GenomeNet

Database: Pfam
Entry: Phage_B
LinkDB: Phage_B
Original site: Phage_B 
#=GF ID   Phage_B
#=GF AC   PF02304.14
#=GF DE   Scaffold protein B
#=GF AU   Mian N, Bateman A
#=GF SE   Pfam-B_9648 (release 5.2)
#=GF GA   25.00 25.00;
#=GF TC   120.30 119.10;
#=GF NC   23.60 19.40;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 26740544 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Bacteriophage_scaffolding_proteins
#=GF RN   [1]
#=GF RM   9305849
#=GF RT   Structure of a viral procapsid with molecular scaffolding. 
#=GF RA   Dokland T, McKenna R, Ilag LL, Bowman BR, Incardona NL, Fane BA,
#=GF RA   Rossmann MG; 
#=GF RL   Nature 1997;389:308-313.
#=GF DR   INTERPRO; IPR003513;
#=GF DR   SCOP; 1cd3; fa;
#=GF CC   This is a family of proteins from single-stranded DNA
#=GF CC   bacteriophages.  Scaffold proteins B and D are required for
#=GF CC   procapsid formation.  Sixty copies of the internal scaffold
#=GF CC   protein B are found in the procapsid.
#=GF SQ   15
#=GS A0A0N7LV86_THAGE/4-120    AC A0A0N7LV86.1
#=GS A0A0P1IQL5_9RHOB/4-120    AC A0A0P1IQL5.1
#=GS A0A061LUQ4_9MICO/4-120    AC A0A061LUQ4.1
#=GS A0A0N5C5A2_STREA/4-120    AC A0A0N5C5A2.1
#=GS W1SH29_9BACI/4-120        AC W1SH29.1
#=GS A0A0N4Z2Y6_PARTI/310-425  AC A0A0N4Z2Y6.1
#=GS A0A0M2CQM0_9MICC/4-120    AC A0A0M2CQM0.1
#=GS A0A022KXD6_9MICO/4-120    AC A0A022KXD6.1
#=GS A0A0R3SMM1_HYMDI/317-432  AC A0A0R3SMM1.1
#=GS A0A0R3TE32_HYMNN/677-792  AC A0A0R3TE32.1
#=GS U2PP43_9CLOT/4-120        AC U2PP43.1
#=GS A0A0P1GC87_9RHOB/4-120    AC A0A0P1GC87.1
#=GS A0A183L7N8_9TREM/262-323  AC A0A183L7N8.1
#=GS SCAFB_BPPHS/4-120         AC P03633.1
#=GS SCAFB_BPPHS/4-120         DR PDB; 1CD3 B; 4-120;
#=GS SCAFB_BPPHS/4-120         DR PDB; 1AL0 B; 4-120;
#=GS A0A0S4T8F6_HYMMI/4-120    AC A0A0S4T8F6.1
A0A0N7LV86_THAGE/4-120               ...LTKNQAVATSQEAVQNQNEPQLRDENAHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
A0A0P1IQL5_9RHOB/4-120               ...LTKNQAVATSQEAVQNQNEPQLRDENAHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
A0A061LUQ4_9MICO/4-120               ...LTKNQAVATSQEAVQNQNEPQLRDENAHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
A0A0N5C5A2_STREA/4-120               ...LTKNQAVATSQEAVQNQNEPQLRDENAHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
W1SH29_9BACI/4-120                   ...LTKNQAVATSQEAVQNQNEPQLRDENAHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
A0A0N4Z2Y6_PARTI/310-425             laa----KAVATSQEAVQNQNEPQLRDENAHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
A0A0M2CQM0_9MICC/4-120               ...LTKNQAVATSQEAVQNQNEPQLRDENAHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
A0A022KXD6_9MICO/4-120               ...LTKNQAVATSQEAVQNQNEPQLRDENAHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
A0A0R3SMM1_HYMDI/317-432             laa----KAVATSQEAVQNQNEPQLRDENAHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
A0A0R3TE32_HYMNN/677-792             laa----KAVATSQEAVQNQNEPQLRDENAHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
U2PP43_9CLOT/4-120                   ...LTKNQAVATSQEAVQNQNEPQLRDENAHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
A0A0P1GC87_9RHOB/4-120               ...LTKNQAVATSQEAVQNQNEPQLRDENAHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
A0A183L7N8_9TREM/262-323             .la---AKAVATSQEAVQNQNEPQLRDENAHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDE------------------------------------------------------
SCAFB_BPPHS/4-120                    ...LTKNQAVATSQEAVQNQNEPQLRDENAHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
#=GR SCAFB_BPPHS/4-120         SS    ...----------------------------------------------------------HHHHHHHHHHHHHHHHHHSS--SCCHHHHCCH--TT--S--TTTS-----HHHHCTS--
A0A0S4T8F6_HYMMI/4-120               ...LTKNQAVATSQEAVQNQNEPQLRDENAHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
#=GC SS_cons                         ...----------------------------------------------------------HHHHHHHHHHHHHHHHHHSS--SCCHHHHCCH--TT--S--TTTS-----HHHHCTS--
#=GC seq_cons                        ...LTKNQAVATSQEAVQNQNEPQLRDENAHNDKSVHGVLNPTYQAGLRRDAVQPDIEAERKKRDEIEAGKSYCSRRFGGATCDDKSAQIYARFDKNDWRIQPAEFYRFHDAEVNTFGYF
//
DBGET integrated database retrieval system