GenomeNet

Database: Pfam
Entry: Pneumo_M2
LinkDB: Pneumo_M2
Original site: Pneumo_M2 
#=GF ID   Pneumo_M2
#=GF AC   PF07380.9
#=GF DE   Pneumovirus M2 protein
#=GF AU   Moxon SJ
#=GF SE   Pfam-B_20478 (release 10.0)
#=GF GA   25.00 25.00;
#=GF TC   210.20 210.10;
#=GF NC   21.70 21.00;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   12692207
#=GF RT   Identification of amino acids that are critical to the
#=GF RT   processivity function of respiratory syncytial virus M2-1
#=GF RT   protein. 
#=GF RA   Zhou H, Cheng X, Jin H; 
#=GF RL   J Virol 2003;77:5046-5053.
#=GF DR   INTERPRO; IPR009969;
#=GF CC   This family consists of several Pneumovirus M2 proteins. The
#=GF CC   M2-1 protein of respiratory syncytial virus (RSV) is a
#=GF CC   transcription processivity factor that is essential for virus
#=GF CC   replication [1].
#=GF SQ   1
#=GS M22_HRSVB/1-89  AC O42047.1
M22_HRSVB/1-89             MTKPKIMILPDKYPCSISSILISSESMIATFNHKNILQFNHNHLDNHQRLLNNIFDEIHWTPKNLLDATQQFLQHLNIPEDIYTIYILV
#=GC seq_cons              MTKPKIMILPDKYPCSISSILISSESMIATFNHKNILQFNHNHLDNHQRLLNNIFDEIHWTPKNLLDATQQFLQHLNIPEDIYTIYILV
//
DBGET integrated database retrieval system