GenomeNet

Database: Pfam
Entry: Peptidase_M44
LinkDB: Peptidase_M44
Original site: Peptidase_M44 
#=GF ID   Peptidase_M44
#=GF AC   PF03410.9
#=GF DE   Metallopeptidase from vaccinia pox
#=GF PI   Protein_G1; 
#=GF AU   Finn RD
#=GF SE   Pfam-B_4417 (release 6.6)
#=GF GA   25.00 25.00;
#=GF TC   139.00 138.90;
#=GF NC   20.70 19.80;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 80369284 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF DR   INTERPRO; IPR005072;
#=GF DR   MEROPS; M44;
#=GF CC   This is a family of Poxviridae metalloendopeptidases. The
#=GF CC   members were often originally named as G1 proteins. The family
#=GF CC   carries three zinc-binding ligands and a catalytic glutamate.
#=GF CC   The first two zinc ligands are histidine residues, found
#=GF CC   together with the catalytic glutamate in a HXXEH motif, an
#=GF CC   inverse of the classical metallopeptidase motif, HEXXH. The
#=GF CC   third zinc ligand is a glutamate C-terminal to the HXXEH motif
#=GF CC   within a motif ELENEY (see MEROPS).
#=GF SQ   94
#=GS B9U1F8_9POXV/1-591  AC B9U1F8.1
#=GS A4GDD3_9POXV/1-591  AC A4GDD3.1
#=GS K4J0K9_9POXV/1-589  AC K4J0K9.1
#=GS G0XXN2_COWPX/1-591  AC G0XXN2.1
#=GS D2JM86_RACVI/1-70   AC D2JM86.1
#=GS Q77GN4_LSDV/1-595   AC Q77GN4.1
#=GS Q6VZN9_CNPV/1-631   AC Q6VZN9.1
#=GS Q6RZM4_9POXV/1-591  AC Q6RZM4.1
#=GS MP44_YLDV/1-589     AC Q9DHR2.1
#=GS D2JM90_9POXV/1-70   AC D2JM90.1
#=GS Q70H73_FOWPV/1-625  AC Q70H73.1
#=GS G1_VACCW/1-591      AC P16713.2
#=GS G3EID5_9POXV/1-591  AC G3EID5.1
#=GS Q070H9_CPRVZ/1-633  AC Q070H9.1
#=GS D2JM92_9POXV/1-70   AC D2JM92.1
#=GS Q3I7P7_MONPV/1-591  AC Q3I7P7.1
#=GS I0AZD7_9POXV/1-591  AC I0AZD7.1
#=GS U5TD42_COWPX/1-591  AC U5TD42.1
#=GS D2JM89_9POXV/1-70   AC D2JM89.1
#=GS H6TA42_9POXV/1-600  AC H6TA42.1
#=GS Q6TUW3_YMTV5/1-588  AC Q6TUW3.1
#=GS U3UB96_9POXV/1-592  AC U3UB96.1
#=GS T2ASN7_9POXV/1-589  AC T2ASN7.1
#=GS U5TDI0_COWPX/1-591  AC U5TDI0.1
#=GS G1_VAR67/1-591      AC P32991.1
#=GS Q91MV7_LSDV/1-595   AC Q91MV7.1
#=GS Q8V510_MONPV/1-591  AC Q8V510.1
#=GS A9J1M8_VACCA/1-591  AC A9J1M8.1
#=GS G0XX20_COWPX/1-591  AC G0XX20.1
#=GS U5TET1_COWPX/1-591  AC U5TET1.1
#=GS Q6TVF1_9POXV/1-597  AC Q6TVF1.1
#=GS Q80DZ5_COWPX/1-591  AC Q80DZ5.1
#=GS Q0NCQ8_VAR65/1-591  AC Q0NCQ8.1
#=GS D2JM88_9POXV/1-70   AC D2JM88.1
#=GS D2JM84_9POXV/1-70   AC D2JM84.1
#=GS K4J8U6_9POXV/1-589  AC K4J8U6.1
#=GS D3IZ53_9POXV/1-597  AC D3IZ53.1
#=GS V5K998_YMTV/1-70    AC V5K998.1
#=GS U5TKD1_COWPX/1-591  AC U5TKD1.1
#=GS Q0NPD0_9POXV/1-591  AC Q0NPD0.1
#=GS MP44_MYXVL/1-589    AC Q9Q8Q1.1
#=GS MP44_MCV1/1-592     AC Q98224.1
#=GS U5TG24_COWPX/1-591  AC U5TG24.1
#=GS Q49PQ7_9POXV/1-591  AC Q49PQ7.1
#=GS Q8V2U2_CAMPM/1-591  AC Q8V2U2.1
#=GS D2JM85_9POXV/1-70   AC D2JM85.1
#=GS Q0NLZ0_VAR66/1-591  AC Q0NLZ0.1
#=GS Q5IXV5_MONPV/1-591  AC Q5IXV5.1
#=GS Q8V3P7_SWPV1/1-592  AC Q8V3P7.1
#=GS Q0NPZ7_COWPX/1-591  AC Q0NPZ7.1
#=GS G0XWF9_COWPX/1-591  AC G0XWF9.1
#=GS H2DS96_9POXV/1-591  AC H2DS96.1
#=GS Q8QMY2_COWPX/1-591  AC Q8QMY2.1
#=GS D2JM93_9POXV/1-70   AC D2JM93.1
#=GS U5TD87_COWPX/1-591  AC U5TD87.1
#=GS G1_VACCC/1-591      AC P21022.1
#=GS Q775W6_CAMPS/1-591  AC Q775W6.1
#=GS F1AX06_ORFV/1-598   AC F1AX06.1
#=GS Q0NG75_VAR46/1-591  AC Q0NG75.1
#=GS V5K9H1_YMTV/1-70    AC V5K9H1.1
#=GS G0XVU5_COWPX/1-591  AC G0XVU5.1
#=GS Q0GP06_HSPV/1-591   AC Q0GP06.1
#=GS Q08FC3_DPV84/1-596  AC Q08FC3.1
#=GS H2DX12_9POXV/1-591  AC H2DX12.1
#=GS H2DXK8_9POXV/1-591  AC H2DXK8.1
#=GS D2JM87_9POXV/1-70   AC D2JM87.1
#=GS Q0N847_VARV/1-591   AC Q0N847.1
#=GS U5THX5_COWPX/1-591  AC U5THX5.1
#=GS Q8JTV1_LSDV/1-594   AC Q8JTV1.1
#=GS Q6TW63_ORFV/1-598   AC Q6TW63.1
#=GS B2CWF2_9POXV/1-589  AC B2CWF2.1
#=GS Q08FU3_DPV83/1-596  AC Q08FU3.1
#=GS W5U9B7_ORFV/1-598   AC W5U9B7.1
#=GS M9WKW5_9POXV/1-591  AC M9WKW5.1
#=GS D2JM91_9POXV/1-70   AC D2JM91.1
#=GS F1DIS7_MONPV/1-591  AC F1DIS7.1
#=GS U5TIL1_COWPX/1-591  AC U5TIL1.1
#=GS G0XSH3_COWPX/1-591  AC G0XSH3.1
#=GS MP44_FOWPN/1-625    AC Q9J5D0.1
#=GS D3IZI4_9POXV/1-597  AC D3IZI4.1
#=GS A7XCH0_9POXV/1-589  AC A7XCH0.1
#=GS G0XTD8_COWPX/1-591  AC G0XTD8.1
#=GS MP44_VACCA/1-591    AC P68492.1
#=GS Q0N5U0_VARV/1-591   AC Q0N5U0.1
#=GS Q0N583_VARV/1-591   AC Q0N583.1
#=GS MP44_VACCT/1-591    AC P68493.1
#=GS Q8JLE8_9POXV/1-591  AC Q8JLE8.1
#=GS Q3I8U4_MONPV/1-591  AC Q3I8U4.1
#=GS MP44_RFVKA/1-589    AC Q9Q926.1
#=GS Q6TVT3_ORFSA/1-598  AC Q6TVT3.1
#=GS G0XV79_COWPX/1-591  AC G0XV79.1
#=GS Q0NSX6_VARV/1-591   AC Q0NSX6.1
#=GS G0XU01_COWPX/1-591  AC G0XU01.1
#=GS Q2F8D8_ORFV/1-598   AC Q2F8D8.1
B9U1F8_9POXV/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPACPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QRINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SKRTKS..KILFGRNTRYDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNTNKLFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
A4GDD3_9POXV/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.KSDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPACPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QRINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SKRTKS..KILFGRNTRYDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNTNKLFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
K4J0K9_9POXV/1-589             MIVFDNGTRVFINSSTNKDIYVGFSGFGFEKDIGG.ILGIAHLLEHILISFDASRFVANASTARSYMSFWCTPIRGRAtSVDAVRTLISWFFDKD.GLKDDFPVSKIKYHIKELENEYYFRNEVFHCMDALTFLANGDLYNGGRLSMLDRLEDIPLILRDRMRTIIGPNVVIFVRELNDVVLSLLANTFGRLPACPLTIPC.TVRTIIGGKTIMMPSPFYTVMVRVEPSLHNILSILCLYEIYHLVDYETVDNKLYVTFSFIHEHNYERFLQGSGR....LNL.TIY.KKIRLCY.GDDFLMNVYLSFPCIRHDIFDYLTIVNTDTSSMISSLERDIYQSVRTGDYIVVYPNFSNTMSNTADRQLHKTVVI...................NPNIVYA....SQPTTS..--------....IDL..........................MKKQTH.NEMYIKYSDAGFIDYVQL.....ALG.LRRK-IH...KHVHGIHIRHQFSADDIKTILESDTFMKYSKSKPAAMYQYLILSFFVSGNTIEDILQHRESVVKL..CRTYKN..KIVLGKQTRYDIQTLSSFVCGIFKGPSVTSEYLTDIMWKLKRKGLIYSLEFVEL-QKNMFYLFMFTIYPEDVTTYLSSRKLFTSRCVVVSKKG...NTEDFSSMKKDIIIKL..
G0XXN2_COWPX/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPSCPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFIRGEAI....LQI.SQC.QSINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SKRTKS..KILFGRNTRYDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNNNKRFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
D2JM86_RACVI/1-70              MIVLPNKARIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTKFLANASTSRSYMSFWC-------.----------------.---------------------------------------------------------------------------------------------------------.--------------------------------------------------------------------------....---.---.-------.---------------------------------------------------------------------------...................-------....------..--------....---..........................------.------------------.....---.-------...-----------------------------------------------------------------..------..---------------------------------------------------------------------------------------------...----------------..
Q77GN4_LSDV/1-595              MIVLSNGVRIFIDELMNKDIYLGIASFGFENDIGN.IIGIAHLLEHILITFDPSKFVANASTARSYMSFWCRSIKGKSkTIDAVETLISWFFDEN.KIKDTFSISKIKDHIKELENEYYFRNEIFHCMDALSFLANGDLYNGGRISMLQNINNIDDMLSSRMHRIIGPNVVIFVKALDEYTLSLLSKTFGKLPTCPLTIPY.NNLPTIKGKFVMMPSPFYTVMVNIKPTLDNILSMISLYEMYHLIDYETIGDQLYISISFINEDDFEKFIKGIYI....IDF.EAY.KNITFNY.GDDFLMNIYLSFPWIQHDIYDYITEINCNISIILKSLEDNIYNSIASGNYVAIYPNFSNVIFNKNDSQMHKIIVM...................DNN-NFS....INDIYN..N-TNTKSR....IKL..........................MKKQSQ.NEIYIKYDDVEFISYVNL.....ALG.FKNK-IK...KKNDGVQINHQFSSEDIKNILESETFLKYSKSKPATMYQYLLLSFFVSGNSIEDILLNRESVLKP..VKHFKN..KIVFGKKSKYHIKTFSSFVCGLVKGINITNESLTNMMWVLKRKGLIYSLDFTKL-DKHLYYVFMFTIYPNSVVKYITTENIFKNHCLVISEKG...IVEDFSSMKKDIVIKL..
Q6VZN9_CNPV/1-631              MILLKNGVRIFVNHSMRKDIYIGISDFGFEKDIHDdVLGIAHLLEHILISFDNKYFNANASTSRTYMSFWCESLYKNR.YNDAIKTAISWFFDKCgNLKTDFSKVVLENYIAELENEYYYRTEMYHCMDILAYLYGGDLYNGGRITMLERIHEIRKLLSNRMKRLAGRNIVIFVKHLTHNIMDMLSKTFGTLPMYAEIIPVePYLQDATNKIIMMPYPFYTILIQVDNTLNNLLAIICLVENYNLIDYETIGDKLYISISFAEEDQYEYLLYNIKD....IDF.-HI.DKVELDL.GEDYIMNLYINFPWLKKDIFEYIHTMTTSNKILIERLKKDMYESISQHRFMVIYPSFTKSLYNLTDKQDHGLLVVgnvnfkingnnkldnsnseD-----T....LENTTTclIKTNNKAKe.qkNIL..........................YKKTCD.NNVVVSITDESFFRYAIFyhitgSKK.CNKNTLSr.iKTSTEICYRHSFSNEDLKELVNSDTFIRYNSSKPAVLYQYILLAYFVTEKDIKDILGYKNQVLQL.dTRHLGN.nKIIFGKKTRYDIYTKSMFVCGLIKGRKLSEKSMIDYMWELKKLGLIYFLSYTKISTPNTYYIFTFTVFADKVYKYFTNLKEISSSCLVVSNKNkksEEDDYSSLKKYIVID-i.
Q6RZM4_9POXV/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPACPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QRINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SKRTKS..KILFGRNTRYDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNNNKLFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
MP44_YLDV/1-589                MIVLSNGVRIFINSNMNKDIYLGIASFGFENDIGE.ILGIAHLLEHILISFDSSKFVANASTARKYMSFWCCSIKGKSnYIDSINTLISWFFNNN.KLRDNFCLNDIKNHIKELENEYYFRNEVFHCMDVLTFLENGDLYNGGRIDMLNNLESVNNMLYNRMHKIIGPNIVIFVKELNKNCLMLIQNSFGTLPSCPMSFSF.PNFSNIDGKIIMMPSPFYTVMIKVSLSISNVISIMCLFETYHLIDYETVGNDLYVTLSFVKESDYENFINGVST....LKF.NNVpNYTVLSL.CDDFLMNAYLCFPWLSNDINNYLSTVRY-SQNMFKNLEEDIQNSILLKKYIVVYPHFSKTVFNKNDSQMHKIVIL...................DCLNEIK....EDQLPK..------LN....VNL..........................MKKQTK.NEIFIKYNDSSLIKYIIF.....AIG.YKNN-IL...RGNEGVSIHHQFSSEDIKSILESDTFLKYSKSKPAAMYQYLLLSFFVSGYSIEDILLNRESTIKL..LKQYNN..KILFGKKSRYDITTKSNFVCGIIKNKNINNNVITNTMWELKKKGLIYSMEHTKI-DKRIFYIFMFTIYPDEVFLYLS--KKFLSHCLIVSKTG...NIEDFSSMKKDVIIKL..
#=GR MP44_YLDV/1-589     sAS   ............................................*..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
D2JM90_9POXV/1-70              MIVLSNGVRIFINNEMEKDIYVGISGFGFENDINE.VIGIAHLLEHILIEFDPSKFLANASTARSYMSFWC-------.----------------.---------------------------------------------------------------------------------------------------------.--------------------------------------------------------------------------....---.---.-------.---------------------------------------------------------------------------...................-------....------..--------....---..........................------.------------------.....---.-------...-----------------------------------------------------------------..------..---------------------------------------------------------------------------------------------...----------------..
Q70H73_FOWPV/1-625             MIQLNNGIRIFVNHSMKKDIYIGISDFGFEKDINDgILGIAHLLEHILISFDNKYFNANASTSRTYMSFWCVALQKRH.YEDAIRTAISWFFDKKyILKTDFSRIVLENYITELENEYYYRTEMYHCMDVLAYLYGGDLYNGGRITMLERLPEIRNMLSNRMKFLSGKNIVIFVKRLTNNILTLLTNTFGSIPKYPIIIPLdPQIQDARRKIIMMPCPFYTLLIQVDNTMNNLLAIICLVENYNLIDYETISDKLYVCISFANEDQYEYLLYNIKD....MDF.-NI.NRIELDL.GEDYIMNLYINFPWLKNDIFEYIHTMNTKSAMLLADLKKNMHNSILEHKFMIIYPSFTKLLYNITDKQNHGILVVgdvs..........ftpekDPSMHHS....NKENNN..NYSKTVTKrkskYVM..........................YRKTPTtNNIVIDYTDSSFFDYATFy..hvMKSkYEKTNLFsrlKTSTGMCYKHCFDNDDLNELINSDTFIRYNSSKPAVLYQYILLAYFVTERDIKELVDYKDA-IEL.dMKYYSK.nKILFGKNTRYDIRTKSMFVCGLIKGRKLSEKVITDYMWKLKSLGLIYYLTSIKLGISNTFYIFAFTIFPEKVYNFFVGLKEITNRCLIVSNKNtkiEEDDYSSLNKQIVI--gi
G1_VACCW/1-591                 MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPACPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QRINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SKRTKS..KILFGRNTRYDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNTNKLFFAKCLVVSTKG...DVENFSSLKKDVVIRV..
#=GR G1_VACCW/1-591      sAS   ............................................*..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
G3EID5_9POXV/1-591             MILLPNKVRIFINNQMKKDIYVGISNFGFENDIGE.ILGIAHLLEHLLISFDSTKFLANASTSRSYMSFWCKSINNSS.YLDSIKTLISWFFING.RLKDNFPLSSIRFHIKELENEYYFRNEIFHCMDVLMFLSGGDLYNGGRLDMMDDINTVGNMLINRMQQISGSNIVIFVKQLCPEILNLLEDTFGKLPACPETIHS.SIAYNPSGKIVMTPSPFYTVMVKINPTLDNILIIMCLYEIYHLIDYEKIGNYLYLSISFIDEVDYENFLRGESI....LKF.EHP.KYINMNY.TDDYLMNIYINFPWITHDMLDYITRINNEYDKMLVSFQQEITNAIINRDIIVVYPNFSKFMYNTKDKQQHPILVM...................DATYD--....-----N..ISYNPYKP....LYF..........................MKRQNE.NELFIRYGDSSLIDTIAF.....ALS.SKDISLK...KNEEGINIRHSFSADDMQSIMESETFMKYTKSKPAVMYQYIFLSFFASGSSINDILSNRESTLEF..SHIKQN..KILFGKNTRYDVVSKSSFVCGIVKGKSLDKSYLIEMMWDLKKKGLIYSMEFTNLHGKNTFYLFTFTIYTEDVYNYIKNNKQISAKCLVISKKG...EYENFKSLKKDVLIKI..
Q070H9_CPRVZ/1-633             MILLSNGVRVFLMPEMRKDIYVGIANFGFERDIDD.VLGISHLLEHILIDFDHERFAGNATTSRTYMSFWCCALRGAT.YMDAVRTTVSWFFGPDgRLRTNFQRVPVENFVRELENEYYFRCESFHCFDVLTYLGGGDLYNGGRATMLRDLPRVRRLLGRRMRAISAHGVVIFVRHMNREVFALIDATFGRLPAYPALIGP.DR-GVSGNKIVFTPSPFFTVYVRVPNTIENLIALCCVSSVYLFVNYETVLGELYVSVSFVDEDGYEDFVNDVFSenpgNRF.DEY.GVANFTY.GDDDLMALYLNFPSVQRDLTEYVYYCYRRHRQLIDALWRDLAAAARRRDVIIIYPSFAEPLFNAVDGQRHRLLLA...................DIRPSDP....APAGAP..RPGEAGAP....AEAeagapilpprladdggrplarrrawpRRAAAR.QSVTVPYRHSHYLDYAALfgalaRLK.LGRVELR...RDGRGLSLRHDLAQADLDKVFTADAFVRYRNSKPALLYIDIFLAYFASGRSIEAILSNTDA-LSFisARDDKI..NLKFGRNKAYRITTRSSFVCGVVRGKRVSQCLISRFMWDLKRLGYLYNLECVKI-LPRTYYLFAFSVCPESILRYLAAALKGEKFCFVVSTRG...AEEDFSALKKRTTV--al
D2JM92_9POXV/1-70              MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWC-------.----------------.---------------------------------------------------------------------------------------------------------.--------------------------------------------------------------------------....---.---.-------.---------------------------------------------------------------------------...................-------....------..--------....---..........................------.------------------.....---.-------...-----------------------------------------------------------------..------..---------------------------------------------------------------------------------------------...----------------..
Q3I7P7_MONPV/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPSCPEIIPS.SIPVSTNGKIVMTPAPFYTVMVRINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QSINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYTSIINRDIIVIYPNFSKAMCNTRDTQQHQIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILTNRDSTLEF..SKRTKS..KILFGRNTRYDITAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNNNKLFSAKCLVVSTKG...DVENFSSLKKDMVIRF..
I0AZD7_9POXV/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPACPEIIPS.SIPVSTNGKIVMTPSPFYTVMVRINPTLDNILGILYLYESYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QSINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYTSIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILTNRDSTLEF..SKRTKS..KILFGRNTRYDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNTNKLFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
U5TD42_COWPX/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPSCPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QSINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SRRTKS..KILFGRNTRYDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNNNKLFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
D2JM89_9POXV/1-70              MIVFDNGVRVFINTSTNKDIYIGISGFGFEKDIGG.ILGIAHLLEHILISFDASRFVANASTARSYMSFWC-------.----------------.---------------------------------------------------------------------------------------------------------.--------------------------------------------------------------------------....---.---.-------.---------------------------------------------------------------------------...................-------....------..--------....---..........................------.------------------.....---.-------...-----------------------------------------------------------------..------..---------------------------------------------------------------------------------------------...----------------..
H6TA42_9POXV/1-600             MIVLSNGVRIFINNEMEKDIYVGISGFGFENDINE.VIGIAHLLEHILIEFDPSKFLANASTARSYMSFWCNSIPGKSnNIDAVKTLISWFFYRG.KLKDRFDSDRIINHIKELENEYYFRNEIFHCLDILTYLSNGDLYNGGRITMMNNISKITSMLYNRIHRIIGPNIVIFVKKINSCILELLTSSFGTLDSCPLTIPY.NVISTMNGKIVMMPSPFYTVMVNVKMTIDNILTIMALYELYHLIDYETVNDKLYVSISFVNENDYENFLKGITV....INF.NID.KDINLNF.SDDYLMNLYLCFPLIRNDILDYITYINTNLNNILESFNNEINNSIYLGKYISIYPNFSDVIYNKNDRQFHKIAVI...................DSIYNNNipisNMNNKD..INVKNIVP....IKL..........................MKKETK.NELFITYSDSDLINYVSL.....ALS.VNNK-IL...KNSEGISIQHRFSQDDILSILESDTFVKYTKSKPAPIYQYMILSFFVTGNSIDDIINNREAIIRS..CKLFKN..KIVFGKRCKYDIQTCSSFVAGIIKGKELD-EILTKIMWDLKRKGLIYSLDYTKL-DKKIYYIFMFTIYPDNVYTYISKMDCVKSHCLVVSKIG...NTEDYSSMKKDIVIKL..
Q6TUW3_YMTV5/1-588             MIVLSNGVRIFINDDMNKDIYLGVASFGFENDIGE.ILGVAHLLEHILISFDSSKFIANASTARKYMSFWCCSIKGKSsYIDSVNTLISWFFINN.KLRDSFLLSNVKNHIKELENEYYFRNEVFHCMDVLTFLENGDLYNGGRIDMLNNLEDVNNMLCNRMKKIIGPNIVIFVKELNKTCLNMLQNSFGTLPSCPMLFSL.PTFSNIEGKIIMMPSPFYTVMIKISLSISNVISIICLFKTYHLIDYETVGNDLYITLSFVKENDYENFINGVST....LKFdDVT.DYSFFSL.CDDFLMNIYLCFPWLSHDITDYLTTVKC-TRKMFKSLEDDIRDSLRSKKYVVVYPHFSKTVFNKNDRQMHKIVIL...................DCLN---....------..SLNNELPRl..sVNL..........................MKKQTK.NKILIKYNDSSLIKYVNF.....AIG.YKHK-IL...KENEGVCIHHQFSSEDISSILESDTFLKYNKSKPGAMYQYLLLSFFVSGYSIEDILLNRESTVKL..LRQYNN..KILFGKKAGTTLTTKSNFVGGLLKSKDIRNNIMTSIMWELKKMGLIYSMEHTKI-DKKIFYIFMFTIYPDDVFSYFS--KKFLSHCLVVSKKG...PIDDFSSIKKDVIIKL..
U3UB96_9POXV/1-592             MIVLANGVRLFVNESMAKDIFVGIANFGFENDVAD.VLGVSHLLEHVLISFDPGRFVANATTSRNCMSFWCRAVDARR.GNDAVRLLTSWFFPDG.RLRVDFSGVRIADYIHELENEYYFRNEILHCLDVITFLCGGDLYNGGRLCMLERADEVRDLLAKRMRRIAGPNVVIFVKRLGPSVLSLLSRTFGALPRCPDSVMG.RLPKDIGGKIVMMPTPFYTMMVHVPATVDNVLAILYLSEAYHLVDFEAVGASLYVSISFVHEDDFDRFMRGEAV....PRF.GEP.GALDIGE.GDDFLMNLYLCFPWMKNDILDYVAEFEANKVAIVRGLERDIRDAVLARDLVAVYPNFSKSVFNAQDSQRHRLVVM...................DAQPCAA....SEALGR..R------D....AVF..........................MRKQPTrDEMFVRYGDTRLLDVVAM.....AVG.QRSLTLR...RTRDGVRVQHRMSATDMRSILESDVFLKYSRSRPAALYQYILLDFFTSGRSIEDILANRESALVF..HGRGEN..RLVFGRRTKFAVTSGSSFVCGVVRGGGVSEDWAVGLMWRLKRKGLIYSMDHTKLRGRRTMFLFAFSIYPEKVYSFLTKDAAVKDHCLVVSTVG...E-EDFSALYKSVTVRL..
T2ASN7_9POXV/1-589             MIVFDNGTRVFINASTNKDIYVGISGFGFEKDIGG.ILGIAHLLEHILISFDASRFVANASTARSYMSFWCAAIRGRAtSVDAVRTLISWFFDRN.GLKDEFAISKIKYHIKELENEYYFRNEVFHCMDALTFLANGDLYNGGRLSMMDRLDDIPLILRDRMSTIIGPNVVIFVKELNDVVLSMLANTFGRLPSCPLTIPR.TLPTTIGGKIIMMPSPFYTVMVRVEPTLHNILSILCLYELYHLVDYETVDNNLYVTISFIHEHEYERFLQGAGR....LNL.AIY.KKIHLHY.GDDFLMNAYLSFPCIRHDIVDYLTIVNTDMSSMISSLEQNIYRSVRTGEYIVVYPNFSNTMSNATDRQLHKTVVI...................NTNLVYT....SQPT--..------TT....INL..........................MKKQTH.NDMYIKYSDTEFIDYVQL.....ALG.LRRT-IH...KHVDGIHIRHQFSAEDIKTILESDTFIRYSKSKPAAMYQYLILSFFVSGNTIEDILQHRESVVKL..CRTYKN..KIVLGKQARYDIQTLSSFVCGIFKGPSVTNEYLTDIMWKLKRKGLIYSLESVEL-QKNMFYLFMFTIYPEDVTAYLSSRKLFTSRCVVVSKKG...NVEDFSAMKKDIIIKL..
U5TDI0_COWPX/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPSCPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QSINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SKRTKS..KILFGRNTRHDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNNNKRFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
G1_VAR67/1-591                 MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTIFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFNQTFGSLPACPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QRINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYTSIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILTNRDSTLEF..SKKTKS..KILFGRNARYDVTTKSSFVCGIVRGKLLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNTNKLFSAKCLVISTKG...DVENFSSLKKDVVIRV..
#=GR G1_VAR67/1-591      sAS   ............................................*..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q91MV7_LSDV/1-595              MIVLSNGVRIFIDELMNKDIYLGIASFGFENDIGN.IIGIAHLLEHILITFDPSKFVANASTARSYMSFWCRSIKGKSkTIDAVETLISWFFDEN.KIKDTFSISKIKDHIKELENEYYFRNEIFHCMDALSFLANGDLYNGGRISMLQNINNIDDMLSSRMHRIIGPNVVIFVKALDEYTLSLLSKTFGKLPTCPLTIPY.NNLPTIKGKFVMMPSPFYTVMVNIKPTLDNILSMISLYEMYHLIDYETIGDQLYISISFINEDDFEKFIKGIYI....IDF.EAY.KNITFNY.GDDFLMNIYLSFPWIQHDIYDYITEINCNISIILKSLEDNIYNSIASGNYVAIYPNFSNVIFNKNDSQMHKIIVM...................DNN-NFS....INDIYN..N-TNTKSR....IKL..........................MKKQSQ.NEIYIKYDDVEFISYVNL.....ALG.FKNK-IK...KKNDGVQINHQFSSEDIKNILESETFLKYSKSKPATMYQYLLLSFFVSGNSIEDILLNRESVLKP..VKHFKN..KIVFGKKSKYHIKTFSSFVCGLVKGINITNESLTNMMWVLKRKGLIYSLDFTKL-DKHLYYVFMFTIYPNSVVKYITTENIFKNHCLVISEKG...IVEDFSSMKKDIVIKL..
Q8V510_MONPV/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ETDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPSCPEIIPS.SIPVSTNGKIVMTPAPFYTVMVRINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QSINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHQIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASPMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILTNRDSTLEF..SKRTKS..KILFGRNTRYDITAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNNNKLFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
A9J1M8_VACCA/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPACPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QRINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SKRTKS..KILFGRNTRYDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNTNKLFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
G0XX20_COWPX/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPACPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKVNPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QSINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SKRTKS..KILFGRNTRYDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNNNKRFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
U5TET1_COWPX/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNVVIFVKRLGPGTLDFFKQTFGSLPACPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QSINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SKRTKS..KILFGRNTRYDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNTNKLFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
Q6TVF1_9POXV/1-597             MIVLGNGVRVFLRPSMKRDIYLGISNFGFGRDVGD.VLGLAHLLEHVLISFDHRRFLANASTARNFMSFWCKSLRGRP.-MDAVRELASWFFEDG.RLRTCFDDVDVRAFAKELENEYYFRNEVLHCFDVLTFLGGGDLYNGGRFDDLVAATDIRERMAARMRSIAGPSIVVFLRQISAPAVELLNATFGTLPRTPDVICP.RAVAGVGGKAVMMATPFYSVLVRVDATLDNALAVMALRETYHLFDYETMGEDLYVVLSFVDETDYDGLLRGIKD....LPL.ETV.PDARLAVdSDDHAMNAYLNFPWMSHDLLDYEDYFRDNAERLVAGLKRDILAAVAERDCVALYPGFTSSIFNAQDAQRHRVMML...................DLHQDQD....GRPLHR..-GHGDACP....VRL..........................MRKTPAgGNVVVRLGDADLLRFVTL.....ATAvHPETRVR...RTHEGIRFQHRLSAEDMDAIMESEVFMKFSKSRPAAAYQYMFLDFFASERSMEDILENRTT--AR..RGGCMP..HLVFDRRTRYDVVACSSFVCGVVKGRALRKERLHELMWRMKRLGIIYSLDHTPLKSPCTFYVFAFSLSPEETFRCISKCPGVTSYCLVVARRG...AADDFSALTKKVVLRM..
Q80DZ5_COWPX/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPACPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QSINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SKRTKS..KILFGRNTRYDVTAKSSFVCGIVRGKSLDKTSLIEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNNNKLFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
Q0NCQ8_VAR65/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTIFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFNQTFGSLPACPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QRINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYTSIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILTNRDSTLEF..SKKTKS..KILFGRNARYDVTTKSSFVCGIVRGKLLDKTSLVKMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNTNKLFSAKCLVISTKG...DVENFSSLKKDVVIRV..
D2JM88_9POXV/1-70              MITFENGVRIFPRPTMTKDIYIGIANFGFENDISE.VLGIAHLLEHILISFDYTRFIANASTSRSYMSFWC-------.----------------.---------------------------------------------------------------------------------------------------------.--------------------------------------------------------------------------....---.---.-------.---------------------------------------------------------------------------...................-------....------..--------....---..........................------.------------------.....---.-------...-----------------------------------------------------------------..------..---------------------------------------------------------------------------------------------...----------------..
D2JM84_9POXV/1-70              MIVLPNKARIFINDRMKKDIYLGISNFGFENDIDE.VLGIAHLLEHLLISFDSTKFLANASTSRSYMSFWC-------.----------------.---------------------------------------------------------------------------------------------------------.--------------------------------------------------------------------------....---.---.-------.---------------------------------------------------------------------------...................-------....------..--------....---..........................------.------------------.....---.-------...-----------------------------------------------------------------..------..---------------------------------------------------------------------------------------------...----------------..
K4J8U6_9POXV/1-589             MIVFDNGTRVFINSSTNKDIYVGFSGFGFEKDIGG.ILGIAHLLEHILISFDASRFVANASTARSYMSFWCTPIRGRAtSVDAVRTLISWFFDKD.GLKDDFPVSKIKHHIKELENEYYFRNEVFHCMDALTFLANGDLYNGGRLSMLDRLEDIPLILRDRMRTIIGPNVVIFVRELNDVVLSLLANTFGRLPACPLTIPC.TVRTIIGGKTIMMPSPFYTVMVRVEPSLHNILSILCLYEIYHLVDYETVDNKLYVTFSFIHEHNYERFLQGSGR....LNL.TIY.KKIRLCY.GDDFLMNVYLSFPCIRHDIFDYLTIVNTDTSSMISSLERDIYQSVRTGDYIVVYPNFSNTMSNTADRQLHKTVVI...................NPNIVYA....SQPTTS..--------....IDL..........................MKKQTH.NEMYIKYSDAGFIDYVQL.....ALG.LRRK-IH...KHVHGIHIRHQFSADDIKTILESDTFMKYSKSKPAAMYQYLILSFFVSGNTIEDILQHRESVVKL..CRTYKN..KIVLGKQTRYDIQTLSSFVCGIFKGPSVTSEYLTDIMWKLKRKGLIYSLEFVEL-QKNMFYLFMFTIYPEDVTTYLSSRKLFTSRCVVVSKKG...NTEDFSSMKKDIIIKL..
D3IZ53_9POXV/1-597             MIVLDNGVRVFLRPSMKRDVYLGISNFGFGRDVGA.VLGLAHLLEHVLISFDHRLFLANASTSRNYMSFWCKSRRNRP.-ADAVRELVSWFFDDG.GLRTNFEDVDIRAYAKELENEYYFRNEVLHCFDVLTFLGGGDLYNGGRFADFVNTPDLPARMRERMLSISGSSVVVFLRESGAATVALLNATFGRLPRAPEVIFP.RAVACEGGKAVMMATPFYSILARVHASLDNALAVLALRELYHLFDYETVGEDLFVVLSFVDEADYDGLLRGIKD....LPL.AAT.PDVRICFdAEDYAMNAYLNFPWMAHDILDYENYFVENAARLVAGLKRDVLHAIAERDCVVLYPGFTSSIFNAEDAQRHRLVMI...................DLPPDSP....GGRVRR..N-HNDGAP....AKL..........................MRKTRTpGNVLVRFGDADLLNFVTL.....ALSmHTDARLF...HTFEGIRLQHRLAAEDMDAIMGSDAFMKFSRSRPAVAYQYMFLDFFASERSMEEIVENRAA----..ARRVGGasHLVFGRNTRYDVVACSSFVCGVLKGRALRADHINALMWRMKKLGVIYSMDHTPLKSPHTFYVFAFSLSQEEAFRCIARCTHVTSHCLVVARRG...VADDFSSVCKKVVLRM..
V5K998_YMTV/1-70               MIVLSNGVRIFINDDMNKDIYLGVASFGFENDIGE.ILGVAHLLEHILISFDSSKFIANASTARSYMSFWC-------.----------------.---------------------------------------------------------------------------------------------------------.--------------------------------------------------------------------------....---.---.-------.---------------------------------------------------------------------------...................-------....------..--------....---..........................------.------------------.....---.-------...-----------------------------------------------------------------..------..---------------------------------------------------------------------------------------------...----------------..
U5TKD1_COWPX/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPACPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QSINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SKRTKS..KILFGKNTRYDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNTNKLFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
Q0NPD0_9POXV/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTIFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFNQTFGSLPACPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QRINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SKRTKS..KILFGRNTRYDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNTNKLFSAKCLVVSTKG...DVEIFSSLKKDVVIRV..
MP44_MYXVL/1-589               MIVFDNGTRVFINSSTNKDIYVGFSGFGFEKDIGG.ILGIAHLLEHILISFDASRFVANASTARSYMSFWCTPIRGRAtSVDAVRTLISWFFDKD.GLKDDFPVSKIKYHIKELENEYYFRNEVFHCMDALTFLANGDLYNGGRLSMLDRLEDIPLILRDRMRTIIGPNVVIFVRELNDVVLSLLANTFGRLPACPLTIPC.TVRTIIGGKTIMMPSPFYTVMVRVEPSLHNILSILCLYEIYHLVDYETVDNKLYVTFSFIHEHDYERFLQGSGR....LNL.TIY.KKIRLCY.GDDFLMNVYLSFPCIRHDIFDYLTIVNTDTSSMISSLERDIYQSVRTGDYIVVYPNFSNTMSNTADRQLHKTVVI...................NPNIVYA....SQPTTS..--------....IDL..........................MKKQTH.NEMYIKYSDAGFIDYVQL.....ALG.LRRK-IH...KHVHGIHIRHQFSADDIKTILESDTFMKYSKSKPAAMYQYLILSFFVSGNTIEDILQHRESVVKL..CRTYKN..KIVLGKQTRYDIQTLSSFVCGIFKGPSVTSEYLTDIMWKLKRKGLIYSLEFVEL-QKNMFYLFMFTIYPEDVTTYLSSRKLFTSRCVVVSKKG...NTEDFSSMKKDIIIKL..
#=GR MP44_MYXVL/1-589    sAS   ............................................*..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
MP44_MCV1/1-592                MILLENGVRVFPKPGMGKDIYIGLANFGFENDVPE.LLGVAHLLEHILISFDYTRFVANASTARTYMSFWCRALRAED.YLAALETAVSWFFARG.ALRTDFSRVRIRNYVRELENEYYFRNEVFHCMDILTFLGGGDLYNGGRLSMLEQLDAVRELLGKRMRRLAGPNVVIFVRELSPAALALLERSFGTLPRFPSTIPA.TRLGSIHNKAVLVPAPFYALLIQVDNTVENVLAVICLAESYHFVDYETLGERLYVSFAFVHEQDCEAFLRNVGE....LRF.EPA.PRVELNY.SDDYVMNLYVNFPWLQHDLADYLYTLNADCVPLLRGLEENLRRSVRERQLVVVYPSFSPSLFNSRDRQDHRLLVL...................DVDLARS....AGPARV..--------....PRT..........................FRRQPR.AEVFVRYGDPALLDYVAF.....ALArPRAAALR...RLPRGVRLAHGFSHADMHEIMASETFIKYSRSRPAALFQYIFLAFFATGRSIAEILERREALVSF.dARRCVN..RLVFAKRARYDVVTKSSFVCGVLRGPRLSEAALTRAMWELKRKGLLYSLEHTRMHAKHTFYVFAFSIYPEQVYRYFARWQLVSKHCCVVSMRG...EREDYSALRKEVVVN-f.
#=GR MP44_MCV1/1-592     sAS   ............................................*..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
U5TG24_COWPX/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPSCPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QSINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SKRTKS..KILFGRNTRYDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNTNKLFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
Q49PQ7_9POXV/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPACPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QRINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SKRTKS..KILFGRNTRYDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNTNKLFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
Q8V2U2_CAMPM/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDKFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIVMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFNQTFGSLPACPEIITS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QRINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SKRTKS..KILFGRNTRYDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNTNKLFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
D2JM85_9POXV/1-70              MIVLPNKARIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTKFLANASTSRSYMSFWC-------.----------------.---------------------------------------------------------------------------------------------------------.--------------------------------------------------------------------------....---.---.-------.---------------------------------------------------------------------------...................-------....------..--------....---..........................------.------------------.....---.-------...-----------------------------------------------------------------..------..---------------------------------------------------------------------------------------------...----------------..
Q0NLZ0_VAR66/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTIFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFLNQTFGSLPACPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QRINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYTSIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILTNRDSTLEF..SKKTKS..KILFGRNTRYDVTTKSSFVCGIVRGKLLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNTNKLFSAKCLVISTKG...DVENFSSLKKDVVIRV..
Q5IXV5_MONPV/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPSCPEIIPS.SIPVSTNGKIVMTPAPFYTVMVRINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QSINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYTSIINRDIIVIYPNFSKAMCNTRDTQQHQIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILTNRDSTLEF..SKRTKS..KILFGRNTRYDITAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNNNKLFSAKCLVVSTKG...DVENFSSLKKDVVIRF..
Q8V3P7_SWPV1/1-592             MIVLSNGVRIFIDNSMHKDIYLGISRFGFENDIYE.VLGIAHLLEHILIDFDSSKFIANASTARSYMSFWCNSIKGKStFLDSVKRLISWFFYKD.KIRDSFSISKIKYHIKELENEYYFRNEVFHCMDVLTFLIDGDLYNGGRISMLNNINDISIMLHNRMHRIIGPNIIIFVKDINDYVLSILEKSFGSLPSCPLTIPY.MMSSHITGKIIMMPSPFYTIMINIKSTLDNILSIMCLYEIYHLIDYETVGDQLYITISFIDEKDYESILKGISR....IRL.HID.REIMMKH.TDDFLMNIYLCFPWIRNDIIDYWTDINYNIDTMLQSLNEEIYMSILQGEYIAIYPNFSDIIFNTKDRQMHKLVIM...................DTDINNS....IN----..NQHTQPNY....INL..........................MKKQTY.NEIYIKYGDTDFIDYVNL.....ALG.FKHT-IQ...RNNDGIKIRHQFSSDDIRTILESDVFLKYSKSKPAAMYQYLMLSFFVSGNTIEDILSNRESVLRL..CKKYNN..KIIFGKRTRYDIQTYSSFVCGIVKG-SITNELLTNMMWSLKKKGLIYSLEFTKL-KTNIFYIFMFTIYPDDVFKYVSSKQYFKSYCIVVSNKG...DYEDFSSMKKDIVIKL..
Q0NPZ7_COWPX/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPSCPEIIPS.SIPVSTNGKIVMTPAPFYTVMVRINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFIRGEAI....LQI.SQC.QSINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SKRTKS..KILFGRNTRYDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNNNKLFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
G0XWF9_COWPX/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPACPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QSINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SKRTKS..KILFGRNTRYDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNNNKRFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
H2DS96_9POXV/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPACPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QSINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SKRTKS..KILFGRNTRYDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNTNKLFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
Q8QMY2_COWPX/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPACPEIIPS.YIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QSINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SKRTKS..KILFGRNTRYDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNNNKRFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
D2JM93_9POXV/1-70              MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWC-------.----------------.---------------------------------------------------------------------------------------------------------.--------------------------------------------------------------------------....---.---.-------.---------------------------------------------------------------------------...................-------....------..--------....---..........................------.------------------.....---.-------...-----------------------------------------------------------------..------..---------------------------------------------------------------------------------------------...----------------..
U5TD87_COWPX/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPSCPEIIPS.SIPVSTNGKIVMTPSPFYTVMVRINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFIRGEAI....LQI.SQC.QSINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SKRTKS..KILFGRNTRYDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNNNKLFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
G1_VACCC/1-591                 MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPACPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QSINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SKRTKS..KILFGRNTRYDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNTNKLFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
#=GR G1_VACCC/1-591      sAS   ............................................*..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q775W6_CAMPS/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDKFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIVMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFNQTFGSLPACPEIITS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QRINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SKRTKS..KILFGRNTRYDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNTNKLFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
F1AX06_ORFV/1-598              MIVLENGVRVFLRPSMKRDVYLGISNFGFGRDVGA.VLGLAHLLEHVLISFDHRFFLANASTSRNYMSFWCKSRRNRP.-ADAVRELASWFFDGG.GLRTNFENVDIRAYAKELENEYYFRNEVLHCFDVLTFLGGGDLYNGGRFADLVTTPDLPARMRERMLSISGPSVVVFLRQSDAATVALLNATFGRLPRTPEVIFP.RAVACEGGKAVMMATPFYSILARVHASLDNALAVLALRELYHLFEYETVGEDPFVVLSFVDESDYDGLLRGIKD....LPI.AAT.PDTRICFdAEEYAMNAYLNFPWMAHDILDYENYFVENAERLVAGLKRDVLHAISERDCVVLYPGFTSSIFNAEDAQRHRLVMI...................DLPPESP....GDKMRR..RSHNDGAP....ARL..........................MRKTRTpGNVLVRFGDADLLNFVTL.....ALSmHADARLF...HTFEGIRLQHRLAAEDMDAIMDSDAFMKFSKSRPAVAYQYMFLDFFASERSMEDIVENRAA----..ARRAAGapHLVFGRHTRYDVVACSSFVCGVLKGRALRADHINALMWRMKKLGVIYSMDHTPLKSPHTFYVFAFSLSQEEAFRCIARCPHVTSYCLVVARRG...VADDFSGVSKKVVLRM..
Q0NG75_VAR46/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTIFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFNQTFGSLPACPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QRINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYTSIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILTNRDSTLEF..SKKTKS..KILFGRNARYDVTTKSSFVCGIVRGKLLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNTNKLFSAKCLVISTKG...DVENFSSLKKDVVIRV..
V5K9H1_YMTV/1-70               MIVLSNGVRIFINDDMNKDIYLGVASFGFENDIGE.ILGVAHLLEHILISFDSSKFIANASTARSYMSFWC-------.----------------.---------------------------------------------------------------------------------------------------------.--------------------------------------------------------------------------....---.---.-------.---------------------------------------------------------------------------...................-------....------..--------....---..........................------.------------------.....---.-------...-----------------------------------------------------------------..------..---------------------------------------------------------------------------------------------...----------------..
G0XVU5_COWPX/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPACPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QSINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTKDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SKRTKS..KILFGRNTRYDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNTNKLFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
Q0GP06_HSPV/1-591              MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPACPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QRINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SKRTKS..KILFGRNTRYNVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNNNKLFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
Q08FC3_DPV84/1-596             MIVLSNGVRIFINPYMIKDIYLGIASFGFENDIGN.ILGVAHLLEHILISFDSSKYVANASTARSYMSFWCSSIKGRSnRLDAIKTLISWFFTGNgIIKDIFTPTKIKDHIKELENEYYFRNEIFHCMDVLTFLSDGDLYNGGRIDMINDIDTLENILYSRMHRIIGPNTIIFIKELDEETLSLLSNTFGKLPSCPLTIPC.NSFSSIVGKVVMMPSPFYTVMVNVKQSLENILAIMCLYEIYHLIDYETVGDQLYITISFVKEQEYDNFLKGVSI....LKF.-IP.DEIKFNH.SDDFLMNLYLCFPWIKNDIFDYIVDVNNNMLNMFKSLEDEIYTSIRYGKYISIYPNFSKSIFNKTDRQQHKIVVL...................DCKIDHE....NKDISN..IINNN---....IYL..........................MKKQMInNEIHIKYGDKAFIDYAIL.....GIM.YKNNKIF...KSNHGINIHHQFSSDDINTILESDTFLKYSKSKPAAIYQYLILSFFVSGNSIEDILSKRESTINF..CKDYKN..KILFGKQLRYDIKTNSSFVCGIVKGNSISNETLTNLMWSLKKKGLIYSLEFTKL-DKKIFYIFMFTIYPEDVFKIITSNKMFNRHCIVVSNKR...DIEDFSSLKKDIIIKI..
H2DX12_9POXV/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPACPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QSINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SKRTKS..KILFGRNTRYDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNNNKLFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
H2DXK8_9POXV/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVSDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPACPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QRINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SKRTKS..KILFGRNTRYDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNTNKLFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
D2JM87_9POXV/1-70              MIVLSNGVRIFINPYMIKDIYLGIASFGFENDIGN.ILGVAHLLEHILISFDSSKYVANASTARSYMSFWC-------.----------------.---------------------------------------------------------------------------------------------------------.--------------------------------------------------------------------------....---.---.-------.---------------------------------------------------------------------------...................-------....------..--------....---..........................------.------------------.....---.-------...-----------------------------------------------------------------..------..---------------------------------------------------------------------------------------------...----------------..
Q0N847_VARV/1-591              MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTIFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFNQTFGSLPACPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QRINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYTSIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILTNRDSTLEF..SKKTKS..KILFGRNARYDVTTKSSFVCGIVRGKLLDKTSLVKMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNTNKLFSAKCLVISTKG...DVENFSSLKKDVVIRV..
U5THX5_COWPX/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPACPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QSINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SKRTKS..KILFGRNTRYDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNTNKLFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
Q8JTV1_LSDV/1-594              MIVLSNGVRIFIDELMNKDIYLGIASFGFENDIGN.IIGIAHLLEHILITFDPSKFVANASTARSYMSFWCRSIKGKSkTIDAVETLISWFFDEN.KIKDTFSISKIKDHIKELENEYYFRNEIFHCMDALSFLANGDLYNGGRISMLQNINNIDDMLSSRMHRIIGPNVVIFVKALDEYTLSLLSKTFGKLPTCPLTIPY.NNLPTIKGKFVMMPSPFYTVMVNIKPTLDNILSMISLYEMYHLIDYETIGDQLYISISFINEDDFEKFIKGIYI....IDF.EAY.KNITFNY.GDDFLMNIYLSFPWIQHDIYDYITEINCNISIILKSLEDNIYNSIASGNYVAIYPNFSNVIFNKNDSQMHKIIVM...................DNN-NFS....INDIYN..N--TTKSR....IKL..........................MKKQSQ.NEIYIKYDDVEFISYVNL.....ALG.FKNK-IK...KKNDGVQINHQFSSEDIKNILESETFLKYSKSKPATMYQYLLLSFFVSGNSIEDILLNRESVLKP..VKHFKN..KIVFGKKSKYHIKTFSSFVCGLVKGINITNESLTNMMWVLKRKGLIYSLDFTKL-DKHLYYVFMFTIYPNSVVKYITTENIFKNHCLVISEKG...IVEDFSSMKKDIVIKL..
Q6TW63_ORFV/1-598              MIVLENGVRVFLRPSMKRDVYLGISNFGFGRDVGA.VLGLAHLLEHVLISFDHRFFLANASTSRNYMSFWCKSRRNRP.-ADAVRELASWFFDGG.GLRTNFENVDIRAYAKELENEYYFRNEVLHCFDVLTFLGGGDLYNGGRFADLVTTPDLPARMRERMLSISGPSVVVFLRQSDAATVALLNATFGRLPRTPEVIFP.RAVACEGGKAVMMATPFYSILARVHASLDNALAVLALRELYHLFDYETVGEDLFVVLSFVDESDYDGLLRGIKD....LPI.AAT.PDTRICFdAEDYAMNAYLNFPWMAHDILDYENYFVENAERLVAGLKRDVLHAISERDCVVLYPGFTSSIFNAEDAQRHRLVMI...................DLPPESP....GDKMRR..RSHNDGAP....ARL..........................MRKTRTpGNVLVRFGDADLLDFVTL.....ALSmHADARLF...HTFEGIRLQHRLAAEDMDAIMDSDAFMKFSKSRPAVAYQYMFLDFFASERSIEDIVENRAA----..ARRAGGapHLVFSRNTRYDVVACSSFVCGVLKGRALRADHINALMWRMKKLGVIYSMDHTPLKSPHTFYVFAFSLSQEEAFRCIARCPHVTSYCLVVARRG...VADDFSGVSKKVVLRM..
B2CWF2_9POXV/1-589             MIVFDNGTRVFINSSTNKDIYVGFSGFGFEKDIGG.ILGIAHLLEHILISFDASRFVANASTARSYMSFWCTPIRGRAtSVDAVRTLISWFFDKD.GLKDDFPVSKIKYHIKELENEYYFRNEVFHCMDALTFLANGDLYNGGRLSMLDRLEDIPLILRDRMRTIIGPNVVIFVRELNDVVLSLLANTFGRLPACPLTIPC.TVRTIIGGKTIMMPSPFYTVMVRVEPSLHNILSILCLYEIYHLVDYETVDNKLYVTFSFIHEHDYERFLQGSGR....LNL.TIY.KKIRLCY.GDDFLMNVYLSFPCIRHDIFDYLTIVNTDTSSMISSLERDIYQSVRTGDYIVVYPNFSNTMSNTADRQLHKTVVI...................NPNIVYA....SQPTTS..--------....IDL..........................MKKQTH.NEMYIKYSDAGFIDYVQL.....ALG.LRRK-IH...KHVHGIHIRHQFSADDIKTILESDTFMKYSKSKPAAMYQYLILSFFVSGNTIEDILQHRESVVKL..CRTYKN..KIVLGKQTRYDIQTLSSFVCGIFKGPSVTSEYLTDIMWKLKRKGLIYSLEFVEL-QKNMFYLFMFTIYPEDVTTYLSSRKLFTSRCVVVSKKG...NTEDFSSMKKDIIIKL..
Q08FU3_DPV83/1-596             MIVLSNGVRIFINPYMIKDIYLGIASFGFENDIGN.ILGVAHLLEHILISFDSSKYVANASTARSYMSFWCNSIKGRSnRLDAIKTLISWFFTGNgRIKDIFTPTKIKDHIKELENEYYFRNEIFHCMDVLTFLSDGDLYNGGRIDMINDIDTLENILYSRMHRIIGPNTIIFIKELDEETLSLLSNTFGKLPSCPLTIPC.NSFSSIVGKVVMMPSPFYTVMVNVKQSLENILAIMCLYEIYHLIDYETVGDQLYITISFVKEHEYDNFLKGVSM....LKF.-IP.DEIKFNH.SDDFLMNLYLCFPWIKNDIFDYIVDVNNNMLNMFKSLEDEIYTSIRYGKYISIYPNFSKSIFNKTDRQKHKIVVL...................DCKIDHE....NKDSSN..IINNN---....IYL..........................MKKQMInNEIHIKYGDKAFIDYAIL.....GIM.YKNNKIF...KSNHGINIHHQFSSDDINTILESDTFLKYSKSKPAAIYQYLILSFFVSGNSIEDILSKRESTINF..CKDYKN..KILFGKQLRYDIKTNSSFVCGIVKGSSISNETLTNLMWSLKKKGLIYSLEFTKL-DKKIFYIFMFTIYPEDVFKIITSNKMFNRHCIVVSNKS...DIEDFSSLKKDIIIKI..
W5U9B7_ORFV/1-598              MIVLENGVRVFLRPSMKRDVYLGISNFGFGRDVGA.VLGLAHLLEHVLISFDHRFFLANASTSRNYMSFWCKSRRNRP.-ADAVRELASWFFDGG.SLRTNFENVDIRAYAKELENEYYFRNEVLHCFDVLTFLGGGDLYNGGRFADLVTTPDLPARMRERMLSISGPSVVVFLRQSDAATVALLNATFGRLPRTPEVIFP.RAVACEGGKAVMMATPFYSILARVHASLDNALAVLALRELYHLFDYETVGEDLFVVLSFVDESDYDGLLRGIKD....LPI.AAT.PDTRICFdAEDYAMNAYLNFPWMAHDILDYENYFVENAERLVAGLKRDVLHAISERDCVVLYPGFTSSIFNAEDAQRHRLVMI...................DLPPESP....GDKMRR..RSHNDGAP....ARL..........................MRKTRTpGNVLVRFGDADLLDFVTL.....ALSmHADARLF...HTFEGIRLQHRLAAEDMDAIMDSDAFMKFSKSRPAVAYQYMFLDFFASERSIEDILENRAA----..ARRAGGapHLVFGRNTRYDVVACSSFVCGVLKGRALRADHINALMWRMKKLGVIYSMDHTPLKSPHTFYVFAFSLSQEEAFRCIARCPHVTSYCLVVARRG...VADDFSGVSKKVVLRM..
M9WKW5_9POXV/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPACPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QRINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYTSIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SKRTKS..KILFGRNTRYDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNTNKLFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
D2JM91_9POXV/1-70              MIVLPNKVRIFINNQMKKDIYVGISNFGFENDIGE.ILGIAHLLEHLLITFDSTKFLANASTSRSYMSFWC-------.----------------.---------------------------------------------------------------------------------------------------------.--------------------------------------------------------------------------....---.---.-------.---------------------------------------------------------------------------...................-------....------..--------....---..........................------.------------------.....---.-------...-----------------------------------------------------------------..------..---------------------------------------------------------------------------------------------...----------------..
F1DIS7_MONPV/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ETDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDXYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPSCPEIIPS.SIPVSTNGKIVMTPAPFYTVMVRINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QSINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHQIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILTNRDSTLEF..SKRTKS..KILFGRNTRYDITAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNNNKLFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
U5TIL1_COWPX/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFNQTFGSLPACPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFIRGEAI....LQI.SQC.QRINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRIKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SKRTKS..KILFGRNTRYDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNTNKLFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
G0XSH3_COWPX/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPSCPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QSINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SKRTKS..KILFGRNTRYDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNNNKLFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
MP44_FOWPN/1-625               MIQLNNGIRIFVNHSMKKDIYIGISDFGFEKDINDgILGIAHLLEHILISFDNKYFNANASTSRTYMSFWCVALQKRH.YEDAIRTAISWFFDKKyILKTDFSRIVLENYITELENEYYYRTEMYHCMDVLAYLYGGDLYNGGRITMLERLPEIRNMLSNRMKFLSGKNIVIFVKRLTNNILTLLTNTFGSIPKYPIIIPLdPQIQDARRKIIMMPCPFYTLLIQVDNTMNNLLAIICLVENYNLIDYETISDKLYVCISFANEDQYEYLLYNIKD....MDF.-NI.NRIELDL.GEDYIMNLYINFPWLKNDIFEYIHTMNTKSAMLLADLKKNMHNSILEHKFMIIYPSFTKLLYNITDKQNHGILVVgdvs..........ftpekDPSMHHS....NKENNN..NYSKTVTKrkskYVM..........................YRKTPTtNNIVIDYTDSSFFDYATFy..hvMKSkYEKTNLFsrlKTSTGMCYKHCFDNDDLNELINSDTFIRYNSSKPAVLYQYILLAYFVTERDIKELVDYKDA-IEL.dMKYYSK.nKILFGKNTRYDIRTKSMFVCGLIKGRKLSEKVITDYMWKLKSLGLIYYLTSIKLGISNTFYIFAFTIFPEKVYNFFVGLKEITNRCLIVSNKNtkiEEDDYSSLNKQIVI--gi
#=GR MP44_FOWPN/1-625    sAS   ............................................*..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
D3IZI4_9POXV/1-597             MIVLDNGVRVFLRPSMKRDVYLGISNFGFGRDVGA.VLGLAHLLEHVLISFDHRLFLANASTSRNYMSFWCKSRRNRP.-ADAVRELVSWFFDDG.GLRANFEDVDIRAYAKELENEYYFRNEVLHCFDVLTFLGGGDLYNGGRFTDFVNTPDLPARMRERMLSISGSSVVVFLRESGAATVALLNATFGRLPRAPEVIFP.HAVACEGGKAVMMATPFYSILARVHASLDNALAVLALRELYHLFDYETVGEDLFVVLSFVDEADYDGLLRGIKD....LPL.AAT.PDVRICFdAEDYAMNAYLNFPWMAHDILDYENYVVENAARLVAGLKRDVLHAIAERDCVVLYPGFTSSIFNTEDAQRHRLVMI...................DLPPDSP....GARARR..N-HNDGAP....AKL..........................MRKTRTpGNVLVRFGDADLLNFVTL.....ALSmHTDARLF...HTFEGIRLQHRLAAEDMDAIMGSDAFMKFSRSRPAVAYQYMFLDFFASERSMEEIVENRAA----..ARRAGGasHLVFGRNTRYDVVACSSFVCGVLKGRALRADHINALMWRMKKLGVIYSMDHTPLKSPHTFYVFAFSLSQEEAFRCIARCPHVSSHCLVVARRG...VADDFSSVCKKVVLRM..
A7XCH0_9POXV/1-589             MIVLSNGVRIFINSNMNKDIYLGIASFGFENDIGE.ILGIAHLLEHILISFDSSKFVANASTARKYMSFWCCSIKGKSnYIDSINTLISWFFNNN.KLRDNFCLNDIKNHIKELENEYYFRNEVFHCMDVLTFLENGDLYNGGRIDMLNNLESVNNMLYNRMHKIIGPNIVIFVKELNKNCLMLIQNSFGTLPSCPMSFSF.PNFSNIDGKIIMMPSPFYTVMIKVSLSISNVISIMCLFETYHLIDYETVGNDLYVTLSFVKESDYENFINGVST....LKF.NNVpNYTVLSL.CDDFLMNAYLCFPWLSNDINNYLSTVRY-SQNMFKNLEEDIQNSILLKKYIVVYPHFSKTVFNKNDSQMHKIVIL...................DCLNEIK....EDQLPQ..------LN....VNL..........................MKKQTK.NEIFIKYNDSSLIKYIIF.....AIG.YKNN-IL...RGNEGVSIYHQFSSEDIKSILESDTFLKYSKSKPAAMYQYLLLSFFVSGYSIEDILLNRESTIKL..LKQYNN..KILFGKKSRYDITTKSNFVCGIIKNKNINNNVITNTMWELKKKGLIYSMEHTKI-DKRIFYIFMFTIYPDEVFLYLS--KNFLSHCLIVSKTG...NIEDFSSMKKDVIIKL..
G0XTD8_COWPX/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPACPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QSINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SKRTKS..KILFGRNTRYDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNNNKLFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
MP44_VACCA/1-591               MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPACPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QRINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SKRTKS..KILFGRNTRYDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNTNKLFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
#=GR MP44_VACCA/1-591    sAS   ............................................*..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q0N5U0_VARV/1-591              MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTIFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFLNQTFGSLPACPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QRINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYTSIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILTNRDSTLEF..SKKTKS..KILFGRNTRYDVTTKSSFVCGIVRGKLLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNTNKLFSAKCLVISTKG...DVENFSSLKKDVVIRV..
Q0N583_VARV/1-591              MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTIFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFNQTFGSLPACPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QRINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYTSIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILTNRDSTLEF..SKKTKS..KILFGRNARYDVTTKSSFVCGIVRGKLLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNTNKLFSAKCLVISTKG...DVENFSSLKKDVVIRV..
MP44_VACCT/1-591               MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPACPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QRINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SKRTKS..KILFGRNTRYDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNTNKLFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
#=GR MP44_VACCT/1-591    sAS   ............................................*..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q8JLE8_9POXV/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPACPEIIPS.SIPVSTNGKIVMTPSPFYTVMVRINPTLDNILGILYLYESYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QSINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYTSIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDIITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILTNRDSTLEF..SKRTKS..KILFGRNTRYDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNTNKLFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
Q3I8U4_MONPV/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ETDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPSCPEIIPS.SIPVSTNGKIVMTPAPFYTVMVRINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QSINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHQIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILTNRDSTLEF..SKRTKS..KILFGRNTRYDITAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNNNKLFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
MP44_RFVKA/1-589               MIVFDNGVRVFINTSTNKDIYVGISGFGFEKDIGG.ILGTAHLLEHILISFDVSRFIANASTARSYMSFWCTSIRGRStPVDAIRTLISWFFDRD.GLKHYFPVSKIKYHIKELENEYYFRNEVFHCMDALTFLANGDLYNGGRLSMLDRLDDMPLILQDRMCAITGPNIVIFVRELNDVVLSLLVSTFGTLPSCPLTIPC.TLPTPIGGKIIMMPSPFYTVMVRVQPSLYNILSILCLYEIYHLVDYETVNNKLYVTISFIHEHEYESFLHGSAR....LNF.TIY.KKIRLHY.GDDFLMNMYLSFPCIRHDIFDYLTIINTNVSTMIPSLEQNIYQSIKTGDYIVVYPNFSNTMSNVADRQLHKTVVI...................DTNIVYV....TKPT--..------TV....IDL..........................MKKHTH.NDMYIKYSDTEFIDYVQL.....ALG.LRRK-IH...KNVNGIHIRHQFSADDIKTILESETFMKYSKSKPAAMYQYLILSFFVSGNTIEDILQHRESVIKL..CRTYKN..KILLGKQTRYDIQTLSSFVCGIFKGPSITSEYLTDIMWKLKRKGLIYSLEFVEL-QKNMFYLFMFTIYPEDVTSYLTSRKLFTSRCVVVSKKC...NVEDFSSMKKDIIIKL..
#=GR MP44_RFVKA/1-589    sAS   ............................................*..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................
Q6TVT3_ORFSA/1-598             MIVLENGVRVFLRPSMKRDVYLGISNFGFGRDVGA.VLGLAHLLEHVLISFDHRFFLANASTSRNYMSFWCKSRRNRP.-ADAVRELASWFFDGG.GLRTNFENVDIRAYAKELENEYYFRNEVLHCFDVLTFLGGGDLYNGGRFADLVTTPDLPARMRERMLSISGPSVVVFLRQSNAATVALLNATFGRLPRTPEVIFP.RAVACEGGKAVMMATPFYSILARVHASLDNALAVLALRELYHLFDYETVGEDLFVVLSFVDESDYDGLLRGIKD....LPI.AAT.PDTRICFdAEDYAMNAYLNFPWMAHDILDYENYFVENAERLVAGLKRDVLHAISERDCVVLYPGFTSSIFNAEDAQRHRLVMI...................DLPPESP....GDKMRR..RSHNDGAP....ARL..........................MRKTRTpGNVLVRFGDADLLNFVTL.....ALSmHADARLF...HTFEGIRLQHRLAAEDMDAIMDSDAFMKFSKSRPAVAYQYMFLDFFASERSMEDIVENRAA----..ARRAAGapHLVFGRNTRYDVVACSSFVCGVLKGRALRADHIDALMWRMKKLGVIYSMDHTPLKSPHTFYVFAFSLSQEEAFRCIARCPHVTSYCLVVARRG...VADDFSGVSKKVVLRM..
G0XV79_COWPX/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLVPGTLDFFKQTFGSLPSCPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QSINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SKRTKS..KILFGRNTRYDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNNNKRFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
Q0NSX6_VARV/1-591              MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTIFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPETLDFFNQTFGSLPACPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QRINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYTSIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILTNRDSTLEF..SKKTKS..KILFGRNARYDVTTKSSFVCGIVRGKLLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNTNKLFSAKCLVISTKG...DVENFSSLKKDVVIRV..
G0XU01_COWPX/1-591             MIVLPNKVRIFINDRMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTNFLANASTSRSYMSFWCKSINSAT.ESDAIRTLVSWFFSNG.KLKDNFSLSSIRFHIKELENEYYFRNEVFHCMDILTFLSGGDLYNGGRIDMIDNLNIVRDMLVNRMQRISGSNIVIFVKRLGPGTLDFFKQTFGSLPSCPEIIPS.SIPVSTNGKIVMTPSPFYTVMVKINPTLDNILGILYLYETYHLIDYETIGNQLYLTVSFIDETEYESFLRGEAI....LQI.SQC.QSINMNY.SDDYMMNIYLNFPWLSHDLYDYITRINDDSKSILISLTNEIYASIINRDIIVIYPNFSKAMCNTRDTQQHPIVVL...................DATNDGL....IKKPYR..S-------....IPL..........................MKRLTS.NEIFIRYGDASLMDMITL.....SLS.KQDISLK...RNAEGIRVKHSFSADDIQAIMESDSFLKYSRSKPAAMYQYIFLSFFASGNSIDDILANRDSTLEF..SRRTKS..KILFGRNTRYDVTAKSSFVCGIVRGKSLDKTSLVEMMWDLKKKGLIYSMEFTNLLSKNTFYLFTFTIYTDEVYDYLNNNKRFSAKCLVVSTKG...DVENFSSLKKDVVIRV..
Q2F8D8_ORFV/1-598              MIVLENGVRVFLRPSMKRDVYLGISNFGFGRDVGA.VLGLAHLLEHVLISFDHRFFLANASTSRNYMSFWCKSRRNRP.-ADAVRELASWFFDGG.GLRTNFENVDIRAYAKELENEYYFRNEVLHCFDVLTFLGGGDLYNGGRFADLVTTPDLPARMRERMLSISGPSVVVFLRQSDAATVALLNATFGRLPRTPEVIFP.RAVACEGGKAVMMATPFYSILARVHASLDNALAVLALRELYHLFDYETVGEDLFVVLSFVDESDYDGLLRGIKD....LPI.AAT.PDTRICFdAEDYAMNAYLNFPWMAHDILDYENYFVENAERLVAGLKRDVLHAISERDCVVLYPGFTSSIFNAEDAQRHRLVMI...................DLPPESP....GDKMRR..RSHNDGAP....ARL..........................MRKTRTpGNVLVRFGDADLLNFVTL.....ALSmHADARLF...HTFEGIRLQHRLAAEDMDAIMDSDAFMKFSKSRPAVAYQYMFLDFFASERSIEDIVENRAA----..ARRAAGapHLVFGRNTRYDVVACSSFVCGVLKGRALRADHINALMWRMKKLGVIYSMDHTPLKSPHTFYVFAFSLSQEEAFRCIARCPHVTSYCLVVARRG...VADDFSGVSKKVVLRM..
#=GC seq_cons                  MIVLPNKVRIFINDcMKKDIYLGISNFGFENDIDE.ILGIAHLLEHLLISFDSTpFLANASTSRSYMSFWCKSIputo.psDAIRTLlSWFFssG.KLKDNFSlSsIRaHIKELENEYYFRNEVFHCMDlLTFLuGGDLYNGGRIsMlDNLshVR-MLsNRMpRISGsNIVIFVK+LssuTLshhppTFGoLPuCPElIPs.olssossGKIVMhPSPFYTVMV+lsPTLDNILuILhLYEsYHLIDYETIGNQLYlTlSFIDEo-YEuFLRGpul....Lpl.ups.ppIshNY.oDDYhMNIYLNFPWLuHDlaDYITcIN-DocolLhSLps-IYsSIlsRDhIVIYPNFSKuMsNTcDoQpH.IVVL...................DsssDuh....h++shR..s...........IsL..........................MK+hTo.NEIFIRYGDASLhDhlTL.....uLS.+pDhsL+...RssEGIRl+HsFSADDIpAIMESDoFLKYS+SKPAAMYQYIFLSFFASGNSI-DILsNR-STLcF..uK+sKu..KILFGRNTRYDVssKSSFVCGIV+GKuLccsoLs-hMW-LKKKGLIYSMEFTsLhSKNTFYLFsFTIYsDEVYcYLsssKhFou+CLVVSsKG...-lEsFSSLKKDVVIRl..
//
DBGET integrated database retrieval system