GenomeNet

Database: Pfam
Entry: Pneumo_M2
LinkDB: Pneumo_M2
Original site: Pneumo_M2 
#=GF ID   Pneumo_M2
#=GF AC   PF07380.6
#=GF DE   Pneumovirus M2 protein
#=GF AU   Moxon SJ
#=GF SE   Pfam-B_20478 (release 10.0)
#=GF GA   25.00 25.00;
#=GF TC   73.20 72.80;
#=GF NC   22.90 20.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   12692207
#=GF RT   Identification of amino acids that are critical to the
#=GF RT   processivity function of respiratory syncytial virus M2-1
#=GF RT   protein. 
#=GF RA   Zhou H, Cheng X, Jin H; 
#=GF RL   J Virol 2003;77:5046-5053.
#=GF DR   INTERPRO; IPR009969;
#=GF CC   This family consists of several Pneumovirus M2 proteins. The
#=GF CC   M2-1 protein of respiratory syncytial virus (RSV) is a
#=GF CC   transcription processivity factor that is essential for virus
#=GF CC   replication [1].
#=GF SQ   21
#=GS C3UPB6_9MONO/1-89  AC C3UPB6.1
#=GS Q4KRW2_HRSV/1-89   AC Q4KRW2.1
#=GS D8L6Y0_HRSV/1-87   AC D8L6Y0.1
#=GS M22_BRSVA/1-89     AC Q77KZ6.2
#=GS G8EIP1_HRSV/1-87   AC G8EIP1.1
#=GS Q65704_9MONO/6-94  AC Q65704.1
#=GS G8EIT4_HRSV/1-87   AC G8EIT4.1
#=GS G8FR67_9MONO/1-89  AC G8FR67.1
#=GS G8FRA0_9MONO/1-89  AC G8FRA0.1
#=GS G8EIS3_HRSV/1-87   AC G8EIS3.1
#=GS G8EIN0_HRSV/1-87   AC G8EIN0.1
#=GS G8EID1_HRSV/1-87   AC G8EID1.1
#=GS G8EIF3_HRSV/1-87   AC G8EIF3.1
#=GS G8EJ11_HRSV/1-87   AC G8EJ11.1
#=GS Q9YS22_9MONO/1-89  AC Q9YS22.1
#=GS M22_HRSVB/1-89     AC O42047.1
#=GS G8FR56_9MONO/1-47  AC G8FR56.1
#=GS G8FR45_9MONO/1-89  AC G8FR45.1
#=GS M22_HRSVA/1-89     AC P88812.1
#=GS G8FR89_9MONO/1-52  AC G8FR89.1
#=GS Q6V2E5_HRSV/4-92   AC Q6V2E5.1
C3UPB6_9MONO/1-89             MTMPKIMILPDKYPCSITSILITSRCRVTMYNRKNTLYFNQNNPNNHMYSPNQTFNEIHWTSQDLIDTIQNFLQHLGVIEDIYTIYILV........
Q4KRW2_HRSV/1-89              MTMPKIMILPDKYPCSITSILITSRCRVTMYNRKNTLYFNQNNPNNHMYSPNQTFNEIHWTSQDLIDTIQNFLQHLGVIEDIYTIYILV........
D8L6Y0_HRSV/1-87              --MPKIMILPDKYPCSINSILITSSCRVTMYNQKNTLYINQTNQNNHIYSPNQPFNEIHWTSQDLIDATQNFLQHLGINDDIYTIYILV........
M22_BRSVA/1-89                MNNSNIIIFPEKYPCSISSLLIKDENDVFVLSHQNVLDCLQFQYPYNMYSQNHMLDDIYWTSQELIEDVLKILHLSGISINKYVIYVLV........
G8EIP1_HRSV/1-87              --MPKIMILPDKYPCSINSILITSSCRVTMYNQKNTLYFNQNNQNNHTYSSNQPFNEIHWTSQDLIDAIQNFLQHLGITDDVYTIYILV........
Q65704_9MONO/6-94             MNNSNIIIFPEKYPCSISSLLIKDENDVFVLSHQNVLDCLQFQYPYNMYSQNHMLDDIYWTSQELIEDVLKILHLSGISINKYVIYVLV........
G8EIT4_HRSV/1-87              --MPKIMILPDKYPCSINSILITSSCRVTMYNQKNTLYFNQNNQNNHIYSPNQPFNEIHWTSQDLIDATQNFLQHLGIIDDIYTIYILV........
G8FR67_9MONO/1-89             MTKPKIMILPDKYPCSISSILISSESMIATFNHKDILQFNHNHLDNHQCLLNHIFDEIHWTPKNLLDATQQFLQHLNIPEDIYTVYILV........
G8FRA0_9MONO/1-89             MTKPKIMILPDKYPCSISSILISSESMIATFNHKDILQFNHNHLDNHQCLLNHIFDEIHWTPKNLLDATQQFLQHLNISEDIYTVYILV........
G8EIS3_HRSV/1-87              --MPKIMILPDKYPCSINSILITSNCRVTMYNQKNTLYFNQNNQNNHIYSPNQPFNEIHWTSQDLIDAIQNFLQHLGITDDIYTIYILV........
G8EIN0_HRSV/1-87              --MPKIMILPDKYPCSINSILITSNCRVTMYNQKNTLYINQNNQNNHIYSPNQPFNEIHWTSQDLIDATQNFLQHLGITDDIYTIYILV........
G8EID1_HRSV/1-87              --MPKIMILPDKYPCSINSILITSNCRVTMYNQKNTLYINQNNQNNHIYPPDQPFNEIHWTSQDLIDATQNFLQHLGITDDIYTIYILV........
G8EIF3_HRSV/1-87              --MPKIMILPDKYPCSINSILITSNYRVTMYNQKNTLYINQNNQNNHIYPPDQPFNEIHWTSQDLIDATQNFLQHLGITDDIYTIYILV........
G8EJ11_HRSV/1-87              --MPKIMILPDKYPCSITSILITSRCRVTMYNQKNTLYFNQNNPNNHMYSPNQTFNEIHWTSQELIDTIQNFLQHLGIIEDIYTIYILV........
Q9YS22_9MONO/1-89             MNNSNIIIFPEKYPCSISSLLIKNENDVIVLSHQNVLDYLQFQYPCNMYSQNHMLDDIYWTSQELIEDVLKILHLSGISISKYVIYVLV........
M22_HRSVB/1-89                MTKPKIMILPDKYPCSISSILISSESMIATFNHKNILQFNHNHLDNHQRLLNNIFDEIHWTPKNLLDATQQFLQHLNIPEDIYTIYILV........
G8FR56_9MONO/1-47             MTKPKIMILPDKYXCSISSILISSESMIATFNHKDILQFNHNHLDNH------------------------------------------........
G8FR45_9MONO/1-89             MTKPKIMILPDKYPCSISSILISSESMIATFNHKDILQFNHNHLDNHQCLLNHIFDEIHWTPKDLLDTTQQFLQHLNIPEDIYTVYILV........
M22_HRSVA/1-89                MTMPKIMILPDKYPCSITSILITSRCRVTMYNQKNTLYFNQNNPNNHMYSPNQTFNEIHWTSQELIDTIQNFLQHLGIIEDIYTIYILV........
G8FR89_9MONO/1-52             MTKPKIMILPDKYPCSISSILISSESMIATFNHKDILQFNHXXX---------------------------------------------xxxxxxxx
Q6V2E5_HRSV/4-92              MTKPKIMILPDKYPCSISSILISSESMVATFNHKNILQFNHNHLDNHQCLLNHIFDEIHWTPKNLLDTTQQFLQHLNIPEDIYTVYILV........
#=GC seq_cons                 MshPKIMILPDKYPCSIoSILIoScscVshaNpKNsL.FNQNp.sNHhYs.Np.FsEIHWTSQ-LIDssQpFLQHLGIs-DIYTIYILV........
//
DBGET integrated database retrieval system