GenomeNet

Database: Pfam
Entry: Pox_F15
LinkDB: Pox_F15
Original site: Pox_F15 
#=GF ID   Pox_F15
#=GF AC   PF04596.10
#=GF DE   Poxvirus protein F15
#=GF AU   Mifsud W
#=GF SE   Pfam-B_5182 (release 7.5)
#=GF GA   25.00 25.00;
#=GF TC   170.60 170.40;
#=GF NC   20.50 20.40;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF DR   INTERPRO; IPR007675;
#=GF SQ   10
#=GS Q070K5_CPRVZ/12-148  AC Q070K5.1
#=GS F15_VACCW/12-147     AC Q80HX4.1
#=GS Q08FW4_DPV83/12-148  AC Q08FW4.1
#=GS Q98193_MCV1/12-148   AC Q98193.1
#=GS F15_VAR67/26-161     AC P33873.1
#=GS Q8V3R7_SWPV1/12-148  AC Q8V3R7.1
#=GS Q77PA4_MYXVL/12-148  AC Q77PA4.1
#=GS Q6TUY3_YMTV5/12-148  AC Q6TUY3.1
#=GS Q9Q947_RFVKA/12-148  AC Q9Q947.1
#=GS F15_FOWPN/12-147     AC Q9J5B5.1
Q070K5_CPRVZ/12-148             LSPFNKSGYKRVSAD--CLCGNSCFVKLAEIKQMPRHAVTlrgaNQECVHRNGLKFSLYEILYSAFYYNRSYYQYVRPAFVLGAARAAVRSGQRAR--AVHYPTGSYDLKLDLIFPTLQRRLHVIVGLRVKDYWRPVFVLE.
F15_VACCW/12-147                MKPFKNMNKITINQKDNCILANRCFVKIDTPRYIPSTSIS....SSNIIRIRNHDFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKVSKQQKKCKYCISNRG-DDDSLSINLFIPTINKSIYIIIGLRMKNFWKPKFEIE.
Q08FW4_DPV83/12-148             LNPFKNMKKIKINLDDNCLLGNRCFVKIGNVRYIPTNSIE....TSESIMIRGHKFTLLELLYSPFHFQQSQHQYILPGFILTCIEKAKRNKNICKYCITDRGDGQDSLNINIFIQTIYTSIYIIIGLRIKYFWSSNFEIE.
Q98193_MCV1/12-148              LQPFHDMDRVKINRKENCILGNRCFVKLAEVFHMPRCSVP....TSASLCANNHSFTLHELLYSPFHYKQPQYQYLLPSFVFTCIELARKNNQTCYYCKADRANEEGSLNLNIFVPTLARSMYVVIGIRIKDYWVEAFEI-v
F15_VAR67/26-161                MKPFKNMNKITINQKDNCILANRCFVKIDTPRYIPLTSIS....SSNIIRIRNHDFTLSELLYSPFHFQQPQFQYLLPGFVLTCIDKVSKQQKECKYCISNRG-DDDSLSINLFIPTINKSIYIIIGLRMKNFWKPKFEIE.
Q8V3R7_SWPV1/12-148             MNPFRNMGKIKINEKDNCVLGNRCFVKIDKVRYIPDNCIP....TTSSIKIRGHEFTLRELLYSPFHFRQPQYQYLLPSFVLNCIDEAHTYNAISMYCISNNDTKDDSLNINIFIPTKIKCIYLIIGLRIKYFWSSKFEIE.
Q77PA4_MYXVL/12-148             LNPFKHMNRIKINREEKCLLGSTSFIKIDKVKHIPGNAVN....VSKSIHVRGQDFTLSELLYSPLYFQQARGQCIMPHFVLKCIDEAKKNRMVCKYCTVTKSSDPQGLNANIFIPTKTESTYIIIGIRIKSYWSVTFRVE.
Q6TUY3_YMTV5/12-148             LNPFKNMNKVIINLNDNCVLGNRCFVKLDKVRCIPSNSVE....TSKPILIKGCKFTLPELLYSPFHFRRPQVQYLMPGFVLYCIEEAKKNKSESRYCIVDNDIETDELKINIFVPTFLKSVYVIIGLRVKHFWSSKFKIE.
Q9Q947_RFVKA/12-148             LNPFKHMNRIKINTEEKCLLGSTSFIKIDKVKHIPNNAVD....VSKSIRVRGQDFTLSELLYSPLYFQQARGQCIMPHFVIKCIDEAKKNRMVCKYCTVTKSSDPQGLNANIFIPTKTESIYIIVGIRIKSYWSVTFRVE.
F15_FOWPN/12-147                MNPFSDMENIVINEKEKCILGNRCFVKLSEVYNMPMCCID....TNQCLTMNRFKFSLNELLYTPFYYKQLQYQYLTPQFIFRCIQEANENNMSCYYCYTKKK-EHNGLNIDIFIPTANSKSYIVIGLRIKDFWKQSFKVN.
#=GC seq_cons                   LNPFKsMs+I+INpc-NClLGNRCFVKIDcV+aIPssuls....oSpsI+lRGacFTLsELLYSPFHFpQsQaQYLhPuFVLsCI-cA+KNpppC+YChss+us-ssuLNINIFIPThs+SlYIIIGLRIKsFWsssFcIE.
//
DBGET integrated database retrieval system