GenomeNet

Database: Pfam
Entry: Pox_polyA_pol_N
LinkDB: Pox_polyA_pol_N
Original site: Pox_polyA_pol_N 
#=GF ID   Pox_polyA_pol_N
#=GF AC   PF12630.5
#=GF DE   Poxvirus poly(A) polymerase N-terminal domain
#=GF AU   Bateman A
#=GF SE   Structure
#=GF GA   27.00 27.00;
#=GF TC   28.50 138.30;
#=GF NC   26.50 26.50;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   16678106
#=GF RT   Crystal structures of the vaccinia virus polyadenylate
#=GF RT   polymerase heterodimer: insights into ATP selectivity and
#=GF RT   processivity.
#=GF RA   Moure CM, Bowman BR, Gershon PD, Quiocho FA;
#=GF RL   Mol Cell. 2006;22:339-349.
#=GF DR   INTERPRO; IPR024398;
#=GF CC   This domain is found at the N-terminus of the pox virus Poly(A)
#=GF CC   polymerase protein [1]. According to SCOP this domain contains a
#=GF CC   helix-hairpin-helix motif.
#=GF SQ   11
#=GS PAP1_YMTV5/1-108    AC Q6TUY0.1
#=GS PAP1_DPV83/1-108    AC Q08FW1.1
#=GS PAP1_MCV1/1-108     AC Q98199.1
#=GS PAP1_RFVKA/1-108    AC Q9Q944.1
#=GS PAP1_FOWPN/3-110    AC Q9J5B8.1
#=GS PAP1_CPRVZ/1-106    AC Q070J7.1
#=GS PAP1_VACCW/10-117   AC P23371.2
#=GS PAP1_VACCW/10-117   DR PDB; 3ERC C; 12-117;
#=GS PAP1_VACCW/10-117   DR PDB; 3ER8 D; 12-117;
#=GS PAP1_VACCW/10-117   DR PDB; 3OWG A; 12-117;
#=GS PAP1_VACCW/10-117   DR PDB; 2GA9 D; 12-117;
#=GS PAP1_VACCW/10-117   DR PDB; 2GAF D; 12-117;
#=GS PAP1_VACCW/10-117   DR PDB; 3ERC D; 12-117;
#=GS PAP1_VACCW/10-117   DR PDB; 3OWG B; 12-117;
#=GS PAP1_VACCW/10-117   DR PDB; 3ER8 C; 12-117;
#=GS PAP1_VACCW/10-117   DR PDB; 3ER9 B; 12-117;
#=GS PAP1_SWPV1/1-108    AC Q8V3R4.1
#=GS PAP1_VAR67/11-117   AC P33809.1
#=GS Q6TVV2_ORFSA/2-105  AC Q6TVV2.1
#=GS PAP1_MYXVL/1-108    AC Q9Q8R9.1
PAP1_YMTV5/1-108               .....MNNSITLTLKNYLGRMPTVNEYYMLKSQVRNIQKIMFFNKDIFISLIKKNKKKFFYEIKSSPSEMRLHILEYFMKQQKTSSIGKLYAIIELQTILVSTYTDVLGVLTT
PAP1_DPV83/1-108               .....MNRHISEILEKYLGRIPSLTEYHTLKSQYKNIHRVNIFNKDIFISLIKKNKKKFFSDIDTSVSEIKKLVFDYFTKQEQTYSIGKLYTIIELQTILVTTYTDILGVLTT
PAP1_MCV1/1-108                .....MNGAQFELLREYLGRPPTLNQYFIFKPQARAIQRIMRFDTDVFFALIKKNKKRFFARIGGSASEINARVLSYFVKQRATTKVGRILSIIELQSVLVNSYTEIMGVLTL
PAP1_RFVKA/1-108               .....MNARIADLLYNYLGRPPSLSEYHMLKLQHRNIQKIIAFNKDIFISLIKKNKKKFFSDIDLTSSEIKTSVLSYFSKQRDTYSIGKLYTIIELQTILVSTYTDVLGVLTL
PAP1_FOWPN/3-110               ...rs--RQVYYIINEYLGRHPSSTEYQVLKHQVEKISKINNFNKETFFFLLKKNKNKFFKDLELSDDLLKKRIDEYFSKQKHAKRLGNLFAIMELQKILISSFTKTIGILTT
PAP1_CPRVZ/1-106               .....MNNR--ELINRYLGKTADQPIYYALFHKVGKIKQILNFDLNVFLKLLLKNRDRFLRENKQPTAEIKRRLTHYFTKQHRVRKVGKILSIVEFQHVIVTTFTRVLGVLTI
PAP1_VACCW/10-117              lpnit-----LKIIETYLGRVPSVNEYHMLKLQARNIQKITVFNKDIFVSLVKKNKKRFFSDVNTSASEIKDRILSYFSKQTQTYNIGKLFTIIELQSVLVTTYTDILGVLTI
#=GR PAP1_VACCW/10-117   SS    XX-HH-----HHHHHHHHTS---HHHHHHHGGGHHHHHHHHHS-HHHHHHHHHHHHHHH-TTSSS-THHHHHHHHHHTTGGGC---HHHHHHHHHHHHHHHHHHHHHTGGGGS
PAP1_SWPV1/1-108               .....MNRQIANILENYLGRYPSLNEYHTLKSQYRNIQKVNIFNKDIFISLLRKNKKKFFSDLVCTQSDIKHSVLSYFSKQENTYSIGKLYTIIELQTILVTTYTDVLGVLTT
PAP1_VAR67/11-117              .pnit-----LKIIETYLGRLPSVNEYHMLKLQTRNIQKITVFNKDIFVSLVKKNKKRFFSDVDTSASEIKDRILSYFSKQTQTYNIGKLFTIIELQSVLVTTYTNILGVLTI
Q6TVV2_ORFSA/2-105             ...ap------PVIEEYLGSRPSMERCVLLRAQRRNMSRVLNFDRKLFLSLVVKSRRRFFKKLGGSEKEIAARIEEYFSRQRRLEKLGQILTVLELQSVIVGEFTRTLGSLTT
PAP1_MYXVL/1-108               .....MNARIAELLHNYLGRPPSLSEYHMLKLQHRNIQKIIAFNKDIFISLIKKNKKKFFSDIDLTSSEIKTSVLSYFSKQRDTYSIGKLYTIIELQTILVSTYTDVLGVLTL
#=GC SS_cons                   XX-HH-----HHHHHHHHTS---HHHHHHHGGGHHHHHHHHHS-HHHHHHHHHHHHHHH-TTSSS-THHHHHHHHHHTTGGGC---HHHHHHHHHHHHHHHHHHHHHTGGGGS
#=GC seq_cons                  .....MNtp.hcllcpYLGRhPSlsEYahLKhQhRNIQKIhsFNKDIFlSLlKKNKK+FFuDlcsSsSEIKp+lLsYFSKQcpThsIGKLaTIIELQolLVoTYT-lLGVLTh
//
DBGET integrated database retrieval system