GenomeNet

Database: Pfam
Entry: Pico_P1A
LinkDB: Pico_P1A
Original site: Pico_P1A 
#=GF ID   Pico_P1A
#=GF AC   PF02226.14
#=GF DE   Picornavirus coat protein (VP4)
#=GF AU   Bateman A
#=GF SE   Pfam-B_345 (release 5.2)
#=GF GA   20.80 20.80;
#=GF TC   21.80 143.90;
#=GF NC   18.00 17.10;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   9083115
#=GF RT   The refined structure of human rhinovirus 16 at 2.15 A
#=GF RT   resolution: implications for the viral life cycle. 
#=GF RA   Hadfield AT, Lee Wm, Zhao R, Oliveira MA, Minor I, Rueckert RR,
#=GF RA   Rossmann MG; 
#=GF RL   Structure 1997;5:427-441.
#=GF DR   INTERPRO; IPR003138;
#=GF DR   SCOP; 1aym; fa;
#=GF CC   VP1, VP2, VP3 and VP4 for the basic unit that forms the
#=GF CC   icosahedral coat of picornaviruses. Five symmetry-related N
#=GF CC   termini of coat protein VP4 form a ten-stranded, antiparallel
#=GF CC   beta barrel around the base of the icosahedral fivefold axis
#=GF CC   [1].
#=GF SQ   2
#=GS POLG_HRV8A/2-69  AC P07210.3
#=GS POLG_POL1M/2-69  AC P03300.3
#=GS POLG_POL1M/2-69  DR PDB; 3JBG 4; 2-69;
#=GS POLG_POL1M/2-69  DR PDB; 3JBC 4; 2-69;
#=GS POLG_POL1M/2-69  DR PDB; 3JBE 4; 2-69;
#=GS POLG_POL1M/2-69  DR PDB; 3JBF 4; 2-69;
#=GS POLG_POL1M/2-69  DR PDB; 1AR7 4; 2-69;
#=GS POLG_POL1M/2-69  DR PDB; 1AR9 4; 2-69;
#=GS POLG_POL1M/2-69  DR PDB; 1AR8 4; 2-69;
#=GS POLG_POL1M/2-69  DR PDB; 1VBD 4; 2-69;
#=GS POLG_POL1M/2-69  DR PDB; 1ASJ 4; 2-69;
#=GS POLG_POL1M/2-69  DR PDB; 3J9F 4; 2-69;
#=GS POLG_POL1M/2-69  DR PDB; 1PO1 4; 2-69;
#=GS POLG_POL1M/2-69  DR PDB; 1AL2 4; 2-69;
#=GS POLG_POL1M/2-69  DR PDB; 1POV ; 2-69;
#=GS POLG_POL1M/2-69  DR PDB; 3EPC 4; 2-69;
#=GS POLG_POL1M/2-69  DR PDB; 3J8F 4; 2-69;
#=GS POLG_POL1M/2-69  DR PDB; 1PO2 4; 2-69;
#=GS POLG_POL1M/2-69  DR PDB; 3JBD 4; 2-69;
#=GS POLG_POL1M/2-69  DR PDB; 1HXS 4; 2-69;
#=GS POLG_POL1M/2-69  DR PDB; 1AR6 4; 2-69;
#=GS POLG_POL1M/2-69  DR PDB; 2PLV 4; 2-69;
POLG_HRV8A/2-69             GAQVSRQNVGTHSTQNSVSNGSSLNYFNINYFKDAASSGASRLDFSQDPSKFTDPVKDVLEKGIPTLQ
POLG_POL1M/2-69             GAQVSSQKVGAHENSNRAYGGSTINYTTINYYRDSASNAASKQDFSQDPSKFTEPIKDVLIKTAPMLN
#=GR POLG_POL1M/2-69  SS    -EEEEE---SS-TSSSSSSSSS--EEEEE--SSSGGGS------B---THHHHS-BSSTTSTTSGSGG
#=GC SS_cons                -EEEEE---SS-TSSSSSSSSS--EEEEE--SSSGGGS------B---THHHHS-BSSTTSTTSGSGG
#=GC seq_cons               GAQVSpQpVGsHpspNps.sGSolNYhsINYa+DuASsuAS+.DFSQDPSKFT-PlKDVL.KshPhLp
//
DBGET integrated database retrieval system