GenomeNet

Database: Pfam
Entry: Peptidase_C42
LinkDB: Peptidase_C42
Original site: Peptidase_C42 
#=GF ID   Peptidase_C42
#=GF AC   PF05533.9
#=GF DE   Beet yellows virus-type papain-like endopeptidase C42
#=GF AU   Studholme DJ
#=GF SE   Merops
#=GF GA   25.00 25.00;
#=GF TC   109.60 108.00;
#=GF NC   18.80 17.20;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 11927849 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   11711606
#=GF RT   Functional specialization and evolution of leader proteinases in
#=GF RT   the family Closteroviridae. 
#=GF RA   Peng CW, Peremyslov VV, Mushegian AR, Dawson WO, Dolja VV; 
#=GF RL   J Virol 2001;75:12153-12160.
#=GF DR   INTERPRO; IPR008749;
#=GF DR   MEROPS; C42;
#=GF CC   Members of the Closteroviridae and Potyviridae families of plant
#=GF CC   positive-strand RNA viruses encode one or two papain-like leader
#=GF CC   proteinases, belonging to Merops peptidase family C42.
#=GF SQ   1
#=GS R1AB_BYVU/502-589  AC Q08534.2
R1AB_BYVU/502-589             yr--PGEGLCYLAHAALCCALQKRTFREEDFFVGMYPTKFVFAKRLTEKLGPSALKHPVRGRQVSRSLFHCDVASAFSSPFYSLPRFIGG
#=GR R1AB_BYVU/502-589  AS    .........*...........................................................*....................
#=GC seq_cons                 YR..PGEGLCYLAHAALCCALQKRTFREEDFFVGMYPTKFVFAKRLTEKLGPSALKHPVRGRQVSRSLFHCDVASAFSSPFYSLPRFIGG
//
DBGET integrated database retrieval system