GenomeNet

Database: Pfam
Entry: Peptidase_C23
LinkDB: Peptidase_C23
Original site: Peptidase_C23 
#=GF ID   Peptidase_C23
#=GF AC   PF05379.9
#=GF DE   Carlavirus endopeptidase 
#=GF AU   Studholme DJ
#=GF SE   Manual
#=GF GA   25.00 25.00;
#=GF TC   132.40 131.30;
#=GF NC   22.20 21.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   7871721
#=GF RT   Autocatalytic processing of the 223-kDa protein of blueberry
#=GF RT   scorch carlavirus by a papain-like proteinase. 
#=GF RA   Lawrence DM, Rozanov MN, Hillman BI; 
#=GF RL   Virology 1995;207:127-135.
#=GF DR   INTERPRO; IPR008041;
#=GF DR   MEROPS; C23;
#=GF CC   A peptidase involved in auto-proteolysis of a polyprotein from
#=GF CC   the plant pathogen blueberry scorch carlavirus (BBScV)[1].
#=GF CC   Corresponds to Merops family C23. 
#=GF SQ   3
#=GS RDRP_PVMR/991-1078    AC P17965.2
#=GS RDRP_CLBVS/979-1065   AC Q91QZ3.1
#=GS RDRP_ASPVP/1199-1286  AC Q64962.1
RDRP_PVMR/991-1078               RNGCVIESVAQALGTRNADILAVVEERCCEEVVESVQAGLGLNLHHVEIVLQCFDIVGHCNLGDKEITLNAGGKMPFCFDISDEHMSF
#=GR RDRP_PVMR/991-1078    AS    ...*................................................................................*...
RDRP_CLBVS/979-1065              KNTCLINAFSKAMKRSKQAIIAKLKTVNSPFWSRYLSEGNGGSIEDCQSACEALDVTVDLNVNGKCVVLGK-GALRISMALRNNHFSV
#=GR RDRP_CLBVS/979-1065   AS    ...*................................................................................*...
RDRP_ASPVP/1199-1286             VNGCVIRAISSALNRREVDVLAVLGKPAHEDLFEEVAEGRGFSIFDLTRLFEIFSICGSVDTGGELIMVNENGRIPAEFSLEKEHLAH
#=GR RDRP_ASPVP/1199-1286  AS    ...*................................................................................*...
#=GC seq_cons                    +NGCVIcAlSpALsRRcsDILAVLccsssE-lsEpVuEGpGhSIaDlpplhEsFDIsGclNlGGKpIsLNcsG+lPhsFuLccEHhSa
//
DBGET integrated database retrieval system