GenomeNet

Database: Pfam
Entry: Phage_B
LinkDB: Phage_B
Original site: Phage_B 
#=GF ID   Phage_B
#=GF AC   PF02304.10
#=GF DE   Scaffold protein B
#=GF AU   Mian N, Bateman A
#=GF SE   Pfam-B_9648 (release 5.2)
#=GF GA   25.00 25.00;
#=GF TC   150.70 150.60;
#=GF NC   19.00 16.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Bacteriophage_scaffolding_proteins
#=GF RN   [1]
#=GF RM   9305849
#=GF RT   Structure of a viral procapsid with molecular scaffolding. 
#=GF RA   Dokland T, McKenna R, Ilag LL, Bowman BR, Incardona NL, Fane BA,
#=GF RA   Rossmann MG; 
#=GF RL   Nature 1997;389:308-313.
#=GF DR   INTERPRO; IPR003513;
#=GF DR   SCOP; 1cd3; fa;
#=GF CC   This is a family of proteins from single-stranded DNA
#=GF CC   bacteriophages.  Scaffold proteins B and D are required for
#=GF CC   procapsid formation.	Sixty copies of the internal scaffold
#=GF CC   protein B are found in the procapsid.
#=GF SQ   76
#=GS Q2LLS0_9VIRU/4-120  AC Q2LLS0.1
#=GS VGB_BPS13/4-120     AC P07929.1
#=GS Q2LL61_9VIRU/4-120  AC Q2LL61.1
#=GS D0U1A7_BPG4/4-120   AC D0U1A7.1
#=GS Q2LL24_BPAL3/1-117  AC Q2LL24.1
#=GS A3FJN2_BPPHX/4-120  AC A3FJN2.1
#=GS Q2LLJ3_9VIRU/4-120  AC Q2LLJ3.1
#=GS Q2LLL5_9VIRU/4-120  AC Q2LLL5.1
#=GS Q2LLA5_9VIRU/4-120  AC Q2LLA5.1
#=GS Q2LLE9_9VIRU/4-120  AC Q2LLE9.1
#=GS B_BPPHX/4-120       AC P03633.1
#=GS B_BPPHX/4-120       DR PDB; 1CD3 B; 4-120;
#=GS B_BPPHX/4-120       DR PDB; 1AL0 B; 4-120;
#=GS Q2LM61_9VIRU/1-117  AC Q2LM61.1
#=GS G4WZG3_BPPHX/4-120  AC G4WZG3.1
#=GS A3FJQ4_BPPHX/4-120  AC A3FJQ4.1
#=GS Q2LL94_9VIRU/4-120  AC Q2LL94.1
#=GS Q77E78_BPG4/4-120   AC Q77E78.1
#=GS VGB_BPAL3/1-117     AC P31278.1
#=GS Q2LLB6_9VIRU/4-120  AC Q2LLB6.1
#=GS Q2LLW4_9VIRU/4-120  AC Q2LLW4.1
#=GS VGB_BPG4/4-120      AC P03634.1
#=GS H7U395_CAMCO/1-82   AC H7U395.1
#=GS Q2LL50_9VIRU/4-120  AC Q2LL50.1
#=GS H7UWE1_CAMCO/1-82   AC H7UWE1.1
#=GS Q2LLV3_9VIRU/4-120  AC Q2LLV3.1
#=GS A3FJL0_BPPHX/4-120  AC A3FJL0.1
#=GS A3FJS6_BPPHX/4-120  AC A3FJS6.1
#=GS Q2LLY6_9VIRU/4-120  AC Q2LLY6.1
#=GS A3FJX0_BPPHX/4-120  AC A3FJX0.1
#=GS Q2LLQ9_9VIRU/4-120  AC Q2LLQ9.1
#=GS Q2LM50_9VIRU/4-120  AC Q2LM50.1
#=GS Q2LM40_9VIRU/1-117  AC Q2LM40.1
#=GS Q2LM19_9VIRU/4-120  AC Q2LM19.1
#=GS Q2LLT1_9VIRU/4-120  AC Q2LLT1.1
#=GS Q2LLI2_9VIRU/4-120  AC Q2LLI2.1
#=GS A3FJT7_BPPHX/4-120  AC A3FJT7.1
#=GS Q2LLG0_9VIRU/4-120  AC Q2LLG0.1
#=GS Q2LLM6_9VIRU/4-120  AC Q2LLM6.1
#=GS Q2LM91_9VIRU/1-117  AC Q2LM91.1
#=GS Q2LM71_9VIRU/1-117  AC Q2LM71.1
#=GS A3FJA0_BPPHX/4-120  AC A3FJA0.1
#=GS Q2LLD8_9VIRU/4-120  AC Q2LLD8.1
#=GS A3FJC2_BPPHX/4-120  AC A3FJC2.1
#=GS Q2LLP8_9VIRU/4-120  AC Q2LLP8.1
#=GS A3FJE4_BPPHX/4-120  AC A3FJE4.1
#=GS Q2LLU2_9VIRU/4-120  AC Q2LLU2.1
#=GS Q2LLH1_9VIRU/4-120  AC Q2LLH1.1
#=GS D0U124_BPPHX/4-120  AC D0U124.1
#=GS A3FJJ9_BPPHX/4-120  AC A3FJJ9.1
#=GS Q5C8S2_9VIRU/4-120  AC Q5C8S2.1
#=GS D0U113_BPPHX/4-120  AC D0U113.1
#=GS Q2LM81_9VIRU/1-117  AC Q2LM81.1
#=GS Q2LLZ7_9VIRU/4-120  AC Q2LLZ7.1
#=GS H7UG50_CAMCO/1-82   AC H7UG50.1
#=GS G4WZH4_BPPHX/4-120  AC G4WZH4.1
#=GS Q2LLC7_9VIRU/4-120  AC Q2LLC7.1
#=GS Q2LL83_9VIRU/4-120  AC Q2LL83.1
#=GS A3FJF5_BPPHX/4-120  AC A3FJF5.1
#=GS VGB_BPPHK/1-117     AC Q38036.1
#=GS Q2LM30_9VIRU/1-117  AC Q2LM30.1
#=GS Q77LT7_BPS13/4-120  AC Q77LT7.1
#=GS Q2LMC1_9VIRU/1-117  AC Q2LMC1.1
#=GS D0U135_BPPHX/4-120  AC D0U135.1
#=GS Q2LLN7_9VIRU/4-120  AC Q2LLN7.1
#=GS A3FJD3_BPPHX/4-120  AC A3FJD3.1
#=GS A3FJY1_BPPHX/4-120  AC A3FJY1.1
#=GS Q2LMD1_9VIRU/4-120  AC Q2LMD1.1
#=GS Q2LMA1_9VIRU/1-117  AC Q2LMA1.1
#=GS Q2LL72_9VIRU/4-120  AC Q2LL72.1
#=GS Q2LLK4_9VIRU/4-120  AC Q2LLK4.1
#=GS A3FJI8_BPPHX/4-120  AC A3FJI8.1
#=GS Q2LLX5_9VIRU/4-120  AC Q2LLX5.1
#=GS Q2LM08_9VIRU/4-120  AC Q2LM08.1
#=GS A3FJB1_BPPHX/4-120  AC A3FJB1.1
#=GS A3FJU8_BPPHX/4-120  AC A3FJU8.1
#=GS C6K2G1_BPST1/1-117  AC C6K2G1.1
#=GS Q2LMB1_9VIRU/1-117  AC Q2LMB1.1
Q2LLS0_9VIRU/4-120             .LTKNQAVATSQEAVQNQNEPQLRDENAHNDKSVHGMLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
VGB_BPS13/4-120                .LTKNQAVATSQEAFQNQNEPQLRDENVHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
Q2LL61_9VIRU/4-120             .YIKNADGSFTKETISNSNEPQLRDETTPNDDADRGVFNPTDPSGLRRDPVQQHLEAERQERATIEAGKAICSRRFGGATCDDQSAKIHAQFDPNNRSVQPTEFYRFNDAEISKYGYF
D0U1A7_BPG4/4-120              .FTQNQNQPHTQESVQNTNVSQFRNETVINGSPVSGNPDGTDPSGLRRDPVQQHLEAERQERAQIEAGKEICRRRFGGATCDDESAKIHAQFDPSNRSVQPTEFYRFNDHEINKYGYF
Q2LL24_BPAL3/1-117             .MQESINGNLSEERISGTQQSETRNGAPVNGSSEQQGTSGTEPNQLRFQSSVSDSERERQKAIDLEHRRAAFARHFGCAPGSEKHVENYSSFDEKDTRVQLAEFYRFNDGHFKKWGYF
A3FJN2_BPPHX/4-120             .LTKNQAVATSQEAVQNQNESQLRDENAHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
Q2LLJ3_9VIRU/4-120             .FTQNQNQPHTQEGIQNSNVPQFRNETVINGSPVSGNPDGADPSGIRRDPVQQHLEAERQERAQIEAGKEICRRRFGGATCDDQSAKIHAQFDPNNRSVQPTEFYRFNDHEINKYGYF
Q2LLL5_9VIRU/4-120             .LTKNQAVATSQEAVQNQNEPQFRDENAHNDQSVHGMLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRVQPAEFYRFHDAEVNTFGYF
Q2LLA5_9VIRU/4-120             .FTQNQNQPHTQESVQNTNVPQFRNETAINGSPVSGNPDGTDPSGLRRDPVQQHLEAERQERAQIEAGKEICRRRFGGATCDDQSAKIHAQFDPNNRSVQPTEFYRFNDHEINKYGYF
Q2LLE9_9VIRU/4-120             .FAQNQNQPHTQEGVQNTNVPQLRNETTVNGSPVGGNFDGTDPSGLRRDPVQQHLEAERQERAQIEAGKEICRRRFGGATCDDQSAKIHAQFDPNNRSVQPTEFYRFNDHEINKYGYF
B_BPPHX/4-120                  .LTKNQAVATSQEAVQNQNEPQLRDENAHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
#=GR B_BPPHX/4-120       SS    .-----XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHHHHHHHHHHHHHHHHHHSS--SCCHHHHCCH--TT--S--TTTS-----HHHHCTS--
Q2LM61_9VIRU/1-117             .MQESTHGNLSEKGIQSSQQPEARNGAPFDGSPQQQGSSGTEPNQLRFQSSVSDSERERQKAIDLEHRRAAFARHFGCAPGSEKYVEKYPSFDEKDTRVQLSEFYRFNDGHLKKWGYF
G4WZG3_BPPHX/4-120             .LTKNQAVATSQEAVQNQNEPQLRNENAHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
A3FJQ4_BPPHX/4-120             .FTKNQAVAISQEAVQNQNEPQLRDENAHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
Q2LL94_9VIRU/4-120             .FTQNQNQPHTQESIQNPNVPQFRNETAINGSPVSGNSDGTDPSGIRRDPVQQHLEAERQERAQIEAGKEICRRRFGGATCDDQSAKIHAQFDPNNRSVQPTEFYRFNDHEINKYGYF
Q77E78_BPG4/4-120              .FTQNQNQPHTQESVQNTNVSQFRNETVINGSPVSGNPDGTDPSGLRRDPVQQHLEAERQERAQIEAGKEICRRRFGGATCDDESAKIHAQFDPNNRSVQPTEFYRFNDHEINKYGYF
VGB_BPAL3/1-117                .MQESINGNLSEERISGTQQSETRNGAPVNGSSEQQGTSGTEPNQLRFQSSVSDSERERQKAIDLEHRRAAFARHFGCAPGSEKHVENYSSFDEKDTRVQLAEFYRFNDGHFKKWGYF
Q2LLB6_9VIRU/4-120             .FTQNQNQPHTQESVQNTNVPQFRNETAINVSPVSGNPDGTDPSGLRRDPVQQHLEAERQERAQIEAGKEICRRRFGGATCDDQSAKIHAQFDPNNRSVQPTEFYRFNDHEINKYGYF
Q2LLW4_9VIRU/4-120             .LTKNQAVATSQEAVQNQNEPQLRDENAHNDKSVHGMLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
VGB_BPG4/4-120                 .FTQNQNQPHTQESVQNTNVSQFRNETVINGSPVSGNPDGTDPSGLRRDPVQQHLEAERQERAQIEAGKEICRRRFGGATCDDESAKIHAQFDPNNRSVQPTEFYRFNDHEINKYGYF
H7U395_CAMCO/1-82              m------------------------------------LNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
Q2LL50_9VIRU/4-120             .YIKNADGSFTKETIPNPNEPQLRDETTPNDDAHRGVLNPTDPSGLRRDPVQQHLEAERQERATIEAGKAICSRRFGGATCDDQSAKIHAQFDPQNRSVQPTEFYRFNDAEISKYGYF
H7UWE1_CAMCO/1-82              m------------------------------------LNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
Q2LLV3_9VIRU/4-120             .LTKNQAVATSQEIIQNSNEPQLRDENAHNDRPVNGMLNPAYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
A3FJL0_BPPHX/4-120             .FTKNQAVATSQEAVQNQNEPQLRDENAHNDKSVHGVLNPTYQAGLRRDAVQSDIEAECKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
A3FJS6_BPPHX/4-120             .LTKNQAVATSQEAVQNQNEPQLRDENAYNDKSVHGVLNPTYQAGLRRDVVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
Q2LLY6_9VIRU/4-120             .LTKNQAVATSQEAVQNQNEPQLRDENAHNDKSVHGMLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
A3FJX0_BPPHX/4-120             .LTKNQAVVTSQEAVQNQNESQLRDENAHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
Q2LLQ9_9VIRU/4-120             .LTKNQAVATSQEAVQNQNEPQLRDENAHNDKSVHGMLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
Q2LM50_9VIRU/4-120             .FAQNQNQPHTQEGVQNPNVPQLRNEATLNGSPVSGNSDGTDPSGLRRDPVQQHLEAERQERAQIEAGKEICRRRFGGATCDDQSAKIHAQFDPNNRSVQPTEFYRFNDHEIIKYGYF
Q2LM40_9VIRU/1-117             .MQESTYGNLSEKGIQSSQQPEARNGVAVDGASQQQSASGTEPNQLRFQPSVSDSERERQKAIDLEHRRAAFARHFGCAPGSEKYVEKYPSFDEKDTRVQLAEFYRFNDGHLKKWGYF
Q2LM19_9VIRU/4-120             .LTKNQTIATSQEAVQNQNEPQLRDENAHNDQSVNGMLNPTYQAGLRRDAVQPDSEAERKKRDEIAAGKSYCSRRFGGATCDDKSAQIYARFDKNDRRVQPAEFYRFHDAEVNTFGYF
Q2LLT1_9VIRU/4-120             .LTKNQAVATSQEAVQNQNEPQLRDENAHNDKSVHGMLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
Q2LLI2_9VIRU/4-120             .FTQNQNQPHTQEGIQNSNVPQFRNETVINGSPVSGNPDGADPSGIRRDPVQQHLEAERQERAQIEAGKEICRRRFGGATCDDQSAKIHAQFDPNNRSVQPTEFYRFNDHEINKYGYF
A3FJT7_BPPHX/4-120             .LTKNQAVATSQEAVQNQNEPQLRDENAHNDKSVHGVLNSTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
Q2LLG0_9VIRU/4-120             .FTQNQNQPHTQESVQNTNVPQFRNETAINVSPVSGNPDGTDPSGLRRDPVQQHLEAERQERAQIEAGKEICRRRFGGATCDDQSAKIHAQFDPNNRSVQPTEFYRFNDHEINKYGYF
Q2LLM6_9VIRU/4-120             .LTKNQAVATTQEIIQNPNEPQLRNENAHNDQSVNGMLDPAYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRVQPAEFYRFHDAEVNTFGYF
Q2LM91_9VIRU/1-117             .MQESTYGNLSEKGIQSSQQPETRNGVTVDGASQQQSASGAEPNQLRFQPSVSDSERERQKAIDLEHRRAAFARHFGCAPGSEKYVEKYPSFDEKDTRVQLAEFYRFNDGHLKKWGYF
Q2LM71_9VIRU/1-117             .MQKSFDGNLLEERIQGSQQPEARNGVTFNGSPEQQGPSGTEQNQLRFQPALSDSERERQKAIELEHRRSAFARHYGCAPASEKYVEKYPSFDEKDTRIQLAEFYRFNDGHLKKWGYF
A3FJA0_BPPHX/4-120             .LTKNQAVATSQEAVQNQNEPQLRDENAHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
Q2LLD8_9VIRU/4-120             .FTQNQNQPHTQESVQNTNVPQFRNETAINGSPVSGNPDGTDPSGLRRDPVQQHLEAERQERAQIEAGKEICRRRFGGATCDDQSAKIHAQFDPNNRSVQPTEFYRFNDHEINKYGYF
A3FJC2_BPPHX/4-120             .LTKNQAVATSQEAVQNQNEPQLRDENAHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFYDAEVNTFGYF
Q2LLP8_9VIRU/4-120             .LTKNQAVATSQEAVQNQNEPQLRDENAHNDKSVHGMLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
A3FJE4_BPPHX/4-120             .LTKNQAVATSQEAVQNQNEPQLRDENAHNDKSVHGVLNPTYQAGLRRDAVQSDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWCIQPAEFYRFHDAEVNTFGYF
Q2LLU2_9VIRU/4-120             .LTKNQAVATSQEIIQNPNEPQLRDENAHNVQPVNGMLNPAYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRVQPAEFYRFHDAEVNTFGYF
Q2LLH1_9VIRU/4-120             .FAQNQNQPHTQESIQNPNVPQFRNETAINGSPVSGNPDGTDPSGIRRDPVQQHLEAERQERAQIETGKEICRRRFGGATCDDQSAKIHAQFDPNNWSVQPTEFYRFNDHEINKYGYF
D0U124_BPPHX/4-120             .LTENQAVATSQEAVQNQNEPQLRDENAHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFXXXXWRIQPAEFYRFHDAEVNTFGYF
A3FJJ9_BPPHX/4-120             .FTKNQAVATSQEAVQNQNEPQLRDENAHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDEIEVGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
Q5C8S2_9VIRU/4-120             .FTQNQNQPHTQESVQNTNVPQFRNETAINVSPVSGNPDGTDPSGLRRDPVQQHLEAERQERAQIEAGKEICRRRFGGATCDDQSAKIHAQFDPNNRSVQPTEFYRFNDHEINKYGYF
D0U113_BPPHX/4-120             .LTKNQAVATSQEAVQNQNEPQLRNENAHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARXYKNDWRIQPAEFYRFHDAEVNTFGYF
Q2LM81_9VIRU/1-117             .MQESTYGNLSEKGIQSSQQPETRNGVTVDGASQQQSASGAEPNQLRFQPSVSDSERERQKAIDLEHRRAAFARHFGCAPGSEKYVEKYPSFDEKDTRVQLAEFYRFNDGHLKKWGYF
Q2LLZ7_9VIRU/4-120             .LTKNQAVATSQEIIQNPNEPQLRDENAHNDQPVNGMLNPAYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRVQPAEFYRFHDAEVNTFGYF
H7UG50_CAMCO/1-82              m------------------------------------LNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
G4WZH4_BPPHX/4-120             .LTENQAVATSQEAVQNQNEPQLRDENAHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
Q2LLC7_9VIRU/4-120             .FAQNQNQPHTQEGVQNPNVPQFRNETVINGSPVSGNPDGTDSSGLRRDPVQQHLEAERQERAQIEAGKEICRRRFGGATCDDQSAKIHAQFDPNNRSVQPTEFYRFNDHEIIKYGYF
Q2LL83_9VIRU/4-120             .FTQNQNQPHPQESVQNTNVPQFRNEAAINGSPVSGNPDGTDPSGLRRDPVQQHLEAERQERAQIEAGKEICRRRFGGATCDDQSAKIHAQFDPNNRSVQPTEFYRFNDHEINKYGYF
A3FJF5_BPPHX/4-120             .LTKNQAVATSQEAVQNQNESQLRDENAHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDEIEVGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
VGB_BPPHK/1-117                .MQESINGNLSEERISGAQQPEAWNGAPVNGSPEQQSASGAESNQLRFQSSLSDSERERQKATDLEHRRAAFARHFGCAPGSEKHVESYSSFDEKDTRVQLAEFYRFNDGHLKKWGYF
Q2LM30_9VIRU/1-117             .MQESTYGNLSEKGIQSSQQPEARNGVTVDGASQQQSASGAESNQLRFQPSVSDSERERQKAIDLEHRRAAFARHFGCAPGSEKYVEKYPSFDEKDTRVQLAEFYRFNDGHLKKWGYF
Q77LT7_BPS13/4-120             .LTKNQAVATSQEAFQNQNEPQLRDENVHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
Q2LMC1_9VIRU/1-117             .MQESTYGNMSEKGIQSSQQPEARNGVAVDGASQQQGTSGTESNQLRFQPSVSDSERERQKAIDLEHRRAAFTRHFGCAPGSEKYVEKYPSFDEKDTRVQLAEFYRFNDGHLKKWGYF
D0U135_BPPHX/4-120             .LTKNQAVATSQEAVQNQNEPQLRDENAHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARXXKNDWRIQPAEFYRFHDAEVNTFGYF
Q2LLN7_9VIRU/4-120             .LTKNQAVATSQEAVQNQNEPQLRDENAHNDKSVHGMLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDRRIQPAEFYRFHDAEVNTFGYF
A3FJD3_BPPHX/4-120             .LTKNQAVATSQEVVQNQNEPQLRDENAHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
A3FJY1_BPPHX/4-120             .LTKNQAVATSQEAVQNQNESQLRDENAHNDKSVHGVLNPTYQAGLRRDAVQPDIEAECKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
Q2LMD1_9VIRU/4-120             .FTQNQNQPAAQENFSHQDVSQLRNEAAHNESPLSGNSNPTDPSGLRRDPVQQHLEAERQERATIEAGKEICRRRFGGATCDDQSAKIHAQFDPSNRSVQPAEFYRFNDNEINKYGYF
Q2LMA1_9VIRU/1-117             .MQESTYGNLSEKGIQSSQQPEARNGVTFDGASQQQSASGTEPNQLRFQSSVSDSERERQKAIDLEHRRTAFARHFGCAPGSEKYVEKYPSFDEKDTRVQLAEFYRFNDGHLKKWGYF
Q2LL72_9VIRU/4-120             .FAQNQNQPHTQEGVQNPNVPQFRNETPVNVTPVSGNSDGTDPSGLRRDPVQQHLEAERQERAQIEAGKEICRRRFGGATCDDQSAKIHAQFDPNNRSVQPTEFYRFNDHEIIKYGYF
Q2LLK4_9VIRU/4-120             .LTKNQAVTTSQEIIQNPNEPQLRDENAHNDQSVNGMLNPAYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRVQPAEFYRFHDAEVNTFGYF
A3FJI8_BPPHX/4-120             .LTKNQAVATSQEAVQNQNEPQLRDENAHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWCIQPAEFYRFHDAEVNTFGYF
Q2LLX5_9VIRU/4-120             .LTKNQAVATSQEIIQNSNEPQLRDENAHNDRPVNGMLNPAYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
Q2LM08_9VIRU/4-120             .LTKNQTIATSQEAVQNQNESQLRDENAHNDQSVNGMLNPTYQAGLRRDAVQPDSEAERKKRDEIAAGKSYCSRRFGGATCDDKSAQIYARFDKNDRRVQPAEFYRFHDAEVNTFGYF
A3FJB1_BPPHX/4-120             .LTKNQAVATSQEAVQNQNEPQFRDENAHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
A3FJU8_BPPHX/4-120             .LTKNQAVATSQEAVQNQNEPQLRDENAHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRCFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
C6K2G1_BPST1/1-117             .MQESINGNLSEERISGAQQSEARNGAPVNGSPEQQSASGTEPNQLRFQPSVSDSERERQKAIDLEHRRAAFARHFGCAPGSEKHVENYSSFDEKDTRVQLAEFYRFNDGHLKKWGYF
Q2LMB1_9VIRU/1-117             .MQESTYGNLSEKGIQSSQQPEARNGVTVDGASQQQSASGAEPNQLRFQPSVSDSERERQKAIDLEHRRAAFARHFGCAPGSEKYVEKYPSFDEKDTRVQLAEFYRFHDGHLKKWGYF
#=GC SS_cons                   .-----XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHHHHHHHHHHHHHHHHHHSS--SCCHHHHCCH--TT--S--TTTS-----HHHHCTS--
#=GC seq_cons                  .hTcNQssspSQEulQNpNpPQhRsEsAhNspuVpGshssT.puGLRRDuVQsDlEAERpKRs-IEAGKuhCoRRFGGATCDDKSApIYApFDcNDhRlQPAEFYRFpDuElNpaGYF
//
DBGET integrated database retrieval system