GenomeNet

Database: Pfam
Entry: PyrBI_leader
LinkDB: PyrBI_leader
Original site: PyrBI_leader 
#=GF ID   PyrBI_leader
#=GF AC   PF08052.10
#=GF DE   PyrBI operon leader peptide
#=GF AU   Lee SC
#=GF SE   Short protein clustering
#=GF GA   25.00 25.00;
#=GF TC   45.40 55.70;
#=GF NC   22.10 20.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 26740544 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   7517939
#=GF RT   Nucleotide-specific transcriptional pausing in the pyrBI leader
#=GF RT   region of Escherichia coli K-12. 
#=GF RA   Donahue JP, Turnbough CL Jr; 
#=GF RL   J Biol Chem 1994;269:18185-18191.
#=GF DR   INTERPRO; IPR012602;
#=GF CC   This family consists of the pyrBI operon leader peptides. The
#=GF CC   expression of the pyrBI operon, which encodes the subunits of
#=GF CC   the pyrimidine biosynthetic enzyme aspartate transcarbamylase. 
#=GF CC   is regulated primarily through a UTP-sensitive transcriptional
#=GF CC   attenuation control mechanism.  In this mechanism, the
#=GF CC   concentration of UTP determines the extent of coupling between
#=GF CC   transcription and translation within the pyrBI leader region,
#=GF CC   hence determining the level of rho-independent transcriptional
#=GF CC   termination at an attenuator preceding the pyrB gene [1].
#=GF SQ   7
#=GS LPPY_SALTY/1-33        AC P0A1W0.1
#=GS D2TNX8_CITRI/1-33      AC D2TNX8.1
#=GS Q328T9_SHIDS/1-44      AC Q328T9.1
#=GS LPPY_ECOLI/1-44        AC P0AD83.1
#=GS A0A181CRD6_9ENTR/1-34  AC A0A181CRD6.1
#=GS A8AMC7_CITK8/6-49      AC A8AMC7.1
#=GS A0A0T7RSG9_SALET/1-33  AC A0A0T7RSG9.1
LPPY_SALTY/1-33                   MVQCVRHSVLPRLKKDAGLPFFFPLKT.NTKPLN-----------.
D2TNX8_CITRI/1-33                 MVQCVRHSVLPRLKADAGLPFFFPLLP.YSQPL------------s
Q328T9_SHIDS/1-44                 MVQCVRHFVLPRLKKDAGLPFFFPLIT.HSQPLNRGAFFCPGVRR.
LPPY_ECOLI/1-44                   MVQCVRHFVLPRLKKDAGLPFFFPLIT.HSQPLNRGAFFCPGVRR.
A0A181CRD6_9ENTR/1-34             MVKRVRHNVLPRLKSDAGLPFFFPLLNlFPEPL------------i
A8AMC7_CITK8/6-49                 MVQCVRHSVLPRLKTDAGLPFFFPLLT.YSRPLIEGLFFCPGVRR.
A0A0T7RSG9_SALET/1-33             MVQCVRHSVLPRLKKDAGLPFFFPLKT.NTKPLN-----------.
#=GC seq_cons                     MVQCVRHsVLPRLKpDAGLPFFFPLlT.aopPL.............
//
DBGET integrated database retrieval system