GenomeNet

Database: Pfam
Entry: Phi-29_GP16_7
LinkDB: Phi-29_GP16_7
Original site: Phi-29_GP16_7 
#=GF ID   Phi-29_GP16_7
#=GF AC   PF06720.10
#=GF DE   Bacteriophage phi-29 early protein GP16.7
#=GF AU   Moxon SJ
#=GF SE   Pfam-B_23362 (release 10.0)
#=GF GA   25.00 25.00;
#=GF TC   290.70 290.50;
#=GF NC   23.50 22.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 26740544 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF DR   INTERPRO; IPR009595;
#=GF CC   This family consists of several bacteriophage phi-29 early
#=GF CC   protein GP16.7 sequences of around 130 residues in length. The
#=GF CC   function of this family is unknown.
#=GF SQ   1
#=GS GP167_BPPH2/1-130  AC P16517.1
#=GS GP167_BPPH2/1-130  DR PDB; 2C5R B; 66-129;
#=GS GP167_BPPH2/1-130  DR PDB; 2BNK A; 65-128;
#=GS GP167_BPPH2/1-130  DR PDB; 2C5R F; 66-129;
#=GS GP167_BPPH2/1-130  DR PDB; 1ZAE B; 63-130;
#=GS GP167_BPPH2/1-130  DR PDB; 2C5R E; 66-129;
#=GS GP167_BPPH2/1-130  DR PDB; 2C5R A; 66-129;
#=GS GP167_BPPH2/1-130  DR PDB; 2C5R C; 66-129;
#=GS GP167_BPPH2/1-130  DR PDB; 1ZAE A; 63-130;
#=GS GP167_BPPH2/1-130  DR PDB; 2C5R D; 66-129;
#=GS GP167_BPPH2/1-130  DR PDB; 2BNK B; 65-128;
GP167_BPPH2/1-130             MEAILMIGVLALCVIFLLSGRNNKKKQEARELEDYLEDLNKRVVQRTQILSELNEVISNRSIDKTVNLSACEVAVLDLYEQSNIRIPSDIIEDLVNQRLQSEQEVLNYIETQRTYWKLENQKKLYRGSLK
#=GR GP167_BPPH2/1-130  SS    XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSXSSS-HHHHHHHHHHHHTT----HHHHHHHHTT--SSHHHHHHHHHHHHHHHHHHHHS----SS-X
#=GC SS_cons                  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSXSSS-HHHHHHHHHHHHTT----HHHHHHHHTT--SSHHHHHHHHHHHHHHHHHHHHS----SS-X
#=GC seq_cons                 MEAILMIGVLALCVIFLLSGRNNKKKQEARELEDYLEDLNKRVVQRTQILSELNEVISNRSIDKTVNLSACEVAVLDLYEQSNIRIPSDIIEDLVNQRLQSEQEVLNYIETQRTYWKLENQKKLYRGSLK
//
DBGET integrated database retrieval system