GenomeNet

Database: Pfam
Entry: Pox_TAP
LinkDB: Pox_TAP
Original site: Pox_TAP 
#=GF ID   Pox_TAP
#=GF AC   PF03355.11
#=GF DE   Viral Trans-Activator Protein 
#=GF AU   Finn RD
#=GF SE   Pfam-B_3956 (release 6.5)
#=GF GA   25.00 25.00;
#=GF TC   458.70 458.50;
#=GF NC   20.00 19.10;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 11927849 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   2344616
#=GF RT   Role of DNA replication in vaccinia virus gene expression: a
#=GF RT   naked template is required for transcription of three late
#=GF RT   trans-activator genes. 
#=GF RA   Keck JG, Baldick CJ Jr, Moss B; 
#=GF RL   Cell 1990;61:801-809.
#=GF DR   INTERPRO; IPR005022;
#=GF CC   These proteins function as a trans-activator of viral late 
#=GF CC   genes.
#=GF SQ   11
#=GS Q6TUV5_YMTV5/1-260  AC Q6TUV5.1
#=GS Q9Q8P3_MYXVL/1-260  AC Q9Q8P3.1
#=GS Q8V3N9_SWPV1/1-260  AC Q8V3N9.1
#=GS Q98235_MCV1/1-260   AC Q98235.1
#=GS VLTF1_VAR67/1-260   AC P32990.1
#=GS Q6TVS5_ORFSA/1-260  AC Q6TVS5.1
#=GS VLTF1_VACCW/1-260   AC P68613.1
#=GS Q08FT5_DPV83/1-260  AC Q08FT5.1
#=GS Q9Q918_RFVKA/1-260  AC Q9Q918.1
#=GS Q070H1_CPRVZ/1-258  AC Q070H1.1
#=GS VLTF1_FOWPN/1-260   AC P15908.1
Q6TUV5_YMTV5/1-260             MSLRIKIDKLRQIVAYFSEFSEEVSINVDASSNIMYIFAALGGSVNIWAMVPLSSSVFYEGENNKVFNLPVSKVKSCLCSFHNDAIIEIEPNIENDLVKLSSYHIVSVSCNKELMPIRTDTCISLKINQKKSYVFNFHKYDEKCCARTVIHLELLLGFIKCISQYQHLTVLFK.NDNIILKTPGNLDTFSREYSMTECSPDLQKFSFKMAIASLNKLRGFKKRVNVFETKIVMDNDDNVLGMLFSDRLQSFKINIFMSFQD
Q9Q8P3_MYXVL/1-260             MSLRIKIDKLRQITAYFSEFSEEVSINVDSGSHLMYIFAALGGSVNIWAIVPLSASVFYDGDTNMVFNLPVTKVKSCLCSFHNDSVIEIQPDLVNNTVTLSSYHIVSVDCNKELVPIRTDTSILLKINQSKSYIFNFHKYEEKCCARTVIHLELLLGFIKCISQYQYLTILFK.DDNLVFKTPGNLDTFSREYSTTECSQELQRFSFKMAIASLNKLRGFKKRVNVFETRIIMDKDDNVLGMLFSDRIQSFKINIFMAFQD
Q8V3N9_SWPV1/1-260             MSLRIKIDKLRQIVAYFSEFSEEVSINVDYSSNLMYVFAALGGSVNIWAIVPLSASVFYDGKNNQVFNLPVSKVKSCLCSFHNDAIIEIEPDIEHDLVKLSSYHVVSVDCNKELMPIRTDTCICLKIDQKKSYIFNFHKYEEKCCARTVIHLELLLGFIKCISQYQYLSILFR.NNNIVFKTPGNLDTFSREYSMTEYSPELQKFSFKMAIASLNKLRGFKKRVNVFETRIVMDKDDNVLGMLFSDRLPSFRINIFMSFHD
Q98235_MCV1/1-260              MSVRIKIDKLRQIVTYFSEFSEEVSVNVDARSELMYIFSTLGGAVNIWAIVPLNANVFYDGGENCVFNIPVLKIKSCLCSFHNDAVVTIEPDLQNDAVRLSSDHMVSVDCNHEPIPHRTGTVISLGIDQKKSYIFNFQRYEEKCCGRTVIHLELLLGFIKCISQYQYLSIGFA.DKNLVLKTPGTRDTFVRRYSMTEWSPALQAYSFKIAIFSLNKLRGFKKKVVMFETKIVMDADDNILGLLFRDRIGTYRVNVFMAFQD
VLTF1_VAR67/1-260              MSIRIKIDKLRQIVAYFSEFSEEVSINVDSTDELMYIFAALGGSVNIWAIIPLSASVFYRGAENIVFNLPVSKVKSCLCSFHNDAIIDIEPDLENNLVKLSSYHVVSVDCNKELMPIRTDTTICLSIDQKKSYVFNFHKYEEKCCGRTVIHLEWLLGFIKCISQHQHLTIMFK.DDNIIMKTPGNTDAFSREYSMTECSQELQKFSFKIAISSLNKLRGFKKRVNVFETRIVMDNDDNILGMLFSDRVQSFKINIFMAFLD
Q6TVS5_ORFSA/1-260             MTLRIKLEKLKQIVTYFSEFSEEVSVNVDVGDGLMYIFAALGGSVNIWTIVPLSASVVYDGDVSRVFNLPVLKVKACLCSFHPDSVVSLEPDLEDNVVRLSSHHVVSVDCDNEPVAHRTNTAICLGINQRKSYVFNFRRYEEKCCGRTIVNLDLLLGFIKCIHQYQYITVCFR.DKKMVLHTPGKVDNFFREYSMTEWAPDLERFSFKIPISSVNKLRGFKKRVVMFESRVVMDADDNIIGMLFTDRVGMYRVNVFMSFQD
VLTF1_VACCW/1-260              MSIRIKIDKLRQIVAYFSEFSEEVSINVDSTDELMYIFAALGGSVNIWAIIPLSASVFYRGAENIVFNLPVSKVKSCLCSFHNDAIIDIEPDLENNLVKLSSYHVVSVDCNKELMPIRTDTTICLSIDQKKSYVFNFHKYEEKCCGRTVIHLEWLLGFIKCISQHQHLAIMFK.DDNIIMKTPGNTDAFSREYSMTECSQELQKFSFKIAISSLNKLRGFKKRVNVFETRIVMDNDDNILGMLFSDRVQSFKINIFMAFLD
Q08FT5_DPV83/1-260             MSLRIKIEKLRQIVAYFSEFSEEVSINVDSNSNLMYIFAALGGSVNIWAIVPLSASVFYDGENNQVFNLPVSKVKACLCSFHNDAIIEIEPDFENDLIKLSSFHVVSVDCNRELMPLRTDTCISLKIDQKKSYIFNFHKYEEKCCARTVIHLELLLGFIKCISQYQYLTILFK.DDNIILRTPGNLDTFSREYSMTECSQELQKFSFKMAIASLNKLRGFKKRVNVFETRIVMDKDDNILGMLFSDRLPSFRINIFMSFQD
Q9Q918_RFVKA/1-260             MSLRIKIDKLRQITAYFSEFSEEVSINVDSGSHLMYIFAALGGSVNIWAIVPLSASVFYDGDTNMVFNLPVTKVKSCLCSFHNDSVIEIQPDLVNNTVTLSSYHIVSVDCNKELVPIRTDTSILLKINQSKSYIFNFHKYEEKCCARTVIHLELLLGFIKCISQYQYLTILFK.DDNLVFKTPGNLDTFSREYSTTECSQELQRFSFKMAIASLNKLRGFKKRVNVFETRIIMDKDDNVLGMLFSDRLQSFKINIFMAFQD
Q070H1_CPRVZ/1-258             MSLRIKLGKLKEIVSFFSEFSEEISLNVDRANSTLYIFSSL-GAVNIWSIVPIQSNIFCDGDVGFVFNVPVIKVKNCLSSFHHDSLVTLSAG--DGCVTLSGEHVVAVTIRDRNREHRTDTSISLSVGQDKFYIFNFLKYEEKCCARTIVSLDLLLGFIKSINNYQFLTVAVDgDCNLILRTPGSKDVFVMRYSTTECSDELQNYTFRVPICSLTKLKGFKKKISVFEMRVVMDVDSNILGMLFRERLGKDLINVFIPFCD
VLTF1_FOWPN/1-260              MSLRIKIDKLRQLVTYFSEFSEEVSINIDVKSNVLYIFATLGGSINIWTIVPLNSNVFYNGVENTVFNLPVLKVKNCLCSFHNDAVVSITADHDNNTVTLSSHYTVSIDCNNEQIPHSTGTSISLGIDQKKSYIFNFHKYEEKCCGRTVFHLDMLLGFIKCISQYQYLNICFD.DKKLLLKTPGTRDTFVRSYSMTEWSPTLQNYSFKIAIFSLNKLRGFKKRVLVFESKIVMDTEGNILGLLFRDRIGTYKVNVFMAFQD
#=GC seq_cons                  MSLRIKIDKLRQIVAYFSEFSEEVSINVDusSpLMYIFAALGGSVNIWAIVPLSASVFYDGcsNhVFNLPVoKVKSCLCSFHNDAlI-IEPDl-NshV+LSSaHlVSVDCN+ELhPlRTDTsIsLpIsQKKSYIFNFHKYEEKCCuRTVIHLELLLGFIKCISQYQYLTIhF+.DcNllhKTPGNhDTFSREYSMTECS.ELQ+FSFKhAIuSLNKLRGFKKRVNVFETRIVMDsDDNILGMLFSDRltSF+INIFMuFQD
//
DBGET integrated database retrieval system