVVEERCC.EEVVGSVQAGLGLNLHHVEIVLQCFDIVGHCNLGDKEVTLNAGGKMSFCFDISDEHMSF..
Q70Z42_9VIRU/989-1077              ...LRNGCVIESVALALGRRNADILAVVEERCC.EEVVESVQAGLGLNLHHVEIVLQCFDIVGHCNLGDKEITLNAGGKMSFCFDISDEHMSF..
Q17UV0_CVB/1084-1172               .ii--NGCVVKAMASALNRKESEVMHVIEENCD.PMMVTSLWNGEGVDLGVFHSLLELFSIKALIFEGSREVLYNREGRFEASFEIKGDHIE-h.
Q70M02_LSV/973-1061                pla---ACTIKALASCLDRRFTEVSSLLYKRLG.TDFMDNALAGQGMELETFREMLVELQICAVVEQAGGTMILNDKGQTKGIFKFLDGHA--eh
E7DUC4_9VIRU/1199-1287             ...PVNGCVIRAIASALGRREVDVLAVLGKPAH.EDLFDEVSEGRGFSIFDLSRLFEIFSICGSVDTGGELIMVNEGGRIPAEFSLEKEHLAH..
G3GK38_9VIRU/1199-1287             ...PVNGCVIRAIASALNRREVDVLAVLGKPAH.EDLFEEVAEGRGFSIFDLTRLFEIFSICGSVDTGRELIMVNENGRIPAEFSLEKEHLSH..
A0JHG1_9VIRU/1-82                  ...-------TAIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPCGKISALFDITNEHIRH..
H6VXL1_9VIRU/1004-1091             ...YRNVCLIRALSKALNRGMQAIIAKLKTVNN.PFWSRFLSDGNGGSVEDCLAACEALGITVDLFVDGKCLVL-GEGAVRVSLALKDNHFSV..
G9CHA2_9VIRU/991-1079              ...PTNDCVLIALEQGLGRKRGDILKVLSRPQH.SDIFQIATGGVGLTLELLEPIFQCFQIDARVLCGSEVFTYPTSGTFALDFELADGHLSF..
A6Q0V3_CVB/1086-1174               .ii--NGCVVKAMASALNRKESEVMHVIEENCD.PMMVTSLWNGEGVDLGVFHSLLELFSIKALIFEGSREVLYNREGRFEASFEIKGDHIE-h.
A0JHI2_9VIRU/1-67                  ..d-----------------------YLSRPST.NPIFDQLCRGGGLHIMYLAEAFEAFDICAKCDINGEIEVINPHGKISALFDITNEHIRH..
Q9DJV1_9VIRU/1038-1126             ...PKEGCVIRAVSEFLRQNPTKILSVLSANCS.KELLAELMSGLGIQEFHLEEIFRVFDIKAEVCDGSELRVINKKGSREARFAVENDHFSY..
A0JHG4_9VIRU/1-82                  ...-------TAIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVVNPRGKISALFDITNEHIRH..
Q52W18_9VIRU/1180-1268             ..p-INGCMITAIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPNGKISALFDITNEHIRH..
Q9E9R6_9VIRU/1000-1088             ...IRNNCVVRAIADGLNRLECEVQHVLERKCA.PVLLEDLRKGRGLEPMNLELVFSCFGVCALVDVGGRTVVYNEGGGTHMQFTLYNEHLSY..
A0JHH2_9VIRU/1-82                  ...-------TAIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPRGKISALFDITNEHIRH..
B9UZ29_9VIRU/973-1061              ...PRNDCVIVAGASALSRSVKDIYKVLMRREY.ALIFKQLCAGEGLSLMLLGQFFSIFDIHAYINFEGEHMEVNESGSLKRCFTVEQEHITH..
C7B9H4_9VIRU/1051-1139             ..p-INGCVVKSIAETLNQTEAKILSVIGRPNN.RLILEGLVEGEGLNIEDLEAAFSVFGICARVSTERGVFTLNKEGNLHANYELKSGHIMY..
Q14QP7_CVB/1087-1175               .ii--NGCVVKAMASALNRKESEVMHVIEENCD.PMMVTSLWNGEGVDLGVFHSLLELFSIKALIFEGSREVLYNREGRFEASFEIKGDHIE-h.
A0JHG5_9VIRU/1-82                  ...-------TAIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEVEVINPRGKISALFDITNEHIRH..
C1KD78_9VIRU/999-1087              ...PRNDCVLVAVASVLRRRVEEVLSILGAQLG.NEFLQDVLKGEGINRDKLAVVFRLFDICAHIHAEGEVFVINSEGRLHGTFNLSKDHIE-h.
RDRP_PVMR/990-1078                 ...LRNGCVIESVAQALGTRNADILAVVEERCC.EEVVESVQAGLGLNLHHVEIVLQCFDIVGHCNLGDKEITLNAGGKMPFCFDISDEHMSF..
Q4U0G5_9VIRU/958-1046              ..m-VEACVLRAISELLGRRIQDVQKVVHGKLG.KDFEEWLLSGEGIDSGRLPQIFECFDIKAFVYDGETALVMNEGGTTPGVFELSDKHLS-l.
Q67654_9VIRU/933-1021              ...YKNDCFVSAVAQTFSRDTNEMYRVLADKKF.DELTELLRLGCGLTLEDLEIGFRLLNIKAHINKDGEYLLINETGEINGFYALTEEHLV-a.
Q52W13_9VIRU/1180-1268             ..p-LNGCMITAIASALGRREVDVLNYLCKPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPNGKISALFDITNEHIRH..
A0JHG7_9VIRU/1-82                  ...-------TAIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPNGKISALFDITNEHIRH..
H6VXK8_9VIRU/1004-1091             ...YRNVCLIRALSKALNRGMQAIIAKLKTVNN.PFWSRFLSDGNGGSVEDCLAACEALGITVDLFVDGKCLVL-GEGAVRVSLALKDNHFSV..
A0JHH0_9VIRU/1-82                  ...-------TAIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPRGKISALFDITNEHIRH..
C1KD72_9VIRU/999-1087              ...PRNDCVLVAVASVLRRRVEEVLSILGAQLG.NEFLQDVLKGEGINRDKLAVVFKLFDICAHIHAEGEVFVINSEGRLHGTFNLSKDHIE-h.
A0JHH7_9VIRU/1-82                  ...-------TAIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPRGKISALFDITNEHIRH..
RDRP_ASPVP/1198-1286               ...PVNGCVIRAISSALNRREVDVLAVLGKPAH.EDLFEEVAEGRGFSIFDLTRLFEIFSICGSVDTGGELIMVNENGRIPAEFSLEKEHLAH..
A7TZR7_9VIRU/1003-1091             ...YKNDCALLAVAETLGRTKREVTEVVCKAKH.GGLLRSMRTGEGLKVELLGELFKIFSIKALVKCNGQLHRLNPEGKILGHYRLEDGHIQ-v.
C0L9E8_9VIRU/942-1030              ...PRNDCVPRAIAEALGRSLREVFGVLSRKEN.SSLYALLGGSGGVDIDDLEDFFNLFDIRAYVDLDGKWYSLNPKGHLERHFNLNDGHMTF..
B5TRQ1_9VIRU/978-1065              ...YKNTCLINAFSKAMKRSKQAIIAKLKTVNS.PFWSRYLSEGNGGSIEDCQSACEALDVTVDLNVNGKYVVL-GKGALRISMALKNNHFSV..
O91901_9VIRU/1180-1268             ..p-LNGCMITAIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPCGKISALFDITNEHIRH..
B0LFB7_9VIRU/968-1056              pvs---ACSLIAISELLQRSLVEITKAAIRNMG.AAFEEELFKGKGVDLPTFTRLLQIFGIRGFLVKENETVEVNAEGTIPGKFKIEGDHIS-l.
Q2VQN2_9VIRU/991-1079              ...PKEMCVIKAIAEAVKRTPMDILAVALKRMG.ENFKEQICGGRGVMLDVFMALAKIFDVNACVLQGTEQLMINPKGRIKGLFRQTADHMSY..
A1KWR5_LSV/973-1061                pla---ACTIKALASCLDRRFTEVSSLLYKRLG.TDFMDNALAGQGMELETFREMLVELQICAVVEQAGGTIILNDKGQTKGIFKFLDGHA--eh
A4ZWC5_9VIRU/1009-1097             ...LKNACVVRAVASALNRRCCEVLKVLDDAGD.LGEDSPLLSGQGVELAELEHYFALFGIAALVVTHTTSHQLNVQGAVPATFRLHDGHID-h.
Q17UV1_CVB/1083-1171               .ii--NGCVVKAMASALNRKESEVMHVIEENCD.PMMVTSLWNGEGVDLGVFHSLLELFSIKALIFEGSREVLYNREGRFEASFEIKGDHIE-h.
B2CML7_9VIRU/986-1074              ...LKNGCVITSVADGLGRKESEVQAVLEQQAA.PSLLDEIWSGLGLTQIGMELVFKCFDIAAHVVEEGKVALYNESGSLHLMFNMESGHLSF..
A8II53_9VIRU/1044-1132             ...PKNNCLVRAIAVSLNRKTSEVLKVLEEGSC.VGSVGTLWRGEGVALEDLDFYFDRFGINAMVEFEGKAYNFNETGHLPAAFTLKDGHIE-f.
B5AMI8_9VIRU/978-1065              ...YKNTCLIDAFSKAMKRSKQAIIAKLKTVNS.PFWSRYLSEGNGGSIEDCQSACEALDVTVDLNVSGKYVVL-GKGAFRISMALKDNHFSV..
A0JHI3_9VIRU/1-82                  ...-------TAIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPNGRMSALFDITNEHIRH..
B6RTB0_9VIRU/801-889               ..a-ENDCVITACAQALAREPEDVVKVLKDRLE.ESILEEIWNGEGVPFERMYLFFEALDIQAHCNRDGAQLVLNGGGKLARCFVIKEDHIE-f.
Q3HM15_9VIRU/956-1044              ..m-VEACVLRAISELLGRRIQDVQKVVHGKLG.KDFEEWLLSGEGIDSGRLPQIFECFDIKAFVYDGETALVMNEGGTTTGVFELSDKHLS-l.
Q9E948_9VIRU/1200-1288             ...PVNGCVIRAIASALGRREVDVLAVLGKPAH.EDLFEEVAEGRGFSIFDLTRLFEIFSICGSVDAGGELIMVNENGRIPAEFSLEKEHLAH..
Q4F978_9VIRU/993-1081              ...LKNGCVITAVAKLLGRRDMDILAVLEREAS.RELCFEIWRGAGVSMASIQSVFAIFDIRGVVKGQENTTVLNAQGAFEGLFSLKDDHLEY..
E7DUB9_9VIRU/1199-1287             ...PVNGCVIRAIASALNRREVDVLAVLGKPAH.EDLFDEVSEGRGFSIFDLSRLFEIFSICGSVDTGGELIMVNEGGRIPAEFSLEKEHLAH..
Q17UU9_CVB/1083-1171               .ii--NGCVVKAMASALNRKESEVMHVIEENCD.PMMVTSLWNGEGVDLGVFHSLLELFSIKALIFEGSREVLYNREGRFEASFEIKGDHIE-h.
Q2VQN8_9VIRU/990-1078              ...PKEMCVVKAIAQAVKRSPMDVLAVALKKMG.EDFKEQICSGKGVMLDVFMALAKIFDVSACVLQGTDQIMINPKGRIKGLFRMTSDHLSY..
A0JHI1_9VIRU/1-82                  ...-------TAIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPRGKISALFDITNEHIRH..
A3KL92_CVB/1090-1178               .ii--NGCVVKAMASALNRKESEVMHVIEENCD.PMMVTSLWNGEGVDLGVFHSLLELFSIKALIFEGSREVLYNREGRFEASFEIKGDHIE-h.
A0JHG9_9VIRU/1-82                  ...-------TAIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPRGKISALFDITNEHIRH..
A0AAQ6_9VIRU/904-992               ...PKEDCAIIAVSETLNRRYQDVYKVLNREEN.SSILREMEEEKGVSLTTFERILKIFSIKGFCIVDRETVLLNEGGNFEAYFCISEGHI--ek
D2Z042_9VIRU/1015-1103             ..p-YNNCYLKAIASHLGRSEFEVELAIYGAGL.HSIQKSIIDDQGLDYEQLEVCFDLFSIQAFCTTPEGPLVLNPSGKIKGFYRLSRDHVE-f.
RDRP_CLBVS/978-1065                ...YKNTCLINAFSKAMKRSKQAIIAKLKTVNS.PFWSRYLSEGNGGSIEDCQSACEALDVTVDLNVNGKCVVL-GKGALRISMALRNNHFSV..
E5KJF1_9VIRU/848-936               ...LKNLCVVSAVAEALSRTEGDVIEVLKRPDY.QDLAESVMCGQGVRVEDLESIFRVFSIKALVSFGDKDLILNPDGNCCACFKLENNHLSY..
Q65652_9VIRU/990-1078              ...PKEMCVVKAIAQAVKRSPMDVLRVALKKMG.EDFKEQICRGKGVMLDVFMVLAKIFDVSACVLQGTEQIMINPKGRIKGLFRMTTDHLSY..
B2KTC2_9VIRU/1050-1138             ...PKEGCVIRAVSEFLKQNPTKILSVLSANCS.KDLLHELMSGLGIQEFFLEEIFSVFDINAEVSDGEKTRNLNPKGSRHAKFLAEQGHFSY..
Q7TD38_9VIRU/989-1077              ...LRNGCVIESVAQALGRRNADILAVVEERCC.EEVVESVQAGLGLNLHHVEIVLQCFDIVGHCNLGDKEITLNAGGKMSFCFDISDEHMSF..
Q9YP86_9VIRU/131-220               .fi--NSCVIDAISKAVDIPPLNVQRMISSQESlHSEYERLSSGKSFDLLGLESLMTFFNIGAEVQENGHKFILSENGSRARSFILENNHIE-f.
B9UZ23_9VIRU/973-1061              ...PRNDCVIVAGASALSRPVKDVYKVLMRREH.SLIFKQLCAGEGLSLMLLGQFFSIFDIHAYINFEGEHMEVNESGSLKRCFTVEQEHIAH..
A0JHH8_9VIRU/1-82                  ...-------TAIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEVEVINPHGKISALFDITNEHIRH..
A0JHG0_9VIRU/1-82                  ...-------TAISSALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPHGKISALFDITNEHIRH..
A8C5N0_9VIRU/1158-1246             ...PVNGCVVRAIASALGRREIDVLAVLGKPEH.RDLYEDACSGNGFCVYDLERLFEIFSIRARLDHQGSLICLNEDGKISAEFSLEKEHLI-h.
G3GK45_9VIRU/1199-1287             ...PVNGCVIRAIASALNRREVDVLAVLGKPAH.EDLFEEIAEGRGFSIFDLTRLFEIFSICGSVDTGGELIMVNENGRIPAEFSLEKEHLSH..
A0JHH4_9VIRU/1-82                  ...-------TAIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEVEVINPHGKISALFDITNEHIRH..
F6KH09_9VIRU/933-1021              ...YKNDCFVSAVAQTFSRDTNEMYRVLAHKKF.EELTELLRLGCGLTLEDLEVGFKLLNIKAHIKKDGEYLQINDSGEINGFYSLTDEHLV-s.
A0JHG8_9VIRU/1-82                  ...-------TAIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINEEIEVINPNGKISALFDITNEHIRH..
A0JHG3_9VIRU/1-82                  ...-------TAIAAALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEIINPGGRISALFDITNEHIRH..
B3VKH1_9VIRU/971-1059              ..p-VELCTIRAISQAVKRTDKDVLVVLLQSLG.DNFEKELLEGKGVQMDMFLQMLEVFDIAGMVESQAGTHLYNAQGAIKCNFKCSGNHIEY..
A0JHH3_9VIRU/1-82                  ...-------TAIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPRGKISALFDITNEHIRH..
Q5L4G0_9VIRU/1080-1167             .ca--NDCCIRAVADALERPTEQVIEVLRCKGG.TDLMEEVTSGQGLELEHFEQVLTLFDICGVC-FGDFDTVLNEGGRLLFYFYVEDGHVE-h.
G5CCW5_9VIRU/953-1041              ...PKSGCTFKALAKCLGRREQDVVATLSKQLG.QDFIDDTMKGQGLSLAQFSDMLKGLGISALVEVNGQHFQLHSEGAIKGAFRLVDGHA--tf
Q6RBY9_9VIRU/1007-1095             ...PKNDCVITATVEALGRSYADVFGVLSRVSN.SHILAEVNSGEGVSSFILEEYFKLFGIQASIIWDGELICLNEIGREKKAFEIVEGHMTH..
O91724_9VIRU/1180-1268             ..p-LNGCMITAISSALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPHGKISALFDITNEHIRH..
Q0VZD1_9VIRU/988-1076              ...LRNGCVVQAIAAALGRREAEVLKVIETKGT.TELCQQLWVGDGLDLLLVELAFKCFSIVAHVNFGETESILNSDGTAHYQFSCSEGHITY..
Q629J0_POPMV/1007-1095             ...PKNDCVITATVEALGRSYADVFGVLSRVSN.SHILAEVNSGEGVSSFILEEYFKLFGIQASIIWDGELICLNEIGREKKAFEIVEGHMTH..
C7AGF6_9VIRU/1022-1110             ..p-VETCTIKALAECLKRREMDVLTFVSKAMG.HEFLESLVAGEGLTIEQFSGMANLLGINSVVEMNGEIFRFNEVGNVSGLFRFENGHA--tf
Q4A3R1_9VIRU/998-1086              ...PRNDCVLVAVASVLRRRVEEVLSILGAQLG.NEFLQDVLKGEGIDRDKLAVVFKLFDICAHIHAEGEVFVINSEGRLPGTFNLSKDHIE-h.
A0JHF7_9VIRU/1-82                  ...-------TAIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVVNPRGKISALFDITNEHIRH..
E7DUC9_9VIRU/1198-1286             ...PVNGCVIRAIASALGRREVDVLAILGKPAH.EDLFDEVSEGRGFSIFDLSRLFEIFSICGSVDTGGELIMVNENGRIPAEFSLEKEHLAH..
A6Q0U1_CVB/1087-1175               .ii--NGCVVKAMASALNRKESEVMHVIEENCD.PMMVTSLWNGEGVDLGVFHSLLELFSIKALIFEGSREVLYNREGRFEASFEIKGDHIE-h.
Q9IH80_9VIRU/1050-1138             ...PKEGCVIRAVSEFLKQNPTKILSVLSANCS.KDLLHELMSGLGIQEFFLEEIFSVFDINAEVSDGEKTRNLNPKGSRYAKFLAEQGHFSY..
D7RJV8_LSV/973-1061                pla---ACTIKALASCLDRRFTEVSSLLYKRLG.TDFMDNALAGQGMELETFREMLVELQICAVVEQAGGTIILNDKGQTKGIFKFLDGHA--eh
A0JHH1_9VIRU/1-82                  ...-------TAIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPRGKISALFDITNEHIRH..
A0JHF8_9VIRU/1-82                  ...-------TAIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPNGKISALFDITNEHIRH..
Q5GR23_9VIRU/1016-1104             ..p-ANCCVPRAIAAAYKRSLSEILAVIREHCD.ESVSSEIWNGEGVNEMHMLLLFECFDIRADVVQQGVSTVFNEAGRVRFSFHLEDKHLTF..
E7DUD4_9VIRU/1200-1288             ...PVNGCVIRAIASALGRREVDVLAVLGKPAH.EDLFDEVSEGRGFSIFDLSRLFEIFSICGSVDTGGELIMVNEGGRIPAEFSLEKEHLAH..
Q8QXY8_9VIRU/933-1021              ...YKNDCFVSAVAQTFSRDTNEMYRVLADKKF.DELTELLRLGCGLTIEDLEVGFKLLNIKAHIMKDGEYLQINDSGEINGFYSLTDEHLV-a.
A6Q0U7_CVB/1086-1174               .ii--NGCVVKAMASALNRKESEVMHVIEENCD.PMMVTSLWNGEGVDLGVFHSLLELFSIKALIFEGSREVLYNREGRFEASFEIKGDHIE-h.
Q91BP7_9VIRU/954-1043              .fi--NSCVMEPISKAVDIPPLNVQRMISSQESlHSEYERLSSGKSFDLLGLESLMTFFNIGAEVQENGHKFILNENGSRARSFILENNHIE-f.
Q8UZK2_9VIRU/861-949               ...PKNGCVIRAIAEFLNQKPAKVLSVISKECS.KELVEDIMSGLGVQPVHLKELFSFFDIAAEVRENGNSRLINAKGSRSATFQISDDHMTF..
G3XFX9_9VIRU/973-1061              ...PRNDCVIVAGASALSRPVKDVYKVLMRREH.SLIFKQLCAGEGLSLMLLGQFFSIFDIHAYINFEGEHMEVNESGSLKRCFTVEQEHIAH..
G9CHA8_9VIRU/933-1021              ...YKNDCFISAVAQTFSRDTNEMYKVLADKKF.DELTELLRLGCGLTLEDLEVGFKLLNIKAHINKDGEYLQINDSGEINGFYSLTDEHLV-a.
Q993S7_9VIRU/806-892               ...IKNICVVKCISKIIKRPCFYVMRRIYN-AC.RHIYHELQEGHGLDITFLGELFNSLGLHVQVHIDGDIFEFGSVGPIS-EVIIENNHMSI..
C7AGE9_9VIRU/1023-1111             .pi--ETCTIKALAECLKRREIDILTLVAKAMG.HEFLESLLAGTGLTIDQFSCMATLLGINSVVEMNGEVFRFNVEGNICGLFRFENGHA--tf
H6VV73_9VIRU/1004-1091             ...YRNVCLIRALSKALNRGMQAIIAKLKTVNN.PFWSRFLSDGNGGSVEDCLAACEALGITVDLFVDGKCLVL-GEGAVRVSLALKDNHFSV..
B3V090_9VIRU/989-1077              ...LRNGCVIESVALALGRRNADILAVVEXRCC.EEXVESVQAGLGLNLHHVEIVLRCFDIVGHCNLGDKEITLNAGGKMXFCFDISDEHMSF..
O91632_9VIRU/1035-1123             ...PKEGCVIRAVSEFLKQNPTKILSVLSANCS.KELLAELMSGLGIQEFHLEEIFRVFDIKAEVCDGSELRIINKKGSREARFAVENDHFSY..
Q1RNG5_9VIRU/1180-1268             ..p-LNGCMITAIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDVNGEIEVINPGGRISALFDITNEHIRH..
G4V4X6_9VIRU/1180-1268             ..p-LNGCMITAIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPRGKISALFDITNEHIRH..
A0JHG6_9VIRU/1-82                  ...-------TAIASALGRREVDVLNYLCKPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPNGKISALFDITNEHIRH..
Q17UV2_CVB/1083-1171               .ii--NGCVVKAMASALNRKESEVMHVIEENCD.PMMVTSLWNGEGVDLGVFHSLLELFSIKALIFEGSREVLYNREGRFEASFEIKGDHIE-h.
Q0ILD8_9VIRU/1180-1268             ..p-LNGCMITAIAAALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEIINPGGRISALFDITNEHIM-h.
E3Q0A2_9VIRU/1199-1287             ...PVNGCVIRAISSALNRREVDVLAVLGKPAH.EDLFEEVAEGRGFSIFDLTRLFEIFSSCGSVDTGGELIMVNENGKIPAEFSLEKEHLAH..
H6VXL4_9VIRU/1004-1091             ...YRNVCLIRALSKALNRGMQAIIAKLKTVNN.PFWSRFLSDGNGGSVEDCLAACEALGITVDLFVDGKCLVL-GEGAVRVSLALKDNHFSV..
B2KTB5_9VIRU/1050-1138             ...PKEGCVIRAVSEFLKQNPTKILSVLSANCS.KDLLHELMSGLGIQEFFLEEIFSVFDINAEVSDGEKTRNLNPKGSRHAKFLAEQGHFSY..
A8CLZ0_9VIRU/1198-1286             ...PRNGCVHRAASSGPGRRAADLLAVLGNPAH.EKIFEEVADGRGFSIFDLTRLFEIFSICGSVDTGREFIKFNENGRISAELSFEKEHLA-r.
Q91UJ3_9VIRU/1007-1095             ...LKNGCVIVAVAEAIGRTNAEVQQVLNDCCC.DGLLKEIWRGEGLQRNDMELVFKAFDIEAYVTENDDTRVYNASGTLRKNFKLVNSHLSY..
A0JHI0_9VIRU/1-82                  ...-------TAIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPRGKISALFDITNEHIRH..
E0WN95_9VIRU/1180-1268             ..p-LNGCMITAIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPNGKISALFDITNEHIRH..
A4V8J8_LSV/973-1061                pla---ACTIKALASCLDRRFTEVSSLLYKRLG.TDFMDNALAGQGMELETFREMLVELQICAVVEQAGGTIMLNDKGQTKGIFKFLDGHA--eh
A0JHH9_9VIRU/1-82                  ...-------TAIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPRGKISALFDITNEHIRH..
A0JHF9_9VIRU/1-82                  ...-------TAIASALGRREVDVLNYLCRPST.NHIFEELCQGGGLNMMYLAEAFEAFDICAKCDINGEIEVINPRGKISALFDITNEHIRH..
B5AMJ0_9VIRU/978-1065              ...YKNTRLIDAFSKAMKRSKQAIIAKLKTVNS.PFWSRYLSEGNGGSIEDCQSACEALDVTVDLNVNGKCVVL-GKGAFRISMALKNNHFSV..
Q7TD32_9VIRU/989-1077              ...LRNGCVIESVAQALGRRNADILAVVEERCC.EEVVESVQAGLGLNLHHVEIVLQCFDIVGHCNLGDKEITLNAGGKMSFCFDISDEHMSF..
Q70WL7_LSV/973-1061                pla---ACTIKALASCLDRRFTEVSSLLYKRLG.TDFMDNALAGQGMELETFREMLVELQICAVVEQAGGTIILNDKGQTKGIFKFLDGHA--eh
#=GC seq_cons                      ....hNsCslpAlAsALsR+ps-VLslLscsss.sclh-pLtpGtGlshhhLtphFchFsIsAplshsGchhllNspG+lpuhFclps-Hlpa..
//
DBGET integrated database retrieval system