GenomeNet

Database: Pfam
Entry: Pox_F15
LinkDB: Pox_F15
Original site: Pox_F15 
#=GF ID   Pox_F15
#=GF AC   PF04596.8
#=GF DE   Poxvirus protein F15
#=GF AU   Mifsud W
#=GF SE   Pfam-B_5182 (release 7.5)
#=GF GA   25.00 25.00;
#=GF TC   165.00 164.90;
#=GF NC   20.50 20.40;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 80369284 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF DR   INTERPRO; IPR007675;
#=GF SQ   55
#=GS F1DIQ4_MONPV/23-158  AC F1DIQ4.1
#=GS Q77GQ2_LSDV/12-145   AC Q77GQ2.1
#=GS G0XTX7_COWPX/23-158  AC G0XTX7.1
#=GS Q0NQ21_COWPX/23-158  AC Q0NQ21.1
#=GS Q0NGA0_VAR46/26-161  AC Q0NGA0.1
#=GS Q8QN02_COWPX/23-158  AC Q8QN02.1
#=GS I0AZB2_9POXV/23-158  AC I0AZB2.1
#=GS Q80E15_COWPX/23-158  AC Q80E15.1
#=GS F15_VACCC/23-158     AC P21020.1
#=GS O57181_9POXV/23-158  AC O57181.1
#=GS A7XCE2_9POXV/12-148  AC A7XCE2.1
#=GS M9WFL5_9POXV/23-158  AC M9WFL5.1
#=GS Q9DHT3_YLDV/12-148   AC Q9DHT3.1
#=GS T2ATW7_9POXV/12-148  AC T2ATW7.1
#=GS Q91MX8_LSDV/12-145   AC Q91MX8.1
#=GS Q0GP33_HSPV/23-158   AC Q0GP33.1
#=GS Q6VZL5_CNPV/12-146   AC Q6VZL5.1
#=GS Q1PIZ6_9POXV/23-158  AC Q1PIZ6.1
#=GS Q83606_9POXV/12-148  AC Q83606.1
#=GS F15_VAR67/26-161     AC P33873.1
#=GS Q70H50_FOWPV/12-147  AC Q70H50.1
#=GS Q775Y6_CAMPS/23-158  AC Q775Y6.1
#=GS Q0NM15_VAR66/26-161  AC Q0NM15.1
#=GS Q1M1R6_9POXV/23-158  AC Q1M1R6.1
#=GS Q8JTW9_LSDV/12-145   AC Q8JTW9.1
#=GS Q76Q38_VARV/26-161   AC Q76Q38.1
#=GS F15_FOWPN/12-147     AC Q9J5B5.1
#=GS Q9Q947_RFVKA/12-148  AC Q9Q947.1
#=GS A0ERQ3_9POXV/23-158  AC A0ERQ3.1
#=GS Q08FW4_DPV83/12-148  AC Q08FW4.1
#=GS A9J1J9_VACCA/23-158  AC A9J1J9.1
#=GS Q0NCT3_VAR65/26-161  AC Q0NCT3.1
#=GS Q49QL8_9POXV/23-158  AC Q49QL8.1
#=GS Q0NPF6_9POXV/23-158  AC Q0NPF6.1
#=GS Q98193_MCV1/12-148   AC Q98193.1
#=GS Q77PA4_MYXVL/12-148  AC Q77PA4.1
#=GS Q6RZP8_9POXV/23-158  AC Q6RZP8.1
#=GS Q5IXX8_MONPV/23-158  AC Q5IXX8.1
#=GS Q77ZD4_9POXV/23-158  AC Q77ZD4.1
#=GS Q08FE4_DPV84/12-148  AC Q08FE4.1
#=GS Q8V533_MONPV/23-158  AC Q8V533.1
#=GS Q8V2W7_CAMPM/23-158  AC Q8V2W7.1
#=GS Q0N5A8_VARV/26-161   AC Q0N5A8.1
#=GS F15_VACCP/23-158     AC P29891.2
#=GS F15_VACCW/12-147     AC Q80HX4.1
#=GS Q070K5_CPRVZ/12-148  AC Q070K5.1
#=GS Q6VFS2_9POXV/12-149  AC Q6VFS2.1
#=GS O11314_MCV1/1-137    AC O11314.1
#=GS Q8V3R7_SWPV1/12-148  AC Q8V3R7.1
#=GS G3EIB0_9POXV/12-148  AC G3EIB0.1
#=GS L7QJC8_9POXV/12-147  AC L7QJC8.1
#=GS Q6TUY3_YMTV5/12-148  AC Q6TUY3.1
#=GS B9U1C4_9POXV/23-158  AC B9U1C4.1
#=GS Q1HTT4_9POXV/12-149  AC Q1HTT4.1
#=GS H6TAJ5_9POXV/12-146  AC H6TAJ5.1
F1DIQ4_MONPV/23-158             MKPFKNMNKITINQKDNCILANRCFVKIDTPRYIPSTSIS....SSNIIRIRNHDFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKVSKQQKECKYCISNRG-.DDDSLSINIFIPTINKSIYIIIGLRXKNFWKPKFEIE.
Q77GQ2_LSDV/12-145              LSPFRNMDKIKINKDDNCLLGNRCFVKMDTVKHFPTNSVA....TSDSVIIKGYRFTLTELLYSPFHFQQPQCQYLLPSFVLKCIDEATKNKTICKYCIINKD-.-DNSLNINIFVPTFDL-KYLIIGLRIKHFWSSKFQIE.
G0XTX7_COWPX/23-158             MKPFKNMNKITINQKDNCILANRCFVKIDTPRYVPSASIN....SSNTIRIRNHDFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKVSKQQKECKYCISNRG-.DDDSLSINLFIPTINKSIYIIIGLRMKNFWKPKFEIE.
Q0NQ21_COWPX/23-158             MKPFKNMNKITINQKDNCILANRCFVKIDTPRYVPSASIN....SSNTIRIRNHSFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKVSKQQKECKYCISNRG-.DDDSLSINLFIPTINKSIYIIIGLRMKNFWKPKFEIE.
Q0NGA0_VAR46/26-161             MKPFKNMNKITINQKDNCILANRCFVKIDTPRYIPLTSIS....SSNIIRIRNHDFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKVSKQQKECKYCISNRG-.DDDSLSINLFIPTINKSIYIIIGLRMKNFWKPKFEIE.
Q8QN02_COWPX/23-158             MKPFKNMNKITINQKDNCILANRCFVKIDTPRYVPSASIN....SSNTIRIRNHDFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKVSKQQKECKYCISNRG-.DDDSLSINLFIPTINKSIYIIIGLRMKNFWKPKFEIE.
I0AZB2_9POXV/23-158             MKPFKNMNKITINQKDNCILANRCFVKIDTPRYIPSTSIS....SSNIIRIRNHDFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKVSKQQKECKYCISNRG-.DDDSLSINLFIPTINKSIYIIIGLRMKNFWKPKFEIE.
Q80E15_COWPX/23-158             MKPFKNMNKITINQKDNCILANRCFVKIDTPRYIPSTSIS....SSNIIRIRNHDFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKVSKQQKECKYCISNRG-.DDDSLSINLFIPTINKSIYIIIGLRMKNFWKPKFEIE.
F15_VACCC/23-158                MKPFKNMNKITINQNDNCILANRCFVKIDTPRYIPSTSIS....SSNIIRIRNHDFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKVSKQQKECKYCISNRG-.DDDSLSINLFIPTINKSIYIIIGLRMKNFWKPKFEIE.
O57181_9POXV/23-158             MKPFKNMNKITINQNDNCILANRCFVKIDTPRYIPSTSIS....SSNIIRIRNHDFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKVSKQQKKCKYCISNRG-.DDDSLSINLFIPTINKSIYIIIGLRMKNFWKPKFEIE.
A7XCE2_9POXV/12-148             LNPFKNMNKIKINLNDNCVLGNRCFVKVDKVRFIPYNSVE....TSKPVMIRGCTFTLPELLYSPFHFQQPQIQYLMPSFVLYCIEEANKNKSTSKYCIIDKNT.ETDELKINIFVPTFLKSVYVIIGLRIKHFWSSKFKIE.
M9WFL5_9POXV/23-158             MKPFKNMNKITINQNDNCILANRCFVKIDTPRYIPSTSIS....SSNIIRIRNHDFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKVSKQQKKCKYCISNCG-.DDDSLSINLFIPTINKSIYIIIGLRMKNFWKPKFEIE.
Q9DHT3_YLDV/12-148              LNPFKNMNKIKINLNDNCVLGNRCFVKVDKVRFIPYNSVE....TSKPVMIRGCTFTLPELLYSPFHFQQPQIQYLMPSFVLYCIEEANKNKSTSKYCIIDKNT.ETDELKINIFVPTFLKSVYVIIGLRIKHFWSSKFKIE.
T2ATW7_9POXV/12-148             LNPFKHMNRIKINAEEKCLLGSTSFIKIDKVKRIPSNAVD....VSKSIHVRGQDFTLSELLYSPLYFQQARGQCIMPHFVLKCIDEAKKNRMVCKYCTVTKSS.DPQGLNANVFIPTKTDSTYIIVGIRIKSYWSVTFRVE.
Q91MX8_LSDV/12-145              LSPFRNMDKIKINKDDNCLLGNRCFVKMDTVKHFPTNSVA....TSDSVIIKGYRFTLTELLYSPFHFQQPQCQYLLPSFVLKCIDEATKNKTICKYCIINKD-.-DNSLNINIFVPTFDL-KYLIIGLRIKHFWSSKFQIE.
Q0GP33_HSPV/23-158              MKPFKNMNKITINQKDNCILANRCFVKIDTPRYIPSTSIS....SSNIIRIRNHDFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKVSKQQKKCKYCISNRG-.DDDSLSINLFIPTINKSIYIIIGLRMKNFWKPKFEIE.
Q6VZL5_CNPV/12-146              MHPFSDMDNVIINEKENCILGNRCFVKISEVYNMPI-CFN....TEQCVSMDRLKFSLVEILYSPFYYKQLQYQYLMPQFIFKCINEANNKKKTCSYCFTKKK-.EHNSLNIDIFIPTTNPRYYIVIGLRIKDYWRQSFKVN.
Q1PIZ6_9POXV/23-158             MKPFKNMNKITINQKDNCILANRCFVKIDTPRYIPSTSIS....SSNIIRIRNHDFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKVSKQQKECKYCISNRG-.DDDSLSINLFIPTINKSIYIIIGLRMKNFWKPKFEIE.
Q83606_9POXV/12-148             LNPFKHMNRIKINREEKCLLGSTSFIKIDKVKHIPGNAVN....VSKSIHVRGQDFTLSELLYSPLYFQQARGQCIMPHFVLKCIDEAKKNRMVCKYCTVTKSS.DPQGLNANIFIPTKTESTYIIIGIRIKSYWSVTFRVE.
F15_VAR67/26-161                MKPFKNMNKITINQKDNCILANRCFVKIDTPRYIPLTSIS....SSNIIRIRNHDFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKVSKQQKECKYCISNRG-.DDDSLSINLFIPTINKSIYIIIGLRMKNFWKPKFEIE.
Q70H50_FOWPV/12-147             MNPFSDMENIVINEKEKCILGNRCFVKLSEVYNMPMCCID....TNQCLTMNRFKFSLNELLYTPFYYKQLQYQYLTPQFIFRCIQEANENNMSCYYCYTKKK-.EHNGLNIDIFIPTANSKSYIVIGLRIKDFWKQSFKVN.
Q775Y6_CAMPS/23-158             MKPFKNMNKITINQKDNCILANRCFVKIDTPRYIPSTSIS....SSNIIRIRNHDFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKVSKQQKECKYCISNRG-.DDDSLSINLFIPTINKSIYIIIGLRMKNFWKPKFEIE.
Q0NM15_VAR66/26-161             MKPFKNMNKITINQKDNCILANRCFVKIDTPRYIPLTSIS....SSNIIRIRNHDFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKVSKQQKECKYCISNRG-.DDDSLSINLFIPTINKSIYIIIGLRMKNFWKPKFEIE.
Q1M1R6_9POXV/23-158             MKPFKNMNKITINQKDNCILANRCFVKIDTPRYIPSTSIS....SSNIIRIRNHDFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKVSKQQKKCKYCISNRG-.NDDSLSINLFIPTINKSIYIIIGLRMKNFWKPKFEIE.
Q8JTW9_LSDV/12-145              LSPFRNMDRIKINKDDNCLLGNRCFVKMDTVKHFPTNSVA....TSDSVIIKGYRFTLTELLYSPFHFQQPQCQYLLPSFVLKCIDEATKNKTICKYCIINKD-.-DNSLNINIFVPTFDL-KYLIIGLRIKHFWSSKFQIE.
Q76Q38_VARV/26-161              MKPFKNMNKITINQKDNCILANRCFVKIDTPRYIPLTSIS....SSNIIRIRNHDFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKVSKQQKECKYCISNRG-.DDDSLSINLFIPTINKSIYIIIGLRMKNFWKPKFEIE.
F15_FOWPN/12-147                MNPFSDMENIVINEKEKCILGNRCFVKLSEVYNMPMCCID....TNQCLTMNRFKFSLNELLYTPFYYKQLQYQYLTPQFIFRCIQEANENNMSCYYCYTKKK-.EHNGLNIDIFIPTANSKSYIVIGLRIKDFWKQSFKVN.
Q9Q947_RFVKA/12-148             LNPFKHMNRIKINTEEKCLLGSTSFIKIDKVKHIPNNAVD....VSKSIRVRGQDFTLSELLYSPLYFQQARGQCIMPHFVIKCIDEAKKNRMVCKYCTVTKSS.DPQGLNANIFIPTKTESIYIIVGIRIKSYWSVTFRVE.
A0ERQ3_9POXV/23-158             MKPFKNMNKITINQKDNCILANRCFVKIDTPRYIPSTSIS....SSNIIRIRNHDFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKVSKQQKKCKYCISNRG-.DDDSLSINLFIPTINKSIYIIIGLRMKNFWKPKFEIE.
Q08FW4_DPV83/12-148             LNPFKNMKKIKINLDDNCLLGNRCFVKIGNVRYIPTNSIE....TSESIMIRGHKFTLLELLYSPFHFQQSQHQYILPGFILTCIEKAKRNKNICKYCITDRGD.GQDSLNINIFIQTIYTSIYIIIGLRIKYFWSSNFEIE.
A9J1J9_VACCA/23-158             MKPFKNMNKITINQNDNCILANRCFVKIDTPRYIPSTSIS....SSNIIRIRNHDFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKVSKQQKKCKYCISNRG-.DDDSLSINLFIPTINKSIYIIIGLRMKNFWKPKFEIE.
Q0NCT3_VAR65/26-161             MKPFKNMNKITINQKDNCILANRCFVKIDTPRYIPLTSIS....SSNIIRIRNHDFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKVSKQQKECKYCISNRG-.DDDSLSINLFIPTINKSIYIIIGLRMKNFWKPKFEIE.
Q49QL8_9POXV/23-158             MKPFKNMNKITINQNDNCILANRCFVKIDTPRYIPSTSIS....SSNIIRIRNHDFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKVSKQQKECKYCISNRG-.DDDSLSINLFIPTINKSIYIIIGLRMKNFWKPKFEIE.
Q0NPF6_9POXV/23-158             MKPFKNMNKITINQKDNCILANRCFVKIDTPRYIPSTSIS....SSNIIRIRNHDFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKVSKQQKECKYCISNRG-.DDDSLSINLFIPTINKSIYIIIGLRMKNFWKPKFEIE.
Q98193_MCV1/12-148              LQPFHDMDRVKINRKENCILGNRCFVKLAEVFHMPRCSVP....TSASLCANNHSFTLHELLYSPFHYKQPQYQYLLPSFVFTCIELARKNNQTCYYCKADRAN.EEGSLNLNIFVPTLARSMYVVIGIRIKDYWVEAFEI-v
Q77PA4_MYXVL/12-148             LNPFKHMNRIKINREEKCLLGSTSFIKIDKVKHIPGNAVN....VSKSIHVRGQDFTLSELLYSPLYFQQARGQCIMPHFVLKCIDEAKKNRMVCKYCTVTKSS.DPQGLNANIFIPTKTESTYIIIGIRIKSYWSVTFRVE.
Q6RZP8_9POXV/23-158             MKPFKNMNKITINQNDNCILANRCFVKIDTPRYIPSTSIS....SSNIIRIRNHDFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKVSKQQKECKYCISNRG-.DDDSLSINLFIPTINKSIYIIIGLRMKNFWKPKFEIE.
Q5IXX8_MONPV/23-158             MKPFKNMNKITINQKDNCILANRCFVKIDTPRYIPSTSIS....SSNIIRIRNHDFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKVSKQQKECKYCISNRG-.DDDSLSINIFIPTINKSIYIIIGLRMKNFWKPKFEIE.
Q77ZD4_9POXV/23-158             MKPFKNMNKITINQKDNCILANRCFVKIDTPRYIPSTSIS....SSNIIRIRNHDFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKVSKQQKECKYCISNRG-.DDDSLSINLFIPTINKSIYIIIGLRMKNFWKPKFEIE.
Q08FE4_DPV84/12-148             LNPFKNMKKIKINLDDNCLLGNRCFVKVGNVRYIPTNSIE....TSESIMIRGHKFTLLELLYSPFHFQQSQHQYILPGFILTCIEKAKRNKNICKYCITDRGD.GRDSLSINIFIQTIYTSVYIIIGLRIKYFWSSNFEIE.
Q8V533_MONPV/23-158             MKPFKNMNKITINQKDNCILANRCFVKIDTPRYIPSTSIS....SSNIIRIRNHDFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKVSKQQKECKYCISNRG-.DDDSLSINIFIPTINKSIYIIIGLRMKNFWKPKFEIE.
Q8V2W7_CAMPM/23-158             MKPFKNMNKITINQKDNCILANRCFVKIDTPRYIPSTSIS....SSNIIRIRNHDFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKVSKQQKECKYCISNRG-.DDDSLSINLFIPTINKSIYIIIGLRMKNFWKPKFEIE.
Q0N5A8_VARV/26-161              MKPFKNMNKITINQKDNCILANRCFVKIDTPRYIPLTSIS....SSNIIRIRNHDFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKVSKQQKECKYCISNRG-.DDDSLSINLFIPTINKSIYIIIGLRMKNFWKPKFEIE.
F15_VACCP/23-158                MKPFKNMNKITINQKDNCILAYRCFVKIDTPRYIPSTSIS....SSNIIRIRNHDFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKVSKQQKECKYCISNRG-.DDDSLSINLFIPTINKSIYIIIGLRMKNFWKPKFEIE.
F15_VACCW/12-147                MKPFKNMNKITINQKDNCILANRCFVKIDTPRYIPSTSIS....SSNIIRIRNHDFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKVSKQQKKCKYCISNRG-.DDDSLSINLFIPTINKSIYIIIGLRMKNFWKPKFEIE.
Q070K5_CPRVZ/12-148             LSPFNKSGYKRVSAD--CLCGNSCFVKLAEIKQMPRHAVTlrgaNQECVHRNGLKFSLYEILYSAFYYNRSYYQYVRPAFVLGAARAAVRSGQRAR--AVHYPT.GSYDLKLDLIFPTLQRRLHVIVGLRVKDYWRPVFVLE.
Q6VFS2_9POXV/12-149             LQPFRSMTKVKINSDGDCVLANRCFVKVSQVRAISRNAVT....TDETVRFRNHEFTLSELLFSLFHFQRPQFQYLLPGFVLSCIDEAARNNKTCHYCIVHRDNsDRHDLNLNVFVPTATNQLYVVIGLRIRSFWSATFEID.
O11314_MCV1/1-137               MQPFHDMDRVKINRKENCILGNRCFVKLAEVFHMPRCSVP....TSASLCANNHSFTLHELLYSPFHYKQPQYQYLLPSFVFTCIELARKNNQTCYYCKADRAN.EEGSLNLNIFVPTLARSMYVVIGIRIKDYWVEAFEI-v
Q8V3R7_SWPV1/12-148             MNPFRNMGKIKINEKDNCVLGNRCFVKIDKVRYIPDNCIP....TTSSIKIRGHEFTLRELLYSPFHFRQPQYQYLLPSFVLNCIDEAHTYNAISMYCISNNDT.KDDSLNINIFIPTKIKCIYLIIGLRIKYFWSSKFEIE.
G3EIB0_9POXV/12-148             LKPFKNMNKVTINQTDKCILANRCFVKLDKPRYIPHNKIT....ISKSIKINDHVLTLPELLYSPFHFQQPQFQYLLPGFVIHCINEAIKQQKECKYCVSNKDG.DNNSLNFNLFIPTTKESIYIIIGLRIKNFWKHKFEIE.
L7QJC8_9POXV/12-147             MKPFKNMNKITINQNDNCILANRCFVKIDTPRYIPSTSIS....SSNIIRIRNHDFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKVSKQQKECKYCISNRG-.DDDSLSINLFIPTINKSIYIIIGLRMKNFWKPKFEIE.
Q6TUY3_YMTV5/12-148             LNPFKNMNKVIINLNDNCVLGNRCFVKLDKVRCIPSNSVE....TSKPILIKGCKFTLPELLYSPFHFRRPQVQYLMPGFVLYCIEEAKKNKSESRYCIVDNDI.ETDELKINIFVPTFLKSVYVIIGLRVKHFWSSKFKIE.
B9U1C4_9POXV/23-158             MKPFKNMNKITINQKDNCILANRCFVKIDTPRYIPSTSIS....SSNIIRIRNHDFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKVSKQQKECKYCISNRG-.DDDSLSINLFIPTINKSIYIIIGLRMKNFWKPKFEIE.
Q1HTT4_9POXV/12-149             LQPFRSMTKVKINSDGDCVLANRCFVKVSQVRAIPRNAVT....TDETVRFRNHEFTLSELLFSLFHFQRPQVQYLLPGFVLSCIDEAARNNKTCHYCIVHRDNsDRHDLNLNVFVPTATNQLYVVIGLRIRSFWSATFEID.
H6TAJ5_9POXV/12-146             LNPFKHMGKAKINYTDNCILGNGCFIKIDNIRNISKKLVN....VRESIKIRNINFTLLDLLYSPFHFQQSQNQYLLPSFVLQSIETSMK-KNICKYYVNDLG-.NENGISIMIFIPTLIINKYIIIGLRLKKFWSVVFNIN.
#=GC seq_cons                   MKPFKNMNKITINQcDNCILANRCFVKIDTPRYIPosSIo....oSshIRIRNHDFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKsoKQQKcCKYCISNRG..DDDSLSINlFIPTINKSIYIIIGLRhKNFWKPKFEIE.
//
DBGET integrated database retrieval system