GenomeNet

Database: Pfam
Entry: Phageshock_PspG
LinkDB: Phageshock_PspG
Original site: Phageshock_PspG 
#=GF ID   Phageshock_PspG
#=GF AC   PF09583.8
#=GF DE   Phage shock protein G (Phageshock_PspG)
#=GF AU   TIGRFAMs, Coggill P
#=GF SE   TIGRFAMs
#=GF GA   25.00 25.00;
#=GF TC   63.10 62.90;
#=GF NC   19.20 19.20;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF DR   INTERPRO; IPR014318;
#=GF CC   This protein was previously designated as YjbO in Escherichia
#=GF CC   coli. It is found only in genomes that have the phage shock
#=GF CC   operon (psp), but it is only rarely encoded near other psp
#=GF CC   genes. The psp regulon is upregulated in response to a number of
#=GF CC   stress conditions, including ethanol, expression of the
#=GF CC   filamentous phage secretin protein IV and other secretins and
#=GF CC   heat shock.
#=GF SQ   61
#=GS J1YNL3_9ENTR/1-64      AC J1YNL3.1
#=GS A0A0G3QJ33_KLUIN/1-64  AC A0A0G3QJ33.1
#=GS A0A0F5ZUS0_9GAMM/1-64  AC A0A0F5ZUS0.1
#=GS W8U8A8_YEREN/1-64      AC W8U8A8.1
#=GS W0HYJ6_9ENTR/1-64      AC W0HYJ6.1
#=GS A4W5G3_ENT38/1-64      AC A4W5G3.1
#=GS A0A0L0H402_9ENTR/1-64  AC A0A0L0H402.1
#=GS A0A0D8P0A4_9GAMM/1-64  AC A0A0D8P0A4.1
#=GS F7YIQ7_VIBA7/16-79     AC F7YIQ7.1
#=GS A0A089PMQ7_PLUGE/1-64  AC A0A089PMQ7.1
#=GS D4GHB4_PANAM/33-96     AC D4GHB4.1
#=GS A0A090U532_9ENTR/1-64  AC A0A090U532.1
#=GS E0SEJ4_DICD3/1-52      AC E0SEJ4.1
#=GS Q7CKP3_YERPE/1-64      AC Q7CKP3.1
#=GS F9T1T4_9VIBR/1-64      AC F9T1T4.1
#=GS A8AN73_CITK8/1-64      AC A8AN73.1
#=GS A0A0F5V7J8_9GAMM/1-64  AC A0A0F5V7J8.1
#=GS G7LJQ0_9ENTR/1-64      AC G7LJQ0.1
#=GS B7VI81_VIBTL/1-64      AC B7VI81.1
#=GS D2TRT7_CITRI/1-64      AC D2TRT7.1
#=GS A0A0M2KJ93_9ENTR/1-64  AC A0A0M2KJ93.1
#=GS K8B1C6_9ENTR/1-64      AC K8B1C6.1
#=GS H2IV46_RAHAC/1-64      AC H2IV46.1
#=GS A0A0C5WP23_9GAMM/1-64  AC A0A0C5WP23.1
#=GS D8MLW1_ERWBE/1-63      AC D8MLW1.1
#=GS E6WIA9_PANSA/1-63      AC E6WIA9.1
#=GS W0LD04_9ENTR/1-64      AC W0LD04.1
#=GS A0A097QY21_HAFAL/1-64  AC A0A097QY21.1
#=GS I6G8N5_SHIFL/1-52      AC I6G8N5.1
#=GS U3TS69_9ENTR/1-63      AC U3TS69.1
#=GS Q7MHA1_VIBVY/2-65      AC Q7MHA1.1
#=GS L0M886_ENTBF/1-64      AC L0M886.1
#=GS A6D435_9VIBR/1-64      AC A6D435.1
#=GS A0KPI4_AERHH/1-64      AC A0KPI4.1
#=GS C5B723_EDWI9/1-64      AC C5B723.1
#=GS B2VKD5_ERWT9/6-69      AC B2VKD5.1
#=GS F0LWV1_VIBFN/2-65      AC F0LWV1.1
#=GS Q327V7_SHIDS/71-134    AC Q327V7.1
#=GS A0A0D8MSK7_PHOLE/1-64  AC A0A0D8MSK7.1
#=GS E3BNY3_9VIBR/1-64      AC E3BNY3.1
#=GS A0A0G4JVU6_9ENTR/1-64  AC A0A0G4JVU6.1
#=GS E1SAX5_PANVC/1-52      AC E1SAX5.1
#=GS F9RDD0_VIBSN/1-64      AC F9RDD0.1
#=GS U4K9X9_9VIBR/1-64      AC U4K9X9.1
#=GS Q7CPB1_SALTY/1-64      AC Q7CPB1.1
#=GS A0A0F4NQA1_9VIBR/1-64  AC A0A0F4NQA1.1
#=GS Q87L87_VIBPA/3-66      AC Q87L87.1
#=GS A9MGN9_SALAR/1-64      AC A9MGN9.1
#=GS Q6D0Y7_PECAS/1-64      AC Q6D0Y7.1
#=GS PSPG_ECOLI/1-64        AC P32696.2
#=GS I2BDW2_SHIBC/1-64      AC I2BDW2.1
#=GS A7MPN4_CROS8/1-64      AC A7MPN4.1
#=GS A0A0F5AR45_9GAMM/1-64  AC A0A0F5AR45.1
#=GS A0A097QN92_9VIBR/1-64  AC A0A097QN92.1
#=GS A8GKA6_SERP5/1-64      AC A8GKA6.1
#=GS D0Z0F0_PHODD/1-64      AC D0Z0F0.1
#=GS L0MKH0_SERMA/1-64      AC L0MKH0.1
#=GS A6TGV8_KLEP7/1-64      AC A6TGV8.1
#=GS I6GCN7_SHIFL/1-64      AC I6GCN7.1
#=GS A8T9Q9_9VIBR/1-64      AC A8T9Q9.1
#=GS A0A0A0Z1P7_9ENTR/1-63  AC A0A0A0Z1P7.1
J1YNL3_9ENTR/1-64                 .MLELLFIIGFFVMLLVTGVSLLGIIAALLVAAAVMFLGGLFALMIKLLPWLLLAVAVVWVIRT-i.
A0A0G3QJ33_KLUIN/1-64             .MLELLFVIGFFIVLLATGVSLLGIIAALLVATAVMFLGGLFALMIKLLPWLLLAVAVVWIIRA-l.
A0A0F5ZUS0_9GAMM/1-64             .MIEFLFIVGFTIALLATGISFLGIVAAMAVGFIVMALAGMIGLVFKMLPWILLAAVIVWLLK--gr
W8U8A8_YEREN/1-64                 .MFEILFVIGFFIMLMATGISLLGIFAALLVAAAFMMLGGLFVMMIKLLPWLILAVVVVWMWRSM..
W0HYJ6_9ENTR/1-64                 .MLELFFVIGFFLMLLLTGISALGVLVALVVGSLAMLFAGLFVTAVKLLPWLLVALAAAWLWRA-i.
A4W5G3_ENT38/1-64                 .MLELLFVIGFFVMLMVTGISLLGIIAALFVATALMFVGGLFALMIKLLPWLLLAIAVVWVIRAV..
A0A0L0H402_9ENTR/1-64             .MLELLFVIGFFVMLLMTGVSLLGILVAIVVATALMFVGGLLAMMLKLLPWLLLAVAVVWVIR--li
A0A0D8P0A4_9GAMM/1-64             .MFEFLFLVAFTLVLIFTGVSLIGVLIAVAAGFAVMAVVGMLGLVFKLLPWIIVIALGIWFFRE-r.
F7YIQ7_VIBA7/16-79                .MFELIFLLVFIATLLATGITLATVFIATIMGFIVLALLGMIGVMFKLLPWIIVIVLGVWFFRHV..
A0A089PMQ7_PLUGE/1-64             .MFELLFVIGFFVMLLVTGVSLVGIIAALVVATAVMFIGGLFALMIKLLPWLLLAIGIVWAIRA-i.
D4GHB4_PANAM/33-96                k-MDILFVLGFFLMLLFTGVSLLGVIAALIVATVVMFIGGVFALIVHVLPWLILAVAAVWLYRR-f.
A0A090U532_9ENTR/1-64             .MLELLFVIGFFIMLMVTGVSLLGVLAALVVATVVMFLGGLFALMIKLLPWLLLAVAVVWVIKA-i.
E0SEJ4_DICD3/1-52                 .------------MLLVTGVSLLGVMAALVVASVVMLIGGLFAVAIKVLPWLLLAVVVVWLWRR-f.
Q7CKP3_YERPE/1-64                 .MLEIFFVIGFFMVLMVTGISLLGILAALLVAAVFMMLGGLFVMMIKLLPWLILAVVVAWIWRSM..
F9T1T4_9VIBR/1-64                 .MFELIFIMVFAATLLVTGVTMVTVLAGVAFSLVVMVLLGMVGAVLKLLPWLIVIAIGIWFFKSY..
A8AN73_CITK8/1-64                 .MLELLFVMGFFIMLMATGVSLLGILAALMVATAVMFLGGMFALVIKLLPWLLLAVAVVWVIKAV..
A0A0F5V7J8_9GAMM/1-64             .MAEFLFLLVFAGVLVMTGISLMGMVFAIAAGFAVMALAGLLGVVIKLLPWIILIAVAVWLYR--ga
G7LJQ0_9ENTR/1-64                 .MLEIFFVIGFFIMLMVTGVSLLGVIAALFVAAFFMLLGGLFVMAIKVLPWLLLAVAAVWIWRH-f.
B7VI81_VIBTL/1-64                 .MFELIFVLIFVATLLVTGITFMTVLAATGIALAVMLVLGMMGVVFKLLPWLIVIAVGVWFFKNY..
D2TRT7_CITRI/1-64                 .MLELLFVLGFFIMLMVTGVSLLGVLAALVVATVVMFLGGMFVLMIKLLPWLLLAVAAVWVIKA-i.
A0A0M2KJ93_9ENTR/1-64             .MMEFLFVMVFFAMLLLMGITLPAIIAALIVATALMVVGGMLTFVIKIFPYLLLAVVLVGVYRHY..
K8B1C6_9ENTR/1-64                 .MFELLFVVAFFLMLLATGVSLLGIIAALMVATLVMFFGGVFALMIKVLPWLLLAVAVVWVIRSV..
H2IV46_RAHAC/1-64                 .MLEILFVLGFFFMLMLTGISLLGMVAALVVAFALMMVGGFLAIVIKMLPWLVLAVVAVWIYRA-f.
A0A0C5WP23_9GAMM/1-64             .MIEFLFLLVFAAVLVCTGVSILGMALAVVAGFVVMAVAGMIGVVFKLLPWLLLIAVVVWFYRE-h.
D8MLW1_ERWBE/1-63                 .-MEILFVLGFFVMLLLTGISVLGIIAALVVATVVMFFGGMLAIVIKLLPWLALAVVAVWIYRAY..
E6WIA9_PANSA/1-63                 .-MEILFVIGFFLMLLLTGVSLLGVIAALIVATVLMFLGGLFALVIKLLPWLVLAVVAVWLYRA-f.
W0LD04_9ENTR/1-64                 .MLELFFIIGFVVMLLVTGISLLGVIAALLVAAAFMLLGGLFAMVIKLLPWLILAVIGVWLYRSM..
A0A097QY21_HAFAL/1-64             .MLEVLFILGFFVMLMVTGISILGIIAAVAVATLFMLFGGLFVMVFKLLPWIALAIVVVWIYRSM..
I6G8N5_SHIFL/1-52                 .------------MLMVTGVSLLGVLAALVVATVVMFLGGLFALMIKLLPWLLLAVAVVWIIKA-i.
U3TS69_9ENTR/1-63                 .-MEILFVIGFFMMLLLTGVSLLGVIAALVVATVVMFLDGLFALVIKLLPWLVLAVVAVWLYRA-f.
Q7MHA1_VIBVY/2-65                 .MLELIFILVFAATLLVTGITMMTVFAATGIALVVMILLGMLGFVLKLLPWLIVIAVAIWFFKHV..
L0M886_ENTBF/1-64                 .MFELLFVIGFFVMLLVTGVSLLGIIAALFVATALMFVGGLFALVFKLLPWLLLAIAVVWVIRA-i.
A6D435_9VIBR/1-64                 .MFELIFVLVFLATLVMTGVTVMTVTLAVVVSFGVMFMLGMVGIVFNLLPYIIAFLIAIWLYKKV..
A0KPI4_AERHH/1-64                 .MLEFIVLMLVLVGMALAGFTVLAMLLVSGVFVLFGALAGMFALIIKLAPWLLVLLVVCWFISS-r.
C5B723_EDWI9/1-64                 .MLEVMFVLAFFMMLLLTGISLLGVIAALAVAALLLVFGGLFVLVIKLLPWLALAIVVVWLYRA-l.
B2VKD5_ERWT9/6-69                 .MSEILFVVGFFIMLLMTGISLLGIIAALLVATLVMFIGGFFAIVIKLLPWLAMAVAAVWLYRT-f.
F0LWV1_VIBFN/2-65                 .MVDLIFILVFVASLLVTGLTVFGTLVAIAVAFGVLMLLSLLGFALKLLPWLIVIALGVWVYRHY..
Q327V7_SHIDS/71-134               .MLELLFVIGFFVMLMVTGVSLLGIIAALVVATAIMFLGGMLALMIKLLPWLLLAIAVVWVIKA-i.
A0A0D8MSK7_PHOLE/1-64             .MFEFLFLLTFALVLVFTGVSIIGMMIAVAAGFAIMAVVGMLGLVIKLLPWILLIAVVIWLVRD-n.
E3BNY3_9VIBR/1-64                 .MFELIFILVFAATLLVTGVTFATVIAGVLFSFVVMLLLGMVGVVLKLLPWIIVIALGVWFFKT-y.
A0A0G4JVU6_9ENTR/1-64             .MLEIFFIIGFFIMLMVTGVSLLGVLAALFIAAVFMLVGGLFVMAIKVLPWLLLAVAVVWLWRH-f.
E1SAX5_PANVC/1-52                 .------------MLLLTGVSLLGVLAALVVATLVMFVGGLFAIVIKVLPWLVLAVIAVWLHRA-f.
F9RDD0_VIBSN/1-64                 .MFELIFILVFIATLLVTGLTMVTVFAAAGFALLVMVLLGMLGAVFKILPWLIVIALGFWFFKHY..
U4K9X9_9VIBR/1-64                 .MIELLFVLVFLGVLFFTGVTLVSIFAAGAVAFAVMLVLGMVGMVFKLLPWLIVLAVAWWFFRN-k.
Q7CPB1_SALTY/1-64                 .MLELLFVLGFFLMLMVTGVSLLGILAALVVATAVMFLGGMFALMIKLLPWLLLAVAVVWVIKAV..
A0A0F4NQA1_9VIBR/1-64             .MFELIFIMVFAATLLVTGVTMVTVIAGVAFSLLVMILLGMLGAVLKLLPWLIVIAIGIWFFKS-c.
Q87L87_VIBPA/3-66                 .MLELIFILVFAATLLVTGITMMTVFAATGIALVVMFLLGMIGAVLKLLPWLIVIALGIWFFRN-f.
A9MGN9_SALAR/1-64                 .MLELLFVLGFFLMLMVTGVSLLGILAALVVATAVMFLGGMLALMIKLLPWLLLAVAVVWVIKAV..
Q6D0Y7_PECAS/1-64                 .MLEIFFVIGFFIMLMLTGVSLLGVIAALFVASLFMLIGGLFTMAIKVLPWLILAVAAVWLWRK-f.
PSPG_ECOLI/1-64                   .MLELLFVIGFFVMLMVTGVSLLGIIAALVVATAIMFLGGMLALMIKLLPWLLLAIAVVWVIKA-i.
I2BDW2_SHIBC/1-64                 .MVELLFVVGFFVMLLVTGVSLLGIIVALLAATALMFVGGLLALMIKLLPWLLLAVVAVWIIRA-i.
A7MPN4_CROS8/1-64                 .MFELLFVVAFFLMLLATGVSLIGIIAALMVATLVMFFGGVFALMIKVLPWLLLAVAVVWVIRSV..
A0A0F5AR45_9GAMM/1-64             .MIEILFLIGFAVVLFMTGVSIMGMVLAMLAGFAVMMLAGMIGTLLKLLPWLLVIALVVWLVK--rq
A0A097QN92_9VIBR/1-64             .MFELIFVLVFIATLLVTGLTMFTVFAAAGFALMVMVLLGMVGAVIKLIPWLIVIAVGIWFFKNY..
A8GKA6_SERP5/1-64                 .MLELFFLVGFVVMLMVTGISLLGVFAAILVAAAFMLLGGLFAMVIKLLPWLILAVVGVWIYRSM..
D0Z0F0_PHODD/1-64                 .MFELLFLLAFTAVLVFTGISVIGILVAVAAGFALMMVAGMLGLVIKLLPWIIVIAIGVYFYRE-h.
L0MKH0_SERMA/1-64                 .MLEIFFFIGFVLMLLVTGVSLLGVLAALFVAAAFMLLGGLFAMVIKLLPWLILAVVGVWIYRS-l.
A6TGV8_KLEP7/1-64                 .MLELLFVIGFFVMLLVTGVSLLGIIAAIVVATALMFVGGLFALMIKLLPWLLLAVAAVWVIRA-l.
I6GCN7_SHIFL/1-64                 .MLELLFVIGFFVMLMVTGVSLLGIIAALVVATAIMFLGGMLALMIKLLPWLLLAIAVVWVIKA-i.
A8T9Q9_9VIBR/1-64                 .MLELIFILVFTATLLVTGLTMMTVFAAAGIALVVMFLLGMVGAILKLLPWLIVIALGIWFFKN-f.
A0A0A0Z1P7_9ENTR/1-63             .-MEIVFVLGFFLMLLLTGVSLLGVIAALAVATALMFLTGLFAFVIKLLPWLLLAVVAVWVWRSV..
#=GC seq_cons                     .MhEllFlluFhlMLllTGVSLLGllAAlsVAsslMhlGGhhulsIKLLPWLlLAllsVWlaRs.h.
//
DBGET integrated database retrieval system