GenomeNet

Database: Pfam
Entry: Pox_TAP
LinkDB: Pox_TAP
Original site: Pox_TAP 
#=GF ID   Pox_TAP
#=GF AC   PF03355.9
#=GF DE   Viral Trans-Activator Protein 
#=GF AU   Finn RD
#=GF SE   Pfam-B_3956 (release 6.5)
#=GF GA   25.00 25.00;
#=GF TC   245.00 244.90;
#=GF NC   19.50 19.10;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   2344616
#=GF RT   Role of DNA replication in vaccinia virus gene expression: a
#=GF RT   naked template is required for transcription of three late
#=GF RT   trans-activator genes. 
#=GF RA   Keck JG, Baldick CJ Jr, Moss B; 
#=GF RL   Cell 1990;61:801-809.
#=GF DR   INTERPRO; IPR005022;
#=GF CC   These proteins function as a trans-activator of viral late 
#=GF CC   genes.
#=GF SQ   56
#=GS Q6TUV5_YMTV5/1-260  AC Q6TUV5.1
#=GS Q0NPC2_9POXV/1-260  AC Q0NPC2.1
#=GS Q70H32_FOWPV/1-260  AC Q70H32.1
#=GS Q77HN3_MONPV/1-260  AC Q77HN3.1
#=GS E2CZU8_9POXV/1-260  AC E2CZU8.1
#=GS Q0NCQ0_VAR65/1-260  AC Q0NCQ0.1
#=GS G0XUM4_COWPX/1-260  AC G0XUM4.1
#=GS Q775V8_CAMPS/1-260  AC Q775V8.1
#=GS D3IZ61_9POXV/1-260  AC D3IZ61.1
#=GS Q77GD5_LSDV/1-260   AC Q77GD5.1
#=GS H6TA50_9POXV/1-259  AC H6TA50.1
#=GS VLTF1_FOWPN/1-260   AC P15908.1
#=GS D3IZJ2_9POXV/1-260  AC D3IZJ2.1
#=GS C5IJN3_9POXV/1-260  AC C5IJN3.1
#=GS Q5IXU7_MONPV/1-260  AC Q5IXU7.1
#=GS Q9Q8P3_MYXVL/1-260  AC Q9Q8P3.1
#=GS Q0GNZ8_HSPV/1-260   AC Q0GNZ8.1
#=GS VLTF1_VACCC/1-260   AC P68612.1
#=GS Q6VZH6_CNPV/1-260   AC Q6VZH6.1
#=GS Q8V3N9_SWPV1/1-260  AC Q8V3N9.1
#=GS Q76Q20_VARV/1-260   AC Q76Q20.1
#=GS VLTF1_VAR67/1-260   AC P32990.1
#=GS VLTF1_VACCW/1-260   AC P68613.1
#=GS O11325_MCV1/1-182   AC O11325.1
#=GS Q910J7_LSDV/1-260   AC Q910J7.1
#=GS A9J1P3_VACCA/1-260  AC A9J1P3.1
#=GS Q08FT5_DPV83/1-260  AC Q08FT5.1
#=GS Q77GM7_LSDV/1-260   AC Q77GM7.1
#=GS Q8QMX6_COWPX/1-260  AC Q8QMX6.1
#=GS B9U1G8_9POXV/1-260  AC B9U1G8.1
#=GS Q49QH7_9POXV/1-260  AC Q49QH7.1
#=GS Q98235_MCV1/1-260   AC Q98235.1
#=GS Q2F8D0_ORFV/1-260   AC Q2F8D0.1
#=GS Q8V2T7_CAMPM/1-260  AC Q8V2T7.1
#=GS VLTF1_VACCA/1-260   AC O57198.1
#=GS Q6RZL6_9POXV/1-260  AC Q6RZL6.1
#=GS Q0N575_VARV/1-260   AC Q0N575.1
#=GS Q1M1N3_9POXV/1-260  AC Q1M1N3.1
#=GS Q6TVS5_ORFSA/1-260  AC Q6TVS5.1
#=GS Q0NLY2_VAR66/1-260  AC Q0NLY2.1
#=GS G3EIE4_9POXV/1-260  AC G3EIE4.1
#=GS Q85380_VARV/1-260   AC Q85380.1
#=GS Q070H1_CPRV/1-258   AC Q070H1.1
#=GS A7XCH9_9POXV/1-260  AC A7XCH9.1
#=GS E3UUF7_9POXV/1-130  AC E3UUF7.1
#=GS B5A8Y9_ORFV/1-130   AC B5A8Y9.1
#=GS F1DJD1_MONPV/1-260  AC F1DJD1.1
#=GS F1DIT5_MONPV/1-260  AC F1DIT5.1
#=GS Q77ZC7_9POXV/1-260  AC Q77ZC7.1
#=GS B2CWG0_9POXV/1-260  AC B2CWG0.1
#=GS Q08FB5_DPV84/1-260  AC Q08FB5.1
#=GS Q0NG67_VAR46/1-260  AC Q0NG67.1
#=GS Q76QK3_COWPX/1-260  AC Q76QK3.1
#=GS Q9Q918_RFVKA/1-260  AC Q9Q918.1
#=GS Q6TVE3_9POXV/1-260  AC Q6TVE3.1
#=GS Q9DHQ5_YLDV/1-260   AC Q9DHQ5.1
Q6TUV5_YMTV5/1-260             MSLRIKIDKLRQIVAYFSEFSEEVSINVDASSNIMYIFAALGGSVNIWAMVPLSSSVFYEGENNKVFNLPVSKVKSCLCSFHNDAIIEIEPNIENDLVKLSSYHIVSVSCNKELMPIRTDTCISLKINQKKSYVFNFHKYDEKCCARTVIHLELLLGFIKCISQYQHLTVLFK.NDNIILKTPGNLDTFSREYSMTECSPDLQKFSFKMAIASLNKLRGFKKRVNVFETKIVMDNDDNVLGMLFSDRLQSFKINIFMSFQD.
Q0NPC2_9POXV/1-260             MSIRIKIDKLRQIVAYFSEFSEEVSINVDSTDELMYIFAALGGSVNIWAIIPLSASVFYRGAENIVFNLPVSKVKSCLCSFHNDAIIDIEPDLENNLVKLSSYHVVSVDCNKELMPIRTDTTICLSIDQKKSYVFNFHKYEEKCCGRTVIHLEWLLGFIKCISQHQHLAIMFK.DDNIIMKTPGNTDAFSREYSMTECSQELQKFSFKIAISSLNKLRGFKKRVNVFETRIVMDNDDNILGMLFSDRVQSFKINIFMAFLD.
Q70H32_FOWPV/1-260             MSLRIKIDKLRQLVTYFSEFSEEVSINIDVKSNVLYIFATLGGSINIWTIVPLNSNVFYNGVENTVFNLPVLKVKNCLCSFHNDAVVSITADHDNNTVTLSSHYTVSIDCNNEQIPHSTGTSISLGIDQKKSYIFNFHKYEEKCCGRTVFHLDMLLGFIKCISQYQYLNICFD.DKKLLLKTPGTRDTFVRSYSMTEWSPTLQNYSFKIAIFSLNKLRGFKKRVLVFESKIVMDTEGNILGLLFRDRIGTYKVNVFMAFQD.
Q77HN3_MONPV/1-260             MSIRIKIDKLRQIVAYFSEFSEEVSINVDSTDELMYIFAALGGSVNIWAIIPLSASVFYRGAENIVFNLPVSKVKSCLCSFHNDAIIDIEPDLENNLVKLSSYHVVSVDCNKELMPIRTDTTICLSIDQKKSYVFNFHKYEEKCCGRTVIHLEWLLGFIKCISQHQHLAIMFK.DDNIIMKTPGNTDAFSREYSMTECSQELQKFSFKIAISSLNKLRGFKKRVNVFETRIVMDNDDNILGMLFSDRVQSFKINIFMAFLD.
E2CZU8_9POXV/1-260             MSLRIKIDKLRQITAYFSEFSEEVSINVDSGSHLMYIFAALGGSVNIWAIVPLSASVFYDGDTNMVFNLPVTKVKSCLCSFHNDSVIEIQPDLVNNTVTLSSYHIVSVDCNKELVPIRTDTSILLKINQSKSYIFNFHKYEEKCCARTVIHLELLLGFIKCISQYQYLTILFK.DDNLVFKTPGNLDTFSREYSTTECSQELQRFSFKMAIASLNKLRGFKKRVNVFETRIIMDKDDNVLGMLFSNRIQSFKINIFMAFQD.
Q0NCQ0_VAR65/1-260             MSIRIKIDKLRQIVAYFSEFSEEVSINVDSTDELMYIFAALGGSVNIWAIIPLSASVFYRGAENIVFNLPVSKVKSCLCSFHNDAIIDIEPDLENNLVKLSSYHVVSVDCNKELMPIRTDTTICLSIDQKKSYVFNFHKYEEKCCGRTVIHLEWLLGFIKCISQHQHLTIMFK.DDNIIMKTPGNTDAFSREYSMTECSQELQKFSFKIAISSLNKLRGFKKRVNVFETRIVMDNDDNILGMLFSDRVQSFKINIFMAFLD.
G0XUM4_COWPX/1-260             MSIRIKIDKLRQIVAYFSEFSEEVSINVDSTDELMYIFAALGGSVNIWAIIPLSASVFYRGAENIVFNLPVSKVKSCLCSFHNDAIIDIEPDLENNLVKLSSYHVVSVDCNKELMPIRTDTTICLSIDQKKSYVFNFHKYEEKCCGRTVIHLEWLLGFIKCISHHQHLAIMFK.DDNIIMKTPGNTDAFSREYSMTECSQELQKFSFKIAISSLNKLRGFKKRVNVFETRIVMDNDDNILGMLFSDRVQSFKINIFMAFLD.
Q775V8_CAMPS/1-260             MSIRIKIDKLRQIVAYFSEFSEEVSINVDSTDELMYIFAALGGSVNIWAIIPLSASVFYRGAENIVFNLPVSKVKSCLCSFHNDAIIDIEPDLENNLVKLSSYHVVSVDCNKELMPIRTDTTICLSIDQKKSYVFNFHKYEEKCCGRTVIHLEWLLGFIKCISQHQHLVIMFK.DGNIIMKTPGNTDAFSREYSMTECSQELQKFSFKIAISSLNKLRGFKKRVNVFETRIVMDNDDNILGMLFSDRVQSFKINIFMAFLD.
D3IZ61_9POXV/1-260             MTLRIKLEKLKQIVTYFSEFSEEVSVNVDVADGLMYIFAALGGSVNIWTIVPLSASVVYDGEVSRVFNLPVLKVKACLCSFHPDSVVSLEPDLEDNVVRLSSHHVVSVDCENEPVAHRTNTSICLGINQRKSYVFNFRRYEEKCCGRTIVNLDLLLGFIKCIHQYQYITVCFR.DKKMVLHTPGKVDNFFREYSMTEWAPDLERFSFKIPIASVNKLRGFKKRVIMFEARVVMDSDDNIIGMLFTDRVGMYRVNVFMSFQD.
Q77GD5_LSDV/1-260              MSLRIKIDKLRQIVAYFSEFSEEVSINVDSNSNLMYIFAALGGSVNIWAIIPLSASVFYDGKNNQVFNIPVSKVKSCLCSFHNDAIIEIEPDIENNLIKLSSYHVVSVDCNKELMPIRTDTTISLKIDQKKSYIFNFHKYEEKCCGRTVIHLELLLGFIKCINQYQHLSILFK.NDNIILRTPGNLDTFSREYSMTECSQELQKFSFKMAISSLNKLRGFKKRVNVFETRIVMDKDDNVLGMLFSDRIPSFRINIFMAFHD.
H6TA50_9POXV/1-259             MGLRIKIDKLRQIVAYFSEFSEEVSINVDSSNKRMYIFAALGGSVNIWAIIPLSASIFYDGDDNKVFNLPVTKVKSCLCSFNNDTVIEIEPDIKNNLVTLSSHHIVGIDCNKKLVSIRTDTRISLKIDQQKSYIFNFNKYEEKCCGRTIIHLELLLGFIKCISQYQDLTIYFK.NNTMILKTPGNLDTFSREYTMTECSEELENFSFKIAISSLNKLRGFKKRVVVFETRIVMDNDDNVLGILFSDRVSSFHINIFMSF--l
VLTF1_FOWPN/1-260              MSLRIKIDKLRQLVTYFSEFSEEVSINIDVKSNVLYIFATLGGSINIWTIVPLNSNVFYNGVENTVFNLPVLKVKNCLCSFHNDAVVSITADHDNNTVTLSSHYTVSIDCNNEQIPHSTGTSISLGIDQKKSYIFNFHKYEEKCCGRTVFHLDMLLGFIKCISQYQYLNICFD.DKKLLLKTPGTRDTFVRSYSMTEWSPTLQNYSFKIAIFSLNKLRGFKKRVLVFESKIVMDTEGNILGLLFRDRIGTYKVNVFMAFQD.
D3IZJ2_9POXV/1-260             MTLRIKLEKLKQIVTYFSEFSEEVSVNVDVGDGFMYIFAALGGSVNIWTIVPLSASVVYDGEVSRVFNLPVLKVKACLCSFHPDSVVSLEPDLDDNVVRLSSHHVVSVDCENEPVAHRTNTSICLGINQRKSYVFNFRRYEEKCCGRTIVNLDLLLGFIKCIHQYQYITVCFR.DKKMVLHTPGKVDNFFREYSMTEWAPDLERFSFKIPIASVNKLRGFKKRVIMFEARVVMDSDDNIIGMLFTDRVGMYRVNVFMSFQD.
C5IJN3_9POXV/1-260             MSLRIKIDKLRQLVTYFSEFSEEVSINIDVKSNVLYIFATLGGSINIWTIVPLNSNVFYNGTENTVFNLPVLKVKNCLCSFHNDAVVSITADHDNNTVTLSSHYTVSIDCNNEQIPHSTGTSISLGIDQKKSYIFNFHKYEEKCCGRTVFHLDMLLGFIKCISQYQYLNICFD.DKKLLLKTPGTRDTFVRSYSMTEWSPTLQNYSFKIAIFSLNKLRGFKKRVLVFESKIVMDTEGNILGLLFRDKIGTYKVNVFMAFQD.
Q5IXU7_MONPV/1-260             MSIRIKIDKLRQIVAYFSEFSEEVSINVDSTDELMYIFAALGGSVNIWAIIPLSASVFYRGAENIVFNLPVSKVKSCLCSFHNDAIIDIEPDLENNLVKLSSYHVVSVDCNKELMPIRTDTTICLSIDQKKSYVFNFHKYEEKCCGRTVIHLEWLLGFIKCISQHQHLAIMFK.DDNIIMKTPGNTDAFSREYSMTECSQELQKFSFKIAISSLNKLRGFKKRVNVFETRIVMDNDDNILGMLFSDRVQSFKINIFMAFLD.
Q9Q8P3_MYXVL/1-260             MSLRIKIDKLRQITAYFSEFSEEVSINVDSGSHLMYIFAALGGSVNIWAIVPLSASVFYDGDTNMVFNLPVTKVKSCLCSFHNDSVIEIQPDLVNNTVTLSSYHIVSVDCNKELVPIRTDTSILLKINQSKSYIFNFHKYEEKCCARTVIHLELLLGFIKCISQYQYLTILFK.DDNLVFKTPGNLDTFSREYSTTECSQELQRFSFKMAIASLNKLRGFKKRVNVFETRIIMDKDDNVLGMLFSDRIQSFKINIFMAFQD.
Q0GNZ8_HSPV/1-260              MSIRIKIDKLRQIVAYFSEFSEEVSINVDSTDELMYIFAALGGSVNIWAIIPLSASVFYRGAENIVFNLPVSKVKSCLCSFHNDAIIDIEPNLENNLVKLSSYHVVSVDCNKELMPIRTDTTICLSIDQKKSYVFNFHKYEEKCCGRTVIHLEWLLGFIKCISQHQHLAIMFK.DDNIIMKTPGNTDAFSREYSMTECSQELQKFSFKIAISSLNKLRGFKKRVNVFETRIVMDNDDNILGMLFSDRVQSFKINIFMAFLD.
VLTF1_VACCC/1-260              MSIRIKIDKLRQIVAYFSEFSEEVSINVDSTDELMYIFAALGGSVNIWAIIPLSASVFYRGAENIVFNLPVSKVKSCLCSFHNDAIIDIEPDLENNLVKLSSYHVVSVDCNKELMPIRTDTTICLSIDQKKSYVFNFHKYEEKCCGRTVIHLEWLLGFIKCISQHQHLAIMFK.DDNIIMKTPGNTDAFSREYSMTECSQELQKFSFKIAISSLNKLRGFKKRVNVFETRIVMDNDDNILGMLFSDRVQSFKINIFMAFLD.
Q6VZH6_CNPV/1-260              MSLRIKIDKLRQLVTYFSEFSEEVSINIDVKSNVLYIFATLGGSINIWTIVPLNSNVFYNGSENYVFNLPVLKVKNCLCSFHNDAVVSITADHEHNTVTLTSHYTVSIDCNNEQIPHNTGTSISLGIDQKKSYIFNFNKYEEKCCGRTVFHLDMLLGFIKCISQYQYLNVCFD.DKKLVLKTPGTRDTFVRSYSMTEWSPALQNYSFKIAIFSLNKLRGFKKRVLVFESKIVMDAEGNILGLLFRDKIGTYKVNVFMAFQD.
Q8V3N9_SWPV1/1-260             MSLRIKIDKLRQIVAYFSEFSEEVSINVDYSSNLMYVFAALGGSVNIWAIVPLSASVFYDGKNNQVFNLPVSKVKSCLCSFHNDAIIEIEPDIEHDLVKLSSYHVVSVDCNKELMPIRTDTCICLKIDQKKSYIFNFHKYEEKCCARTVIHLELLLGFIKCISQYQYLSILFR.NNNIVFKTPGNLDTFSREYSMTEYSPELQKFSFKMAIASLNKLRGFKKRVNVFETRIVMDKDDNVLGMLFSDRLPSFRINIFMSFHD.
Q76Q20_VARV/1-260              MSIRIKIDKLRQIVAYFSEFSEEVSINVDSTDELMYIFAALGGSVNIWAIIPLSASVFYRGAENIVFNLPVSKVKSCLCSFHNDAIIDIEPDLENNLVKLSSYHVVSVDCNKELMPIRTDTTICLSIDQKKSYVFNFHKYEEKCCGRTVIHLEWLLGFIKCISQHQHLTIMFK.DDNIIMKTPGNTDAFSREYSMTECSQELQKFSFKIAISSLNKLRGFKKRVNVFETRIVMDNDDNILGMLFSDRVQSFKINIFMAFLD.
VLTF1_VAR67/1-260              MSIRIKIDKLRQIVAYFSEFSEEVSINVDSTDELMYIFAALGGSVNIWAIIPLSASVFYRGAENIVFNLPVSKVKSCLCSFHNDAIIDIEPDLENNLVKLSSYHVVSVDCNKELMPIRTDTTICLSIDQKKSYVFNFHKYEEKCCGRTVIHLEWLLGFIKCISQHQHLTIMFK.DDNIIMKTPGNTDAFSREYSMTECSQELQKFSFKIAISSLNKLRGFKKRVNVFETRIVMDNDDNILGMLFSDRVQSFKINIFMAFLD.
VLTF1_VACCW/1-260              MSIRIKIDKLRQIVAYFSEFSEEVSINVDSTDELMYIFAALGGSVNIWAIIPLSASVFYRGAENIVFNLPVSKVKSCLCSFHNDAIIDIEPDLENNLVKLSSYHVVSVDCNKELMPIRTDTTICLSIDQKKSYVFNFHKYEEKCCGRTVIHLEWLLGFIKCISQHQHLAIMFK.DDNIIMKTPGNTDAFSREYSMTECSQELQKFSFKIAISSLNKLRGFKKRVNVFETRIVMDNDDNILGMLFSDRVQSFKINIFMAFLD.
O11325_MCV1/1-182              ------------------------------------------------------------------------------CSFHNDAVVTIEPDLENDAVRLSSDHMVSVDCNHEPIPHRTGTVISLGIDQKKSYIFNFQRYEEKCCGRTVIHLELLLGFIKCISQYQYLSIGFA.DKNLVLKTPGTRDTFVRRYSMTEWSPALQAYSFKIAIFSLNKLRGFKKKVVMFETKIVMDADDNILGLLFRDRIGTYRVNVFMAFQD.
Q910J7_LSDV/1-260              MSLRIKIDKLRQIVAYFSEFSEEVSINVDSNSNLMYIFAALGGSVNIWAIIPLSASVFYDGKNNQVFNIPVSKVKSCLCSFHNDAIIEIEPDIENNLIKLSSYHVVSVDCNKELMPIRTDTTISLKIDQKKSYIFNFHKYEEKCCGRTVIHLELLLGFIKCINQYQHLSILFK.NDNIILRTPGNLDTFSREYSMTECSQELQKFSFKMAISSLNKLRGFKKRVNVFETRIVMDKDDNVLGMLFSDRIPSFRINIFMAFHD.
A9J1P3_VACCA/1-260             MSIRIKIDKLRQIVAYFSEFSEEVSINVDSTDELMYIFAALGGSVNIWAIIPLSASVFYRGAENIVFNLPVSKVKSCLCSFHNDAIIDIEPDLENNLVKLSSYHVVSVDCNKELMPIRTDTTICLSIDQKKSYVFNFHKYEEKCCGRTVIHLEWLLGFIKCISQHQHLAIMFK.DDNIIMKTPGNTDAFSREYSMTECSQELQKFSFKIAISSLNKLRGFKKRVNVFETRIVMDNDDNILGMLFSDRVQSFKINIFMAFLD.
Q08FT5_DPV83/1-260             MSLRIKIEKLRQIVAYFSEFSEEVSINVDSNSNLMYIFAALGGSVNIWAIVPLSASVFYDGENNQVFNLPVSKVKACLCSFHNDAIIEIEPDFENDLIKLSSFHVVSVDCNRELMPLRTDTCISLKIDQKKSYIFNFHKYEEKCCARTVIHLELLLGFIKCISQYQYLTILFK.DDNIILRTPGNLDTFSREYSMTECSQELQKFSFKMAIASLNKLRGFKKRVNVFETRIVMDKDDNILGMLFSDRLPSFRINIFMSFQD.
Q77GM7_LSDV/1-260              MSLRIKIDKLRQIVAYFSEFSEEVSINVDSNSNLMYIFAALGGSVNIWAIIPLSASVFYDGKNNQVFNIPVSKVKSCLCSFHNDAIIEIEPDIENNLIKLSSYHVVSVDCNKELMPIRTDTTISLKIDQKKSYIFNFHKYEEKCCGRTVIHLELLLGFIKCINQYQHLSILFK.NDNIILRTPGNLDTFSREYSMTECSQELQKFSFKMAISSLNKLRGFKKRVNVFETRIVMDKDDNVLGMLFSDRIPSFRINIFMAFHD.
Q8QMX6_COWPX/1-260             MSIRIKIDKLRQIVAYFSEFSEEVSINVDSTDELMYIFAALGGSVNIWAIIPLSASVFYRGAENIVFNLPVSKVKSCLCSFHNDAIIDIEPDLENNLVKLSSYHVVSVDCNKELMPIRTDTTICLSIDQKKSYVFNFHKYEEKCCGRTVIHLEWLLGFIKCISQHQHLAIMFK.DDNIIMRTPGNTDAFSREYSMTECSQELQKFSFKIAISSLNKLRGFKKRVNVFETRIVMDNDDNILGMLFSDRVQSFKINIFMAFLD.
B9U1G8_9POXV/1-260             MSIRIKIDKLRQIVAYFSEFSEEVSINVDSTDELMYIFAALGGSVNIWAIIPLSASVFYRGAENIVFNLPVSKVKSCLCSFHNDAIIDIEPDLENNLVKLSSYHVVSVDCNKELMPIRTDTTICLSIDQKKSYVFNFHKYEEKCCGRTVIHLEWLLGFIKCISQHQHLAIMFK.DDNIIMKTPGNTDAFSREYSMTECSQELQKFSFKIAISSLNKLRGFKKRVNVFETRIVMDNDDNILGMLFSDRVQSFKINIFMAFLD.
Q49QH7_9POXV/1-260             MSIRIKIDKLRQIVAYFSEFSEEVSINVDSTDELMYIFAALGGSVNIWAIIPLSASVFYRGAENIVFNLPVSKVKSCLCSFHNDAIIDIEPDLENNLVKLSSYHVVSVDCNKELMPIRTDTTICLSIDQKKSYVFNFHKYEEKCCGRTVIHLEWLLGFIKCISQHQHLAIMFK.DDNIIMKTPGNTDAFSREYSMTECSQELQKFSFKIAISSLNKLRGFKKRVNVFETRIVMDNDDNILGMLFSDRVQSFKINIFMAFLD.
Q98235_MCV1/1-260              MSVRIKIDKLRQIVTYFSEFSEEVSVNVDARSELMYIFSTLGGAVNIWAIVPLNANVFYDGGENCVFNIPVLKIKSCLCSFHNDAVVTIEPDLQNDAVRLSSDHMVSVDCNHEPIPHRTGTVISLGIDQKKSYIFNFQRYEEKCCGRTVIHLELLLGFIKCISQYQYLSIGFA.DKNLVLKTPGTRDTFVRRYSMTEWSPALQAYSFKIAIFSLNKLRGFKKKVVMFETKIVMDADDNILGLLFRDRIGTYRVNVFMAFQD.
Q2F8D0_ORFV/1-260              MTLRIKLEKLKQIVTYFSEFSEEVSVNVDVGDGLMYIFAALGGSVNIWTIVPLSASVVYDGDVSRVFNLPVLKVKACLCSFHPDSVVSLEPDLEDNVVRLSSHHVVSVDCDNEPVAHRTNTAICLGINQRKSYVFNFRRYEEKCCGRTIVNLDLLLGFIKCIHQYQYITVCFR.DKKMVLHTPGKVDNFFREYSMTEWAPDLERFSFKIPISSVNKLRGFKKRVVMFESRVVMDADDNIIGMLFTDRVGMYRVNVFMSFQD.
Q8V2T7_CAMPM/1-260             MSIRIKIDKLRQIVAYFSEFSEEVSINVDSTDELMYIFAALGGSVNIWAIIPLSASVFYRGAENIVFNLPVSKVKSCLCSFHNDAIIDIEPDLENNLVKLSSYHVVSVDCNKELMPIRTDTTICLSIDQKKSYVFNFHKYEEKCCGRTVIHLEWLLGFIKCISQHQHLVIMFK.DGNIIMKTPGNTDAFSREYSMTECSQELQKFSFKIAISSLNKLRGFKKRVNVFETRIVMDNDDNILGMLFSDRVQSFKINIFMAFLD.
VLTF1_VACCA/1-260              MSIRIKIDKLRQIVAYFSEFSEEVSINVDSTDELMYIFAALGGSVNIWAIIPLSASVFYRGAENIVFNLPVSKVKSCLCSFHNDAIIDIEPDLENNLVKLSSYHVVSVDCNKELMPIRTDTTICLSIDQKKSYVFNFHKYEEKCCGRTVIHLEWLLGFIKCISQHQHLAIMFK.DDNIIMKTPGNTDAFSREYSMTECSQELQKFSFKIAISSLNKLRGFKKRVNVFETRIVMDNDDNILGMLFSDRVQSFKINIFMTFLD.
Q6RZL6_9POXV/1-260             MSIRIKIDKLRQIVAYFSEFSEEVSINVDSTDELMYIFAALGGSVNIWAIIPLSASVFYRGAENIVFNLPVSKVKSCLCSFHNDAIIDIEPDLENNLVKLSSYHVVSVDCNKELMPIRTDTTICLSIDQKKSYVFNFHKYEEKCCGRTVIHLEWLLGFIKCISQHQHLAIMFK.DDNIIMKTPGNTDAFSREYSMTECSQELQKFSFKIAISSLNKLRGFKKRVNVFETRIVMDNDDNILGMLFSDRVQSFKINIFMAFLD.
Q0N575_VARV/1-260              MSIRIKIDKLRQIVAYFSEFSEEVSINVDSTDELMYIFAALGGSVNIWAIIPLSASVFYRGAENIVFNLPVSKVKSCLCSFHNDAIIDIEPDLENNLVKLSSYHVVSVDCNKELMPIRTDTTICLSIDQKKSYVFNFHKYEEKCCGRTVIHLEWLLGFIKCISQHQHLTIMFK.DDNIIMKTPGNTDAFSREYSMTECSQELQKFSFKIAISSLNKLRGFKKRVNVFETRIVMDNDDNILGMLFSDRVQSFKINIFMAFLD.
Q1M1N3_9POXV/1-260             MSIRIKIDKLRQIVAYFSEFSEEVSINVDSTDELMYIFAALGGSVNIWAIIPLSASVFYRGAENIVFNLPVSKVKSCLCSFHNDAIIDIEPDLKNNLVKLSSYHVVSVDCNKELMPIRTDTTICLSIDQKKSYVFNFHKYEEKCCGRTVIHLEWLLGFIKCISQHQHLAIMFK.DDNIIMKTPGNTDAFSREYSMTECSQELQKFSFKIAISSLNKLRGFKKRVNVFETRIVMDNDDNILGMLFSDRVQSFKINIFMAFLD.
Q6TVS5_ORFSA/1-260             MTLRIKLEKLKQIVTYFSEFSEEVSVNVDVGDGLMYIFAALGGSVNIWTIVPLSASVVYDGDVSRVFNLPVLKVKACLCSFHPDSVVSLEPDLEDNVVRLSSHHVVSVDCDNEPVAHRTNTAICLGINQRKSYVFNFRRYEEKCCGRTIVNLDLLLGFIKCIHQYQYITVCFR.DKKMVLHTPGKVDNFFREYSMTEWAPDLERFSFKIPISSVNKLRGFKKRVVMFESRVVMDADDNIIGMLFTDRVGMYRVNVFMSFQD.
Q0NLY2_VAR66/1-260             MSIRIKIDKLRQIVAYFSEFSEEVSINVDSTDELMYIFAALGGSVNIWAIIPLSASVFYRGAENIVFNLPVSKVKSCLCSFHNDAIIDIEPDLENNLVKLSSYHVVSVDCNKELMPIRTDTTICLSIDQKKSYVFNFHKYEEKCCGRTVIHLEWLLGFIKCISQHQHLTIMFK.DDNIIMKTPGNTDAFSREYSMTECSQELQKFSFKIAISSLNKLRGFKKRVNVFETRIVMDNDDNILGMLFSDRVQSFKINIFMAFLD.
G3EIE4_9POXV/1-260             MSIRIKIDKLRQIVAYFSEFSEEVSINVDSSDGLMYIFAALGGSVNIWAIIPLSASVFYCGAENIVFNLPVSKVKSCLCSFHNDAIIDIEPDLDNDVVKLSSYHIVSVDCNRELMPIRTDTIISLSIDQKKSYVFNFHKYEEKCCGRTVIHLEWLLGFIKCISQHQHLAIMFK.NDNIIMKTPGTSDSFSREYSMTECSEALQKFSFKMAISSFNKLRGFKKRVNVFETRIVMDNDDNILGMLFSDRIQSFKINIFMSFLD.
Q85380_VARV/1-260              MSIRIKIDKLRQIVAYFSEFSEEVSINVDSTDELMYIFAALGGSVNIWAIIPLSASVFYRGAENIVFNLPVSKVKSCLCSFHNDAIIDIEPDLENNLVKLSSYHVVSVDCNKELMPIRTDTTICLSIDQKKSYVFNFHKYEEKCCGRTVIHLEWLLGFIKCISQHQHLTIMFK.DDNIIMKTPGNTDAFSREYSMTECSQELQKFSFKIAISSLNKLRGFKKRVNVFETRIVMDNDDNILGMLFSDRVQSFKINIFMACLD.
Q070H1_CPRV/1-258              MSLRIKLGKLKEIVSFFSEFSEEISLNVDRANSTLYIFSSL-GAVNIWSIVPIQSNIFCDGDVGFVFNVPVIKVKNCLSSFHHDSLVTLSAG--DGCVTLSGEHVVAVTIRDRNREHRTDTSISLSVGQDKFYIFNFLKYEEKCCARTIVSLDLLLGFIKSINNYQFLTVAVDgDCNLILRTPGSKDVFVMRYSTTECSDELQNYTFRVPICSLTKLKGFKKKISVFEMRVVMDVDSNILGMLFRERLGKDLINVFIPFCD.
A7XCH9_9POXV/1-260             MSLRIKIDKLRQIVAYFSEFSEEVSINVDASSNLMYIFAALGGSVNIWAIVPLSSSVFYEGEKNKVFNLPVSKVKSCLCSFHNDAIIEIEPNIDNDLVKLSSYHIVSVNCNKELMPIRTDTCISLKINQKKSYVFNFHKYDEKCCARTVIHLELLLGFIKCISQYQHLTVLFK.NDNIILKTPGNLDTFSREYSMTECSPDLQKFSFKMAIASLNKLRGFKKRVNVFETKIVMDNDDNVLGMLFSDRLQSFRINIFMSFQD.
E3UUF7_9POXV/1-130             ---------------YFSEFSEEVSVNVDVADGLMYIFAALGGSVNIWTIVPLSASVVYDGEVSRVFNLPVLKVKACLCSFHPDSVVSLEPDLEDNVVRLSSHHVVSVDCENEPVAHRTNTSICLGINQRKSYVFNFRRYEEKCC----------------------------.---------------------------------------------------------------------------------------.
B5A8Y9_ORFV/1-130              ---------------YFSEFSEEVSVNVDVGDGLMYIFAALGGSVNIWTIVPLSASVVYDGDVSRVFNLPVLKVKACLCSFHPDSVVSLEPDLEDNVVRLSSHHVVSVDCDNEPVAHRTNTAICLGINQRKSYVFNFRRYEEKCC----------------------------.---------------------------------------------------------------------------------------.
F1DJD1_MONPV/1-260             MSIRIKIDKLRQIVAYFSEFSEEVSINVDSTXELMYIFAXLGGSVNIWAIIPLSASVFYRGAENIVFNLPVSKVKSCLCSFHNDAIIDIEPDLENNLVKLSSYHVVSVDCNKELMPIRTDTTICLSIDQKKSYVFNFHKYEEKCCGRTVIHLEWLLGFIKCISQHQHLAIMFK.DDNIIMKTPGNTDAFSREYSMTECSQELQKFSFKIAISSLNKLRGFKKRVNVFETRIVMDNDDNILGMLFSDRVQSFKINIFMAFLD.
F1DIT5_MONPV/1-260             MSIRIKIDKLRQIVAYFSEFSEEVSINVDSTDELMYIFAXLGGSVNIWAIIPLSASVFYRGAENIVFNLPVSKVKSCLCSFHNDAIIDIEPDLENNLVKLSSYHVVSVDCNKELMPIRTDTTICLSIDQKKSYVFNFHKYEEKCCGRTVIHLEWLLGFIKCISQHQHLAIMFK.DDNIIMKTPGNTDAFSREYSMTECSQELQKFSFKIAISSLNKLRGFKKRVNVFETRIVMDNDDNILGMLFSDRVQSFKINIFMAFLD.
Q77ZC7_9POXV/1-260             MSIRIKIDKLRQIVAYFSEFSEEVSINVDSTDELMYIFAALGGSVNIWAIIPLSASVFYRGAENIVFNLPVSKVKSCLCSFHNDAIIDIEPDLENNLVKLSSYHVVSVDCNKELMPIRTDTTICLSIDQKKSYVFNFHKYEEKCCGRTVIHLEWLLGFIKCISQHQHLAIMFK.DDNIIMKTPGNTDAFSREYSMTECSQELQKFSFKIAISSLNKLRGFKKRVNVFETRIVMDNDDNILGMLFSDRVQSFKINIFMAFLD.
B2CWG0_9POXV/1-260             MSLRIKIDKLRQITAYFSEFSEEVSINVDSGSHLMYIFAALGGSVNIWAIVPLSASVFYDGDTNMVFNLPVTKVKSCLCSFHNDSVIEIQPDLVNNTVTLSSYHIVSVDCNKELVPIRTDTSILLKINQSKSYIFNFHKYEEKCCARTVIHLELLLGFIKCISQYQYLTILFK.DDNLVFKTPGNLDTFSREYSTTECSQELQRFSFKMAIASLNKLRGFKKRVNVFETRIIMDKDDNVLGMLFSDRIQSFKINIFMAFQD.
Q08FB5_DPV84/1-260             MSLRIKIEKLRQIVAYFSEFSEEVSINVDSNSNLMYIFAALGGSVNIWAIVPLSASVFYDGKNNQVFNLPVSKVKACLCSFHNDAIIEIEPDFENDLIKLSSFHVVSVDCNRELMPLRTDTCISLKIDQKKSYIFNFHKYEEKCCARTVIHLELLLGFIKCISQYQYLTILFK.DDNIILRTPGNLDTFSREYSMTECSQELQKFSFKMAIASLNKLRGFKKRVNVFETRIVMDKDDNVLGMLFSDRLPSFRINIFMSFQD.
Q0NG67_VAR46/1-260             MSIRIKIDKLRQIVAYFSEFSEEVSINVDSTDELMYIFAALGGSVNIWAIIPLSASVFYRGAENIVFNLPVSKVKSCLCSFHNDAIIDIEPDLENNLVKLSSYHVVSVDCNKELMPIRTDTTICLSIDQKKSYVFNFHKYEEKCCGRTVIHLEWLLGFIKCISQHQHLTIMFK.DDNIIMKTPGNTDAFSREYSMTECSQELQKFSFKIAISSLNKLRGFKKRVNVFETRIVMDNDDNILGMLFSDRVQSFKINIFMAFLD.
Q76QK3_COWPX/1-260             MSIRIKIDKLRQIVAYFSEFSEEVSINVDSTDELMYIFAALGGSVNIWAIIPLSASVFYRGAENIVFNLPVSKVKSCLCSFHNDAIIDIEPDLENNLVKLSSYHVVSVDCNKELMPIRTDTTICLSIDQKKSYVFNFHKYEEKCCGRTVIHLEWLLGFIKCISQHQHLAIMFK.DDNIIMKTPGNTDAFSREYSMTECSQELQKFSFKIAISSLNKLRGFKKRVNVFETRIVMDNDDNILGMLFSDRVQSFKINIFMAFLD.
Q9Q918_RFVKA/1-260             MSLRIKIDKLRQITAYFSEFSEEVSINVDSGSHLMYIFAALGGSVNIWAIVPLSASVFYDGDTNMVFNLPVTKVKSCLCSFHNDSVIEIQPDLVNNTVTLSSYHIVSVDCNKELVPIRTDTSILLKINQSKSYIFNFHKYEEKCCARTVIHLELLLGFIKCISQYQYLTILFK.DDNLVFKTPGNLDTFSREYSTTECSQELQRFSFKMAIASLNKLRGFKKRVNVFETRIIMDKDDNVLGMLFSDRLQSFKINIFMAFQD.
Q6TVE3_9POXV/1-260             MALRIKLEKLKQIVTYFSEFSEEVSVNVDVADGLMYIFAALGGSVNIWTIIPLSASVVYDGEVSRVFNVPVLKVKSCLCSFHPDSVVCLEPDLEDNVIRLSSHHVVSVDCENEPIAHRTNTSICLGINQRKSYVFNFRRYEEKCCGRTIVNLDLLLGFIKCIHQYQYITVCFR.DKKMVLHTPGKVDNYFREYSMTEWAPDLERFSFKIPISSINKLRGFKKRVVMFEARVVMDADDNIIGMLFTDRVGVYRVNVFMSFQD.
Q9DHQ5_YLDV/1-260              MSLRIKIDKLRQIVAYFSEFSEEVSINVDASSNLMYIFAALGGSVNIWAIVPLSSSVFYEGEKNKVFNLPVSKVKSCLCSFHNDAIIEIEPNIDNDLVKLSSYHIVSVNCNKELMPIRTDTCISLKINQKKSYVFNFHKYDEKCCARTVIHLELLLGFIKCISQYQHLTVLFK.NDNIILKTPGNLDTFSREYSMTECSPDLQKFSFKMAIASLNKLRGFKKRVNVFETKIVMDNDDNVLGMLFSDRLQSFRINIFMSFQD.
#=GC seq_cons                  MSlRIKIDKLRQIVAYFSEFSEEVSINVDSsDpLMYIFAALGGSVNIWAIlPLSASVFYcGs-NhVFNLPVSKVKSCLCSFHNDAII-IEPDLENNLVKLSSYHVVSVDCNKELMPIRTDToICLuIDQKKSYVFNFHKYEEKCCGRTVIHLEhLLGFIKCISQaQHLsIhFK.DDNIIhKTPGNpDsFSREYSMTECSQELQKFSFKIAISSLNKLRGFKKRVNVFETRIVMDsDDNILGMLFSDRlQSFKINIFMAF.D.
//
DBGET integrated database retrieval system