GenomeNet

Database: Pfam
Entry: Pox_VP8_L4R
LinkDB: Pox_VP8_L4R
Original site: Pox_VP8_L4R 
#=GF ID   Pox_VP8_L4R
#=GF AC   PF04498.8
#=GF DE   Poxvirus nucleic acid binding protein VP8/L4R
#=GF AU   Kerrison ND
#=GF SE   DOMO:DM04340;
#=GF GA   25.00 25.00;
#=GF TC   27.60 178.20;
#=GF NC   21.80 19.20;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 80369284 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   9321647
#=GF RT   Vaccinia virion protein VP8, the 25 kDa product of the L4R gene,
#=GF RT   binds single-stranded DNA and RNA with similar affinity. 
#=GF RA   Bayliss CD, Smith GL; 
#=GF RL   Nucleic Acids Res 1997;25:3984-3990.
#=GF DR   INTERPRO; IPR007586;
#=GF CC   The 25 kDa product of Vaccinia virus gene L4R is also known as
#=GF CC   VP8.  VP8 is found in the cores of Vaccinia virions and is
#=GF CC   essential for the formation of transcriptionally competent viral
#=GF CC   particles.  It binds both single stranded and double stranded
#=GF CC   DNA and RNA with similar affinities.  Binding is thought to
#=GF CC   involve cooperative interactions between protein subunits. The
#=GF CC   protein is proteolytically cleaved during viral assembly at an
#=GF CC   Ala-Gly-Ala site. Possible roles for VP8 include packaging and
#=GF CC   maintaining the DNA genome in a transcribable configuration;
#=GF CC   binding ssDNA during transcription initiation; and cooperation
#=GF CC   with I8R protein to unwind early promoter regions.  VP8 may also
#=GF CC   function in either transcription elongation or release of mRNA
#=GF CC   molecules from viral particles [1].
#=GF SQ   64
#=GS Q9Q8N8_MYXVL/33-248  AC Q9Q8N8.1
#=GS Q9DHQ0_YLDV/33-248   AC Q9DHQ0.1
#=GS Q8JLD8_9POXV/33-248  AC Q8JLD8.1
#=GS Q98241_MCV1/31-250   AC Q98241.1
#=GS Q0NCP5_VAR65/33-248  AC Q0NCP5.1
#=GS M9WED0_9POXV/33-248  AC M9WED0.1
#=GS U3UBJ3_9POXV/33-249  AC U3UBJ3.1
#=GS Q6TUV0_YMTV5/33-249  AC Q6TUV0.1
#=GS Q6RZL1_9POXV/33-248  AC Q6RZL1.1
#=GS E2CZV3_9POXV/33-248  AC E2CZV3.1
#=GS G3EIE9_9POXV/33-248  AC G3EIE9.1
#=GS W5U3P1_ORFV/32-249   AC W5U3P1.1
#=GS I0AZF0_9POXV/33-248  AC I0AZF0.1
#=GS Q89214_VARV/33-248   AC Q89214.1
#=GS Q5IXU2_MONPV/33-248  AC Q5IXU2.1
#=GS Q08FT0_DPV83/33-249  AC Q08FT0.1
#=GS Q0NLX7_VAR66/33-248  AC Q0NLX7.1
#=GS Q0N570_VARV/33-248   AC Q0N570.1
#=GS Q0GNZ3_HSPV/33-248   AC Q0GNZ3.1
#=GS A7XCI6_9POXV/33-248  AC A7XCI6.1
#=GS Q49PP2_9POXV/33-248  AC Q49PP2.1
#=GS T2ATN1_9POXV/33-248  AC T2ATN1.1
#=GS H6TA55_9POXV/35-250  AC H6TA55.1
#=GS Q8V4Z9_MONPV/33-248  AC Q8V4Z9.1
#=GS A9J1Q2_VACCA/33-248  AC A9J1Q2.1
#=GS Q6TW50_ORFV/32-249   AC Q6TW50.1
#=GS D3IZJ7_9POXV/32-249  AC D3IZJ7.1
#=GS D3IZ66_9POXV/32-249  AC D3IZ66.1
#=GS Q8QMX2_COWPX/33-248  AC Q8QMX2.1
#=GS Q08FB0_DPV84/33-249  AC Q08FB0.1
#=GS Q76TT4_9POXV/31-250  AC Q76TT4.1
#=GS Q0NEF6_VARV/33-248   AC Q0NEF6.1
#=GS Q6TVS0_ORFSA/32-249  AC Q6TVS0.1
#=GS VP8_VACCC/33-248     AC P20981.1
#=GS B2CWG5_9POXV/33-248  AC B2CWG5.1
#=GS L7QJ25_9POXV/33-248  AC L7QJ25.1
#=GS G0XX33_COWPX/33-248  AC G0XX33.1
#=GS O11328_MCV1/1-126    AC O11328.1
#=GS Q2F8C5_ORFV/32-249   AC Q2F8C5.1
#=GS Q070F8_CPRVZ/31-240  AC Q070F8.1
#=GS Q9Q913_RFVKA/33-248  AC Q9Q913.1
#=GS Q77TK7_VACCT/33-248  AC Q77TK7.1
#=GS Q6VZH1_CNPV/31-251   AC Q6VZH1.1
#=GS G0XUM9_COWPX/33-248  AC G0XUM9.1
#=GS Q76RD0_9POXV/33-248  AC Q76RD0.1
#=GS Q6TVD8_9POXV/31-247  AC Q6TVD8.1
#=GS VP8_VACCW/33-248     AC P03295.1
#=GS K4JL49_9POXV/33-248  AC K4JL49.1
#=GS VP8_VAR67/33-248     AC P33039.1
#=GS Q0NG62_VAR46/33-248  AC Q0NG62.1
#=GS Q0NPB7_9POXV/33-248  AC Q0NPB7.1
#=GS Q8V3N4_SWPV1/34-250  AC Q8V3N4.1
#=GS G0XVV8_COWPX/33-248  AC G0XVV8.1
#=GS Q775V4_CAMPS/33-248  AC Q775V4.1
#=GS Q91MU5_LSDV/33-250   AC Q91MU5.1
#=GS Q8V2T2_CAMPM/33-248  AC Q8V2T2.1
#=GS Q77GD3_LSDV/33-250   AC Q77GD3.1
#=GS Q77GM4_LSDV/33-250   AC Q77GM4.1
#=GS Q1M1M8_9POXV/33-248  AC Q1M1M8.1
#=GS VP8_FOWPN/32-252     AC P15913.1
#=GS B9U1H3_9POXV/33-248  AC B9U1H3.1
#=GS Q76Q15_VARV/33-248   AC Q76Q15.1
#=GS F1AX34_ORFV/32-249   AC F1AX34.1
#=GS Q70H27_FOWPV/32-252  AC Q70H27.1
Q9Q8N8_MYXVL/33-248             .AKLKYPRSFLSIFNIVPRNMTRYELDLVQTENITGAVFTTVFNIKKNLGILE.EKLTIEAIENYYLDPNNDVLTLMIDNTSLKEI..-SPRKKSRR.TKNPVLFRQGSIPLFFIFESRKKVDIYKENV.NKAVDGSYIKIDDNVALMGKYANMSLLDVHSPSAFMKLNAVYGF.THKNELRKLVSDKEIEEYSGQP.LQEPVRLNDFIGLFDGVKKSIPLTSI-p
Q9DHQ0_YLDV/33-248              .AKVKYPRSFLSIFNIIPRNMTKYELDLVQTENITGAVFTTAFNIKKNLGMGD.EKLTIEAIEGYYLDPNNDILTLMINNTSLSEV..-VPKRKSKR.NKNPVLFRQGSVPLFFIFESRKKVEIYKENM.ESQKDSSYSQINENIALISKYSNMHLLDIHSPSAFMKLNGVYGF.THKNELRKLSSNKEIEEYSNKP.LQEPVRLNDFINLFDCVKKNIPLTNVI.
Q8JLD8_9POXV/33-248             .AKSKFPRSMLSIFNIVPRTMSKYELVLIHNENITGAMFTTMYNIRNNLGLGD.DKLTIEAIENYFLDPNNEVMPLIINNTDMTAV..-IPKKSGRRkNKNMVIFRQGSSPILCIFETRKKINIYKENM.-ESAATEYTPIGDNKALISKYAGINILNVYSPSTSMRLNAIYGF.TNKNKLEKLSTNKELESYSSSP.LQEPIRLNDFLGLLECVKKNIPLTDI-p
Q98241_MCV1/31-250              .AKVKFPRSLLSMYRVVPRTMSRYELALVQSETVTGVVFTTVYNVRRNLGLEErEALSLPALEKYYLDKANDVLTLMVNNTNLEHI..AAYRMRSRR.LLNPVVFRAGAVPLALVFTSRKKLSIYREDTsQAAEDSTYTKIAANVALAGKYAGLLLLDVHTPGTALMLTAVYGL.DDRRELRKLADSTALENHQQSGaLSEAMKLSDFRAVFEGLKKSVPLTNL-e
Q0NCP5_VAR65/33-248             .AKSKFPRSMLSIFNIVPRTMSKYELELIHNENITGAMFTTMYNIRNNLGLGD.DKLTIEAIENYFLDPNNEVMPLIINNTDMTAV..-IPKKSGRRkNKNMVIFRQGSSPILCIFETRKKINIYKENM.-ESASTEYTPIGDNKALISKYAGINVLNVYSPSTSMRLNAIYGF.TNKNKLEKLSTNKELELYSSSP.LQEPIRLNDFLGLLECVKKNIPLTDI-p
M9WED0_9POXV/33-248             .AKSKFPRSMLSIFNIVPRTMSKYELELIHNENITGAMFTTMYNIRNNLGLGD.DKLTIEAIENYFLDPNNEVMPLIINNTDMTAV..-IPKKSGRRkNKNMVIFRQGSSPILCIFETRKKINIYKENM.-ESASTEYTPIGDNKALISKYAGINILNVYSPSTSMRLNAIYGF.TNKNKLEKLSTNKELESYSSSP.LQEPIRLNDFLGLLECVKKNIPLTDI-p
U3UBJ3_9POXV/33-249             s-RTKYPRSFLSLFNIVPRTMTRYALELVNTEAITGAAFTTAYNVRRNLGLGE.EPLRIDCLTSYYLDPSNEVLTLMTNNTSLDAV..TTVKRRGRR.VRNPVVFRQGSVPLLLIFESRKKMGVYREDVsKPAADNAYTAIGDNVVLASKYAGLNLLDVHSPSNSMTLSAVYGV.KE-GELHKLSNDKELTEYQKSA.LKDPIRMDEFNNLFESVKKSIPLTNI-s
Q6TUV0_YMTV5/33-249             .AKVRYPRSFLSIFNIIPRNMTKYELELVQTENITGAVFTTAFNIKKNLGMND.ENLTIEAIEGYYLDPNNDILTLMINNTSLMEV..-VPKRKSKR.NKNPVLFRQGSVPLFFIFESRKKVDIYKENIeNKKDSTSYSQIDENIALISKYSNMQLLDVHSPSAFMKLNGVYGF.THKNELRKLSSNKEIEEYSNKP.LQEPVRLNDFINLFDCVKKNIPLTNVI.
Q6RZL1_9POXV/33-248             .AKSKFPRSMLSIFNIVPRTMSKYELELIHNENITGAMFTTMYNIRNNLGLGD.DKLTIEAIENYFLDPNNEVMPLIINNTDMTAV..-IPKKSGRRkNKNMVIFRQGSSPILCIFETRKKINIYKENM.-ESASTEYTPIGDNKALISKYAGINVLNVYSPSTSMRLNAIYGF.TNKNKLEKLSTNKELESYSSSP.LQEPIRLNDFLGLLECVKKNIPLTDI-p
E2CZV3_9POXV/33-248             .AKLKYPRSFLSIFNIVPRNMTRYELDLVQTENITGVVFTTVFNIKKNLGILE.EKLTIEAIENYYLDPNNDVLTLMIDNTSLKEI..-SPRKKSRR.TKNPVLFRQGSIPLFFIFESRKKVDIYKENV.NKAVDGSYIKIDDNVALMGKYANMSLLDVHSPSAFMKLNAVYGF.THKNELRKLVSDKEIEEYSGQP.LQEPVRLNDFIGLFDGVKKSIPLTSI-p
G3EIE9_9POXV/33-248             .AKAKYPRSMLSIFNIVPRTMSKYNMEMIQNENITGAVFTTMYNVRNNIGLGN.DKLTIETIENYFLDPNNEVMSLIINNTDMSAV..-IPKKRSRKqNKNMVIFRQGSSPILCIFETRKKINIYKEDV.-SSSNNDYMPIGDNKAVISKYAGISILNVYSPSVSLRLNAIYGF.TNKNKVEKLSTNKELESYSDNP.LQEPIRLNDFIKLVESVKKSIPLIDI-p
W5U3P1_ORFV/32-249              .ARVRFPRSLLSLFNVVPRTMTRYETELVGTEMVVGAVFTTAYNVRRNLGLGE.EPVTMRDIEKYFLDSENEVLTLIVHNTDFSAM.sGVRRRGGRR.IANPVIFRSGSTPLLIVMESRKKTNIYRERT.AEQANASYREVGSSLALVTRYAGLQLVDVHTPSSVLTVSAVYGF.TEDKGLKKLGSDKELADYQSTP.LTDPIRLSDFSNIFDGVKKSIQLTNV-p
I0AZF0_9POXV/33-248             .AKSKFPRSMLSIFNIVPRTMSKYELVLIHNENITGAMFTTMYNIRNNLGLGD.DKLTIEAIENYFLDPNNEVMPLIINNTDMTAV..-IPKKSGRRkNKNMVIFRQGSSPILCIFETRKKINIYKENM.-ESAATEYTPIGDNKALISKYAGINTLNVYSPSTSMRLNAIYGF.TNKNKLEKLSTNKELESYSSSP.LQEPIRLNDFLGLLECVKKNIPLTDI-p
Q89214_VARV/33-248              .AKSKFPRSMLSIFNIVPRTMSKYELELIHNENITGAMFTTMYNIRNNLGLGD.DKLTIEAIENYFLDPNNEVMSLIINNTDMTAV..-IPKKSGRRkNKNMVIFRQGSSPILCIFETRKKINIYKENM.-ESASTEYTPIGDNKALISKYAGINVLNVYSPSTSMRLNAIYGF.TNKNKLEKLSTNKELESYSSSP.LQEPIRLNDFLGLLECVKKNIPLTDI-p
Q5IXU2_MONPV/33-248             .AKSKFPRSMLSIFNIVPRTMSKYELELIHNENITGAMFTTMYNIRNNLGLGD.DKLTIEAIENYFLDPNNEVMPLIINNTDMTTV..-IPKKSGRRkNKNMVIFRQGSSPILCIFETRKKINIYKENM.-ESVSTEYTPIGDNKALISKYAGINILNVYSPSTSMRLNAIYGF.TNKNKLEKLSTNKELESYSSSP.LQEPIRLNDFLGLLECVKKNIPLTDI-p
Q08FT0_DPV83/33-249             .AKVKYPRSFLSIFNIIPRNMTKYELELVQTENITGAVFSTAFNIKKNLGITD.EKLTIEAIESYYLDPNNDVLTLMINNTSLDGV..-TPRKRSRR.NKNPVLFRQGSVPLFCIFDSRKKIGVYRENMnSPSKDNSYMQIEDNVALINKYANMSLLDVHSPSASMKLNAVYGF.THKNELRKLVSNKEIEEYSRKP.LQEPVRLNDFIGLFDSVKKNIPLTNI-p
Q0NLX7_VAR66/33-248             .AKSKFPRSMLSIFNIVPRTMSKYELELIHNENITGAMFTTMYNIRNNLGLGD.DKLTIEAIENYFLDPNNEVMSLIINNTDMTAV..-IPKKSGRRkNKNMVIFRQGSSPILCIFETRKKINIYKENM.-ESASTEYTPIGDNKALISKYAGINVLNVYSPSTSMRLNAIYGF.TNKNKLEKLSTNKELESYSSSP.LQEPIRLNDFLGLLECVKKNIPLTDI-p
Q0N570_VARV/33-248              .AKSKFPRSMLSIFNIVPRTMSKYELELIHNENITGAMFTTMYNIRNNLGLGD.DKLTIEAIENYFLDPNNEVMPLIINNTDMTAV..-IPKKSGRRkNKNMVIFRQGSSPILCIFETRKKINIYKENM.-ESASTEYTPIGDNKALISKYAGINVLNVYSPSTSMRLNAIYGF.TNKNKLEKLSTNKELELYSSSP.LQEPIRLNDFLGLLECVKKNIPLTDI-p
Q0GNZ3_HSPV/33-248              .AKSKFPRSMLSIFNIVPRTMSKYELELIHNENITGAMFTTMYNIRNNLGLGD.DKLTIEAIENYFLDPNNEVMPLIINNTDMTAV..-IPKKSGRRkNKNMVIFRQGSSPILCIFETRKKINIYKENM.-ESASTEYTPIGDNKALISKYAGINILNVYSPSTSIRLNAIYGF.TNKNKLEKLSTNKELESYSSSP.LQEPIRLNDFLGLLECIKKNIPLTDI-p
A7XCI6_9POXV/33-248             .AKVKYPRSFLSIFNIIPRNMTKYELDLVQTENITGAVFTTAFNIKKNLGMGD.EKLTIEAIEGYYLDPNNDILTLMINNTSLSEV..-VPKRKSKR.NKNPVLFRQGSVPLFFIFESRKKVEIYKENM.ESQKDSSYSQINENIALISKYSNMHLLDIHSPSAFMKLNGVYGF.THKNELRKLSSNKEIEEYSNKP.LQEPVRLNDFINLFDCVKKNIPLTNVI.
Q49PP2_9POXV/33-248             .AKSKFPRSMLSIFNIVPRTMSKYELELIHNENITGAMFTTMYNIRNNLGLGD.DKLTIEAIENYFLDPNNEVMPLIINNTDMTAV..-IPKKSGRRkNKNMVIFRQGSSPILCIFETRKKINIYKENM.-ESASTEYTPIGDNKALISKYAGINVLNVYSPSTSIRLNAIYGF.TNKNKLEKLSTNKELESYSSSP.LQEPIRLNDFLGLLECVKKNIPLTDI-p
T2ATN1_9POXV/33-248             .AKLKYPRSFLSIFNIVPRNMTRYELDLVQTENITGAVFTTVFNIKKNLGILE.EKLTIEAIENYYLDPNNDVLTLMIDNTSLKEI..-SPRKKSRR.TKNPVLFRQGSIPLFFIFESRKKVDIYKENV.NKAVDGSYIKIDDNVALMGKYANMSLLDVYSPSAFMKLNAVYGF.THKNELRKLVSDKEIEEYSGHP.LQEPVRLNDFIGLFDGVKKSIPLTSI-p
H6TA55_9POXV/35-250             .AKIKYPRSFLSIFNIIPRNVTKYELELVQNDNITGAVFTTAFNIKKNLGITD.DKLTIEAIENYYLDPNNDVLTLMTNNTTLDGI..-TPRKKSRR.NKNPVLFRQGSVPLFFIFESRKRVDIYRENM.NKQNDNSYVQIDDNIALISKYSNMTLLDVHSPSASMKLNAVYGF.THKNELKKLSTNKEIDEYSKKT.LQEPVRLNDFTGLFDCIKKNIPLTSI-p
Q8V4Z9_MONPV/33-248             .AKSKFPRSMLSIFNIVPRTMSKYELELIHNENITGAMFTTMYNIRNNLGLGD.DKLTIEAIENYFLDPNNEVMPLIINNTDMTTV..-IPKKSGRRkNKNMVIFRQGSSPILCIFETRKKINIYKENM.-ESVSTEYTPIGDNKALISKYAGINILNVYSPSTSMRLNAIYGF.TNKNKLEKLSTNKELESYSSSP.LQEPIRLNDFLGLLECVKKNIPLTDI-p
A9J1Q2_VACCA/33-248             .AKSKFPRSMLSIFNIVPRTMSKYELELIHNENITGAMFTTMYNIRNNLGLGD.DKLTIEAIENYFLDPNNEVMPLIINNTDMTAV..-IPKKSGRRkNKNMVIFRQGSSPILCIFETRKKINIYKENM.-ESASTEYTPIGDNKALISKYAGINVLNVYSPSTSMRLNAIYGF.TNKNKLEKLSTNKELESYSSSP.LQEPIRLNDFLGLLECVKKNIPLTDI-p
Q6TW50_ORFV/32-249              .ARVRFPRSLLSLFNVVPRTMTRYETELVGTEMVVGAVFTTAYNVRRNLGLGE.EPVTMRDIEKYFLDSENEVLTLIVHNTDFSAM.sGVRRRGGRR.IANPVIFRSGSTPLLIVMESRKKTNIYRERT.AEQANASYREVGSSLALVTRYAGLQLVDVHTPSSVLTVSAVYGF.TEDKGLKKLGSDKELADYQSTP.LTDPIRLSDFSNIFDGVKKSIQLTNV-p
D3IZJ7_9POXV/32-249             .ARVRFPRSLLSLFNVVPRTMTRYETELVGTEMVVGAIFTTAYNIRRNLGLGE.EPVTMRDIEKYFLDSENEVLTLVVHNTDFSTM.tGIRRRGGRR.IANPVIFRSGSTPLLIVMESRKKTNIYRERT.ADPANASYKEVGSSLALVTRYAGLQLVDVHTPSAVLTVSAIYGF.TEDKGLKKLGSDKELAEYQSAP.LTDPIRLGDFSKLFDGVKKSIQLTNV-p
D3IZ66_9POXV/32-249             .ARVRFPRSLLSLFNVVPRTMTRYETELVGTEMVVGAIFTTAYNIRRNLGLGE.EPVTMRDIEKYFLDSENEVLTLVVHNTDFSTM.tGIRRRGGRR.IANPVIFRSGSTPLLIVMESRKKTNIYRERT.ADPANASYKEVGSSLALVTRYAGLQLVDVHTPSAVLTVSAIYGF.TEDKGLKKLGSDKELAEYQSAP.LTDPIRLSDFSKLFDGVKKSIQLTNV-p
Q8QMX2_COWPX/33-248             .AKSKFPRSMLSIFNIVPRTMSKYELELIHNENITGAMFTTMYNIRNNLGLGD.DKLTIEAIENYFLDPNNEVMPLIINNTDMTAV..-IPKKSGRRkNKNMVIFRQGSSPILCIFETRKKINIYKENM.-ESASTEYTPIGDNKALISKYAGINILNVYSPSTSMRLNAIYGF.TNKNKLEKLSTNKELESYSSSP.LQEPIRLNDFLGLLECVKKNIPLTDI-p
Q08FB0_DPV84/33-249             .AKVKYPRSFLSIFNITPRNMTKYELELVQTENITGAVFSTAFNIKKNLGITD.EKLTIEAIESYYLDPNNDVLTLMINNTSLDGV..-TPRKRSRR.NKNPVLFRQGSVPLFCIFDSRKKIGVYRENMnSPSKDNSYMQIEDNVALINKYANMSLLDVHSPSASMKLNAVYGF.THKNELRKLVSNKEIEEYSRKP.LQEPVRLNDFIGLFDSVKKNIPLTNI-p
Q76TT4_9POXV/31-250             .AKVKFPRSLLSMYRVVPRTMSRYELALVQSETVTGVVFTTVYNVRRNLGLEErEALSLPALEKYYLDKANDVLTLMVNNTNLEHI..AAYRMRSRR.LLNPVVFRAGAVPLALVFTSRKKLSIYREDTsQAAEDSTYTKIAANVALAGKYAGLLLLDVHTPGTALMLTAVYGL.DDRRELRKLADSTALENHQQSGaLSEAMKLSDFRAVFEGLKKSVPLTNL-e
Q0NEF6_VARV/33-248              .AKSKFPRSMLSIFNIVPRTMSKYELELIHNENITGAMFTTMYNIRNNLGLGD.DKLTIEAIENYFLDPNNEVMPLIINNTDMTAV..-IPKKSGRRkNKNMVIFRQGSSPILCIFETRKKINIYKENM.-ESASTEYTPIGDNKALISKYAGINVLNVYSPSTSMRLNAIYGF.TNKNKLEKLSTNKELESYSSSP.LQEPIRLNDFLGLLECVKKNIPLTDI-p
Q6TVS0_ORFSA/32-249             .ARVRFPRSLLSLFNVVPRTMTRYETELVGTEMVVGAVFTTAYNIRRNLGLGE.DPVTMRDIEKYFLDSDNEVLTLIVHNTDFSAM.sGVRRRGGRR.ITNPVIFRSGSTPLLIVMESRKKTNIYRERT.AEQANASYREVGSSLALVTRYAGLQLVDVHTPSSVLTVSAVYGF.TEDKGLKKLGSDKELADYQSTP.LTDPIRLSDFSKLFDGVKKSIQLTNV-p
VP8_VACCC/33-248                .AKSKFPRSMLSIFNIVPRTMSKYELELIHNENITGAMFTTMYNIRNNLGLGD.DKLTIEAIENYFLDPNNEVMPLIINNTDMTAV..-IPKKSGRRkNKNMVIFRQGSSPILCIFETRKKINIYKENM.-ESASTEYTPIGDNKALISKYAGINVLNVYSPSTSMRLNAIYGF.TNKNKLEKLSTNKELESYSSSP.LQEPIRLNDFLGLLECVKKNIPLTDI-p
B2CWG5_9POXV/33-248             .AKLKYPRSFLSIFNIVPRNMTRYELDLVQTENITGAVFTTVFNIKKNLGILE.EKLTIEAIENYYLDPNNDVLTLMIDNTSLKEI..-SPRKKSRR.TKNPVLFRQGSIPLFFIFESRKKVDIYKENV.NKAVDGSYIKIDDNVALMGKYANMSLLDVHSPSAFMKLNTVYGF.THKNELRKLVSDKEIEEYSGQP.LQEPVRLNDFIGLFDGVKKSIPLTSI-p
L7QJ25_9POXV/33-248             .AKSKFPRSMLSIFNIVPRTMSKYELELIHNENITGAMFTTMYNIRNNLGLGD.DKLTIEAIENYFLDPNNEVMPLIINNTDMTAV..-IPKKSGRRkNKNMVIFRQGSSPILCIFETRKKINIYKENM.-ESASTEYTPIGDNKALISKYAGINILNVYSPSTSIRLNAIYGF.TNKNKLEKLSTNKELESYSSSP.LQEPIRLNDFLGLLECVKKNIPLTDI-p
G0XX33_COWPX/33-248             .AKSKFPRSMLSIFNIVPRTMSKYELALIHNENITGAMFTTMYNIRNNLGLGD.DKLTIEAIENYFLDPNNEVMPLIINNTDMTAV..-IPKKSGRRkNKNMVIFRQGSSPILCIFETRKKINIYKENM.-ESAATEYTPIGDNKALISKYAGINILNVYSPSTSMRLNAIYGF.TNKNKLEKLSTNKELESYSSSP.LQEPIRLNDFLGLLECVKKNIPLTDI-p
O11328_MCV1/1-126               .----------------------------------------------------.-------LEKYYLDKANDVLTLMVNNTNLEHI..AAYRMRSRR.LLNPVVFRAGAVPLALVFTSRKKLSIYREDTsQAAEDSTYTKIAANVALAGKYAGLLLLDVHTPGTALMLTAVYGL.DDRRELRKLADSTALE------.---------------------------.
Q2F8C5_ORFV/32-249              .ARVRFPRSLLSLFNVVPRTMTRYETELVGTEMVVGAVFTTAYNVRRNLGLGE.EPVTMRDIEKYFLDSENEVLTLIVHNTDFSAM.sGVRRRGGRR.IANPVIFRSGSTPLLIVMESRKKTNIYRERT.AEQANASYREVGSSLALVTRYAGLQLVDVHTPSSVLTVSAVYGF.TEDKGLKKLGSDKELADYQSTP.LTDPIRLSDFSNIFDGVKKSIQLTNV-p
Q070F8_CPRVZ/31-240             .AKLRYPKSFLSIYRVVPRNTSKYRLRKLATETLVGFAMTTMESVRKSLNV--.TTATAQQVEEYFLD--NDVVTLAVGNTDVSKL..GSYKKRSRA.-KNPVVYRKSSAPVLLVFRSKNKMDVMIEDR.-EETTGTYARHEAG-AVVNTYLQTNFIDVYDPADQLTLDAVYGVpGSDLSLVKM-EGKALEKYQVTG.IQESITLSEFKELFSSAKKNIGVSNFI.
Q9Q913_RFVKA/33-248             .AKLKYPRSFLSIFNIVPRNMTRYELDLVQTENITGAVFTTVFNIKKNLGILE.EKLTIEAIENYYLDPNNDVLTLMIDNTSLNEI..-SPRKKSKR.TKNPVLFRQGSIPLFFIFESRKKVDIYKENV.NKAVDGSYIKIDDNVALMGKYANMSLLDVHSPSAFMKLNAVYGF.THKNELRKLVSDKEIEEYSNHP.LQEPVRLNDFIGLFDGVKKSIPLTSI-p
Q77TK7_VACCT/33-248             .AKSKFPRSMLSIFNIVPRTMSKYELELIHNENITGAMFTTMYNIRNNLGLGD.DKLTIEAIENYFLDPNNEVMPLIINNTDMTAV..-IPKKSGRRkNKNMVIFRQGSSPILCIFETRKKINIYKENM.-ESASTEYTPIGDNKALISKYAGINILNVYSPSTSIRLNAIYGF.TNKNKLEKLSTNKELESYSSSP.LQEPIRLNDFLGLLECVKKNIPLTDI-p
Q6VZH1_CNPV/31-251              .AKYKFPKSLLSIYKIVPKIMTRYPMKLLTNESISGVVITTVYNLKKNLSIPEkTKLTKQDIEKYYLDKNIEVLNLMISNTSVEDLacGRQRRKRTAkRKEPVIFLGVSAPIIVLMTSKKAVNTYVQDK.ESDPSTDYVNITPGIAVLENYGNTRLLDVHNPSAVLTVSAVYGL.DSNMELKKLSTVAEMENYQNTN.IGKPIDLKKFTEIFSTIKKHLSLSNF-t
G0XUM9_COWPX/33-248             .AKSKFPRSMLSIFNIVPRTMSKYELELIHNENITGAMFTTMYNIRNNLGLGD.DKLTIEAIENYFLDPNNEVMPLIINNTDMTAV..-IPKKSGRRkNKNMVIFRQGSSPILCIFETRKKINIYKENM.-ESASTEYTPIGDNKALISKYAGINILNVYSPSTSMRLNAIYGF.TNKNKLEKLSTNKELESYSSSP.LQEPIRLNDFLGLLECVKKNIPLTDI-p
Q76RD0_9POXV/33-248             .AKSKFPRSMLSIFNIVPRTMSKYELELIHNENITGAMFTTMYNIRNNLGLGD.DKLTIEAIENYFLDPNNEVMPLIINNTDMTAV..-IPKKSGRRkNKNMVIFRQGSSPILCIFETRKKINIYKENM.-ESASTEYTPIGDNKALISKYAGINVLNVYSPSTSMRLNAIYGF.TNKNKLEKLSTNKELESYSSSP.LQEPIRLNDFLGLLECVKKNIPLTDI-p
Q6TVD8_9POXV/31-247             .ARVRFPRSLLSLFHVVPRTMTRYETELVGTEMLVGAIFSTAYNVRRNLGLGE.EPVTMRDLERYFLDSENEVLTLVVNNTDFSNL..SGVKKRGRR.IPNPVIFRSGSIPILMVLESRKKVNIYRERT.DEQANSSYKEVGSNLAIVTRYAGLQLVDVHTPSSMLTVSAVYGV.TEDKALKKIGNDKELADYQSTP.LSDPIRLSDFTKLFDGVKKSIQLTNV-p
VP8_VACCW/33-248                .AKSKFPRSMLSIFNIVPRTMSKYELELIHNENITGAMFTTMYNIRNNLGLGD.DKLTIEAIENYFLDPNNEVMPLIINNTDMTAV..-IPKKSGRRkNKNMVIFRQGSSPILCIFETRKKINIYKENM.-ESASTEYTPIGDNKALISKYAGINILNVYSPSTSIRLNAIYGF.TNKNKLEKLSTNKELESYSSSP.LQEPIRLNDFLGLLECVKKNIPLTDI-p
K4JL49_9POXV/33-248             .AKLKYPRSFLSIFNIVPRNMTRYELDLVQTENITGAVFTTVFNIKKNLGILE.EKLTIEAIENYYLDPNNDVLTLMIDNTSLKEI..-SPRKKSRR.TKNPVLFRQGSIPLFFIFESRKKVDIYKENV.NKAVDGSYIKIDDNVALMGKYANMSLLDVHSPSAFMKLNAVYGF.THKNELRKLVSDKEIEEYSGQP.LQEPVRLNDFIGLFDGVKKSIPLTSI-p
VP8_VAR67/33-248                .AKSKFPRSMLSIFNIVPRTMSKYELELIHNENITGAMFTTMYNIRNNLGLGD.DKLTIEAIENYFLDPNNEVMPLIINNTDMTAV..-IPKKSGRRkNKNMVIFRQGSSPILCIFETRKKINIYKENM.-ESASTEYTPIGDNKALISKYAGINVLNVYSPSTSMRLNAIYGF.TNKNKLEKLSTNKELELYSSSP.LQEPIRLNDFLGLLECVKKNIPLTDI-p
Q0NG62_VAR46/33-248             .AKSKFPRSMLSIFNIVPRTMSKYELELIHNENITGAMFTTMYNIRNNLGLGD.DKLTIEAIENYFLDPNNEVMPLIINNTDMTAV..-IPKKSGRRkNKNMVIFRQGSSPILCIFETRKKINIYKENM.-ESASTEYTPIGDNKALISKYAGINVLNVYSPSTSMRLNAIYGF.TNKNKLEKLSTNKELESYSSSP.LQEPIRLNDFLGLLECVKKNIPLTDI-p
Q0NPB7_9POXV/33-248             .AKSKFPRSMLSIFNIVPRTMSKYELELIHNENITGAMFTTMYNIRNNLGLGD.DKLTIEAIENYFLDPNNEVMPLIINNTDMTAV..-IPKKSGRRkNKNMVIFRQGSSPILCIFETRKKINIYKENM.-ESASTEYTPIGDNKALISKYAGINVLNVYSPSTSMRLNAIYGF.TNKNKLEKLSTNKELESYSSSP.LQEPIRLNDFLGLLECVKKNIPLTDI-p
Q8V3N4_SWPV1/34-250             .AKIKYPRSFLSIFNIIPRNMTRYSLDLIQTENITGAVFTTVFNIKKNLGMTD.ENLTIEAIENYYLDPNNDVITLMINNTSLDFI..-NPRKKSRR.NKNPVLFRQGSVPLFFIFDSRKKVEIYKENIdKMNENNTYTKINDNIALAGKYANLSLLDVHSPSASMKLNAVYGF.THKNELRKLSSDKEIEEYSKKP.LQEPVRLNDFIGLFDCVKKNIPLTNI-p
G0XVV8_COWPX/33-248             .AKSKFPRSMLSIFNIVPRTMSKYELELIHNENITGAMFTTMYNIRNNLGLGD.DKLTIEAIENYFLDPNNEVMPLIINNTDMTAV..-IPKKSGRRkNKNMVIFRQGSSPILCIFETRKKINIYKENM.-ESASTEYTPIGDNKALISKYAGINVLNVYSPSTSMRLNAIYGF.TNKNKLEKLSTNKELESYSSSP.LQEPIRLNDFLGLLECVKKNIPLTDI-p
Q775V4_CAMPS/33-248             .AKSKFPRSMLSIFNIVPRTMSKYELELIHNENITGAMFTTMYNIRNNLGLGD.DKLTIEAIENYFLDPNNEVMPLIINNTDMTAV..-IPKKSGRRkNKNMVIFRQGSSPILCIFETRKKINIYKENM.-ESASTEYTPIGDNKALISKYAGINVMNVYSPSTSMRLNAIYGF.TNKNKLEKLSTNKELESYSSSP.LQEPIRLNDFLGLFECVKKNIPLTDI-p
Q91MU5_LSDV/33-250              .AKIKYPRSFLSIFNIIPRNMTKYEMDLVQTENITGAVFTTAFNIKKNLGIVD.EKLTIESIENYYLDPNNDVLTLMINNTSLDNV..TTRKKRSKR.NKNPVLFRQGSIPLFFIFESRKKVEIYKENVdKASSDNSYMKIDDNIAVASKYANMSLLDVHSPSASMKLNGVYGF.TYKNELRKLSSDKEIDEYSNKP.LQEPVRLNDFIGLFDCVKKNIPLTNI-p
Q8V2T2_CAMPM/33-248             .AKSKFPRSMLSIFNIVPRTMSKYELELIHNENITGAMFTTMYNIRNNLGLGD.DKLTIEAIENYFLDPNNEVMPLIINNTDMTAV..-IPKKSGRRkNKNMVIFRQGSSPILCIFETRKKINIYKENM.-ESASTEYTPIGDNKALISKYAGINVMNVYSPSTSMRLNAIYGF.TNKNKLEKLSTNKELESYSSSP.LQEPIRLNDFLGLFECVKKNIPLTDI-p
Q77GD3_LSDV/33-250              .AKIKYPRSFLSIFNIIPRNMTKYEMDLVQTENITGAVFTTAFNIKKNLGIVD.EKLTIESIENYYLDPNNDVLTLMINNTSLDNV..TTRKKRSKR.NKNPVLFRQGSIPLFFIFESRKKVEIYKENVdKASSDNSYMKIDDNIAVASKYANMSLLDVHSPSASMKLNGVYGF.TYKNELRKLSSDKEIDEYSNKP.LQEPVRLNDFIGLFDCVKKNIPLTNI-p
Q77GM4_LSDV/33-250              .AKIKYPRSFLSIFNIIPRNMTKYEMDLVQTENITGAVFTTAFNIKKNLGIVD.EKLTIESIENYYLDPNNDVLTLMINNTSLDNV..TTRKKRSKR.NKNPVLFRQGSIPLFFIFESRKKVEIYKENVdKASSDNSYMKIDDNIAVASKYANMSLLDVHSPSASMKLNGVYGF.TYKNELRKLSSDKEIDEYSNKP.LQEPVRLNDFIGLFDCVKKNIPLTNI-p
Q1M1M8_9POXV/33-248             .AKSKFPRSMLSIFNIVPRTMSKYELELIHNENITGAMFTTMYNIRNNLGLGD.DKLTIEAIENYFLDPNNEVMPLIINNTDMTAV..-IPKKSGRRkNKNMVIFRQGSSPILCIFETRKKINIYKENM.-ESASTEYTPIGDNKALISKYAGINVLNVYSPSTSMRLNAIYGF.TNKNKLEKLSTNKELESYSSSP.LQEPIRLNDFLGLLECIKKNIPLTDI-p
VP8_FOWPN/32-252                .ARSKFPKSLLSMYRVTPRVMTRYPLKLITNESITGVVITTVYNLKKNLNIPQnNKLTTQDIERYYLDKSVEVINLMVGNTSLGDLacGRPRRTKSSkKKDPVIFLGISAPLILVMNSKKSINTYIQDK.KSDPSSDYVNINPGIGVLENYGNTYLLDIHNPSSVLTISTIYGL.DNNMELKKLSTASEIDAYQDVN.IGKSVDLKKFNEIFNTMKKHLSLSNF-s
B9U1H3_9POXV/33-248             .AKSKFPRSMLSIFNIVPRTMSKYELELIHNENITGAMFTTMYNIRNNLGLGD.DKLTIEAIENYFLDPNNEVMPLIINNTDMTAV..-IPKKSGRRkNKNMVIFRQGSSPILCIFETRKKINIYKENM.-ESASTEYTPIGDNKALISKYAGINVLNVYSPSTSIRLNAIYGF.TNKNKLEKLSTNKELESYSSSP.LQEPIRLNDFLGLLECVKKNIPLTDI-p
Q76Q15_VARV/33-248              .AKSKFPRSMLSIFNIVPRTMSKYELELIHNENITGAMFTTMYNIRNNLGLGD.DKLTIEAIENYFLDPNNEVMSLIINNTDMTAV..-IPKKSGRRkNKNMVIFRQGSSPILCIFETRKKINIYKENM.-ESASTEYTPIGDNKALISKYAGINVLNVYSPSTSMRLNAIYGF.TNKNKLEKLSTNKELESYSSSP.LQEPIRLNDFLGLLECVKKNIPLTDI-p
F1AX34_ORFV/32-249              .ARVRFPRSLLSLFNVVPRTMTRYETELVGTEMVVGAVFTTAYNVRRNLGLGE.EPVTMRDIEKYFLDSENEVLTLIVHNTDFSAM.sGVRRRGGRR.IANPVIFRSGSTPLLIVMESRKKTNIYRERT.AEQANASYREVGSSLALVTRYAGLQLVDVHTPSSVLTVSAVYGF.TEDKGLKKLGSDKELADYQSTP.LTDPIRLSDFSKLFDGVKKSIQLTNV-p
Q70H27_FOWPV/32-252             .ARSKFPKSLLSMYRVTPRVMTRYPLKLITNESITGVVITTVYNLKKNLNIPQnNKLTTQDIERYYLDKSVEVINLMVGNTSLGDLacGRPRRTKSSkKKDPVIFLGISAPLILVMNSKKSINTYIQDK.KSDPSSDYVNINPGIGVLENYGNTYLLDIHNPSSVLTISTIYGL.DNNMELKKLSTASEIDAYQDVN.IGKSVDLKKFNEIFNTMKKHLSLSNF-s
#=GC seq_cons                   .AKsKFPRShLSIFNIVPRTMoKYELELlpsENITGAhFTThYNIRpNLGLGD.-KLTIEAIENYFLDPNNEVhsLlINNTDhouV...lPKKsGRR.NKN.VIFRQGSoPlLhIFEoRKKlNIYKENh..-uusopYo.IGDNhALlSKYAGlslLsVaSPSoSM+LNAlYGF.TsKNcLcKLSosKELEsYSSoP.LQEPIRLNDFlGLh-CVKKNIPLTsI.P
//
DBGET integrated database retrieval system