GenomeNet

Database: Pfam
Entry: Phi-29_GP3
LinkDB: Phi-29_GP3
Original site: Phi-29_GP3 
#=GF ID   Phi-29_GP3
#=GF AC   PF05435.9
#=GF DE   Phi-29 DNA terminal protein GP3
#=GF AU   Moxon SJ
#=GF SE   Pfam-B_14111 (release 8.0)
#=GF GA   25.00 25.00;
#=GF TC   223.10 222.10;
#=GF NC   18.70 18.20;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   6779279
#=GF RT   Protein p3 is linked to the DNA of phage phi 29 through a
#=GF RT   phosphoester bond between serine and 5'-dAMP. 
#=GF RA   Hermoso JM, Salas M; 
#=GF RL   Proc Natl Acad Sci U S A 1980;77:6425-6428.
#=GF DR   INTERPRO; IPR008770;
#=GF CC   This family consists of DNA terminal protein GP3 sequences from
#=GF CC   Phi-29 like bacteriophages. DNA terminal protein GP3 is linked
#=GF CC   to the 5' ends of both strands of the genome through a
#=GF CC   phosphodiester bond between the beta-hydroxyl group of a serine
#=GF CC   residue and the 5'-phosphate of the terminal deoxyadenylate.
#=GF CC   This protein is essential for DNA replication and is involved in
#=GF CC   the priming of DNA elongation [1].
#=GF SQ   2
#=GS A0A0L0BZD0_LUCCU/1-259  AC A0A0L0BZD0.1
#=GS TERM_BPPH2/1-266        AC P03681.1
#=GS TERM_BPPH2/1-266        DR PDB; 2EX3 B; 71-259;
#=GS TERM_BPPH2/1-266        DR PDB; 2EX3 D; 71-259;
#=GS TERM_BPPH2/1-266        DR PDB; 2EX3 H; 71-259;
#=GS TERM_BPPH2/1-266        DR PDB; 2EX3 J; 71-259;
#=GS TERM_BPPH2/1-266        DR PDB; 2EX3 L; 71-259;
#=GS TERM_BPPH2/1-266        DR PDB; 2EX3 F; 71-259;
A0A0L0BZD0_LUCCU/1-259             MARKRPIRITKNDRAEYKRLSKNAKSKLNRTVKNYGIDLSNDVDIPKLSDFKTRKEFNDWKQKITSFTSRSNQEYQFRKNEYGVVASVKELNEIKRNTKKAQKIAKEKIdKAMK-LDFYVEGERQGKVKDRIKLMKKEEVAGVSVPVDFDFDKIQTRKRLEDKAGFMEERATGDYYRKKDIQMKENFISMIEQGFNS--DADEVIKKLKKIPPDDFVELTIVTDEIDFRNYGSKNEGGINDEDKLEELNNTLNDY------------fnetttd
TERM_BPPH2/1-266                   MARSPRIRIKDNDKAEYARLVKNTKAKIARTKKKYGVDLTAEIDIPDLDSFETRAQFNKWKEQASSFTNRANMRYQFEKNAYGVVASKAKIAEIERNTKEVQRLVDEKI.KAMKDKEYYAGGKPQGTIEQRIAMTSPAHVTGINRPHDFDFSKVRSYSRLRTLEESMEMRTDPQYYEKKMIQLQLNFIKSVEGSFNSFDAADELIEELKKIPPDDFYELFLRISEISFEEFDSEGNTVENVEGNVYKILSYLEQYRRGDFDLSLKGF.......
#=GR TERM_BPPH2/1-266        SS    XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--TTS-EEE-TTS-EEEHHHHHHHHHHHHHHHHHHHHHH.HHHHHHHHH-------------------------------GGG--SHHHHHHHHHHHHHTTSTTHHHHHHHHHHHHHHHHHHHHH-BSHHHHHHHHHHHTS-HHHHHHHHHHHTTT-----------HHHHHHHHHHHHHHHHHHHTT--XXXXXXX.......
#=GC SS_cons                       XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX--TTS-EEE-TTS-EEEHHHHHHHHHHHHHHHHHHHHHH.HHHHHHHHH-------------------------------GGG--SHHHHHHHHHHHHHTTSTTHHHHHHHHHHHHHHHHHHHHH-BSHHHHHHHHHHHTS-HHHHHHHHHHHTTT-----------HHHHHHHHHHHHHHHHHHHTT--XXXXXXX.......
#=GC seq_cons                      MARp..IRIpcND+AEYtRLsKNsKuKlsRThKpYGlDLos-lDIPcLssFcTRtpFNcWKpphoSFTsRuN.cYQFcKNtYGVVAShtclsEIcRNTKcsQ+lscEKI.KAMK.h-aYstGc.QGplcpRIthhp.tcVsGlshPhDFDFsKlpohpRLcshtt.ME.RssspYYcKK.IQhp.NFIp.lEtuFNS..sADElIccLKKIPPDDFhELhlhhsEIsFcpasScspss.NsEspl.cl.shLppY...................
//
DBGET integrated database retrieval system