GenomeNet

Database: Pfam
Entry: PerB
LinkDB: PerB
Original site: PerB 
#=GF ID   PerB
#=GF AC   PF06590.7
#=GF DE   PerB protein
#=GF AU   Moxon SJ
#=GF SE   Pfam-B_19494 (release 10.0)
#=GF GA   25.00 25.00;
#=GF TC   127.20 127.10;
#=GF NC   21.90 19.40;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 80369284 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   7729884
#=GF RT   A plasmid-encoded regulatory region activates chromosomal eaeA
#=GF RT   expression in enteropathogenic Escherichia coli. 
#=GF RA   Gomez-Duarte OG, Kaper JB; 
#=GF RL   Infect Immun 1995;63:1767-1776.
#=GF RN   [2]
#=GF RM   8885267
#=GF RT   Cloning and characterization of bfpTVW, genes required for the
#=GF RT   transcriptional activation of bfpA in enteropathogenic
#=GF RT   Escherichia coli. 
#=GF RA   Tobe T, Schoolnik GK, Sohel I, Bustamante VH, Puente JL; 
#=GF RL   Mol Microbiol 1996;21:963-975.
#=GF DR   INTERPRO; IPR009513;
#=GF CC   This family consists of several PerB or BfpV proteins found
#=GF CC   specifically in Escherichia coli. PerB is thought to play a role
#=GF CC   in regulating the expression of BfpA [1].
#=GF SQ   16
#=GS A2T8L9_ECOLX/1-68       AC A2T8L9.1
#=GS A2T8S2_ECOLX/1-68       AC A2T8S2.1
#=GS A2T8P6_ECOLX/1-68       AC A2T8P6.1
#=GS PERB_ECO11/1-129        AC P0C961.1
#=GS A2T8R4_ECOLX/1-66       AC A2T8R4.1
#=GS Q9APE5_ECOLX/1-129      AC Q9APE5.1
#=GS A0A025IEF1_ECOLX/1-129  AC A0A025IEF1.1
#=GS A2T8S8_ECOLX/1-68       AC A2T8S8.1
#=GS Q9F875_ECOLX/1-129      AC Q9F875.1
#=GS I6GLE8_ECOLX/1-65       AC I6GLE8.1
#=GS A2T8Q0_ECOLX/1-68       AC A2T8Q0.1
#=GS Q9EUG4_ECOLX/1-129      AC Q9EUG4.1
#=GS Q71SM3_ECOLX/1-129      AC Q71SM3.1
#=GS Q9ETR8_ECOLX/1-129      AC Q9ETR8.1
#=GS Q7DJS4_ECOLX/1-129      AC Q7DJS4.1
#=GS PERB_ECO27/1-129        AC B7UTE8.1
A2T8L9_ECOLX/1-68                  MKNNLREEKEVVFDGCMNVLSLPSGWKAITPKKNNATSEIIVLFIPPKASYHIILKYNKTKHCELFFS-------------------------------------------------------------...
A2T8S2_ECOLX/1-68                  MKNNLREEKEVVFDGCMNVLLLPSGWKAITPKKNNTTSEIIVLFIPPKASYHIILKYNKTKHCELFFS-------------------------------------------------------------...
A2T8P6_ECOLX/1-68                  MKNNLREEKEVVFDGCMNVLSLPSGWKAITPKKNNATSEIIVLSIPPKASYHIILKYNKTKHCELFFS-------------------------------------------------------------...
PERB_ECO11/1-129                   MKNNLREEKEVVFDGCMNVLSLPSGWKAITPKKNNATSEIIVLFIPPKASYHIILKYNKTKHCELFFSDHITGEQDIIYSQNAFFSHVINHTIALVDVLNKKSYASNVIKFLITMEGGGDILSESKRAP...
A2T8R4_ECOLX/1-66                  MKNNLREEKEVVFDGCMNVLSLPSGWKAITPKKNNTTSEIIVLFIPPKASYHIILKYNKTLQI------------------------------------------------------------------vff
Q9APE5_ECOLX/1-129                 MKNNLREEKEVVFDGCMNVLSLPSGWKAITPKKNNTTSEIIVLFIPPKASYHIILKYNKTKHCKLFFSDHITGEQDIIYSQSAFFSHVINHIIALVDVLNKKSYASNVIKFLITMEGGGDILSESKRAP...
A0A025IEF1_ECOLX/1-129             MKNNLREEKEVVFDGCMNVLSLPSGWKAITPKKNNATSEIIVLFIPPKASYHIILKYNKTKHCELFFSDHITGEQDIIYSQNAFFSHVINHTIALVDVLNKKSYASNVIKFLITMEGGGDILSESKRAP...
A2T8S8_ECOLX/1-68                  MKNNLREEKEVVIDGCINVLSLPSEWKAITPKKNNVTSEIIVFFIPPKASYHIILKYDNTKHCELFFS-------------------------------------------------------------...
Q9F875_ECOLX/1-129                 MKNNLREEKEVVIDGCINVLSLPSEWKAITPKKNNVTSEIIVFFIPPKASYHIILKYDNTKHCELFFSDHITGEQDIIYSQSAFFSHVINHIIALVDVLNKKSYASNVIKFLITMEGGGDILSESKRAP...
I6GLE8_ECOLX/1-65                  ----------------------------------------------------------------MFFSDHITGEQDIIYSQNAFFSHVINHTIALVDVLNKKSYASNVIKFLITMEGGGDILSESKRAP...
A2T8Q0_ECOLX/1-68                  MKNNLREEKEVVFDGCMNVLSLPSGWKAITPKKNNATSEIIVFFIPPKASYHIILKYNKTKHCELFFS-------------------------------------------------------------...
Q9EUG4_ECOLX/1-129                 MKNNLREEKEVVIDGCINVLSLPSEWKAITPKKNNVTSEIIVFFIPPKASYHIILKYDNTKHCELFFSDHITGEQDVIYSQSAFFSHVINHIIALVDVLNKKSYASNVIKFLITMEGGGDILSESKRAP...
Q71SM3_ECOLX/1-129                 MKNNLREEKEVVFDGCMNVLSLPSGWKAITPKKNNATSEIIVLFIPPKASYHIILKYNKTKHCELFFSDHITGEQDIIYSQNAFFSHVINHTIALVDVLNKKSYASNVIKFLITMEGGGDILSESKRAP...
Q9ETR8_ECOLX/1-129                 MKNNLREEKEVVFDGCMNVLSLPSGWKAITPKKNNATSEIIVFFIPPKASYHIILKYNKTKHCELFFSDHITGEQDIIYSQNAFFSHVINHIIALVDVLNKKSYASNVIKFLITMEGGGDILSESKRAP...
Q7DJS4_ECOLX/1-129                 MKNNLREEKEVVFDGCMNVLSLPSGWKAITPKKNNATSEIIVLFIPPKASYHIILKYNKTKHCELFFSDHITGEQDIIYSQNAFFSHVINHTIALVDVLNKKSYASNVIKFLITMEGGGDILSESKRAP...
PERB_ECO27/1-129                   MKNNLREEKEVVFDGCMNVLSLPSGWKAITPKKNNATSEIIVLFIPPKASYHIILKYNKTKHCELFFSDHITGEQDIIYSQNAFFSHVINHTIALVDVLNKKSYASNVIKFLITMEGGGDILSESKRAP...
#=GC seq_cons                      MKNNLREEKEVVFDGCMNVLSLPSGWKAITPKKNNsTSEIIVLFIPPKASYHIILKYNKTKHCELFFSDHITGEQDlIYSQsAFFSHVINHhIALVDVLNKKSYASNVIKFLITMEGGGDILSESKRAP...
//
DBGET integrated database retrieval system