GenomeNet

Database: Pfam
Entry: RSF
LinkDB: RSF
Original site: RSF 
#=GF ID   RSF
#=GF AC   PF14876.2
#=GF DE   Respiratory growth transcriptional regulator
#=GF PI   RSF1P;
#=GF AU   Wood V, Coggill P
#=GF SE   Pfam-B_36578 (release 26.0)
#=GF GA   27.00 27.00;
#=GF TC   36.30 36.30;
#=GF NC   24.20 24.20;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 80369284 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   12734673
#=GF RT   Rsf1p, a protein required for respiratory growth of
#=GF RT   Saccharomyces cerevisiae.
#=GF RA   Lu L, Roberts G, Simon K, Yu J, Hudson AP;
#=GF RL   Curr Genet. 2003;43:263-272.
#=GF DR   INTERPRO; IPR027998;
#=GF CC   This is a family of transcriptional regulators that determine
#=GF CC   the transition from fermentative activity to growth on glycerol
#=GF CC   [1].
#=GF SQ   35
#=GS W7R6Y4_YEASX/1-373      AC W7R6Y4.1
#=GS RSF1_YEAST/1-373        AC Q05043.1
#=GS H0GZ78_SACCK/1-328      AC H0GZ78.1
#=GS E9P9J4_YEASX/1-373      AC E9P9J4.1
#=GS E9P9J3_YEASX/1-373      AC E9P9J3.1
#=GS G2WK81_YEASK/1-373      AC G2WK81.1
#=GS E9P9J6_YEASX/1-373      AC E9P9J6.1
#=GS E9P9J5_YEASX/1-373      AC E9P9J5.1
#=GS A0A023ZEL4_YEASX/1-373  AC A0A023ZEL4.1
#=GS B8XW56_YEASX/1-373      AC B8XW56.1
#=GS E7QJ46_YEASZ/1-229      AC E7QJ46.1
#=GS B8XW70_YEASX/1-373      AC B8XW70.1
#=GS B8XW48_YEASX/1-373      AC B8XW48.1
#=GS G0V747_NAUCC/144-311    AC G0V747.1
#=GS E7LYB1_YEASV/1-373      AC E7LYB1.1
#=GS C7GL89_YEAS2/1-373      AC C7GL89.1
#=GS G0W9T7_NAUDC/169-368    AC G0W9T7.1
#=GS B5VPF8_YEAS6/1-373      AC B5VPF8.1
#=GS E9P9J8_YEASX/1-373      AC E9P9J8.1
#=GS RSF1_YEAS7/1-373        AC A6ZM92.1
#=GS A0A024Y0E0_YEASX/1-373  AC A0A024Y0E0.1
#=GS J5RTI8_SACK1/1-379      AC J5RTI8.1
#=GS G0WDB1_NAUDC/85-196     AC G0WDB1.1
#=GS B8XW68_YEASX/1-373      AC B8XW68.1
#=GS W7PBR8_YEASX/1-373      AC W7PBR8.1
#=GS N1NYM4_YEASC/1-373      AC N1NYM4.1
#=GS H0GLZ4_SACCK/1-373      AC H0GLZ4.1
#=GS H2AQQ5_KAZAF/56-190     AC H2AQQ5.1
#=GS H2ATE6_KAZAF/140-252    AC H2ATE6.1
#=GS B8XW58_YEASX/1-373      AC B8XW58.1
#=GS E9P9J7_YEASX/1-373      AC E9P9J7.1
#=GS E7Q7N3_YEASB/1-373      AC E7Q7N3.1
#=GS E7KSH7_YEASL/1-373      AC E7KSH7.1
#=GS E7NLE9_YEASO/1-373      AC E7NLE9.1
#=GS C8ZEN6_YEAS8/1-373      AC C8ZEN6.1
W7R6Y4_YEASX/1-373                 ..................................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETPRILNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV---QRQQQQVVDFIEnNMQLLSSETLNFRSDIMKTLELPIPKRR..DIK...G.NHLSKLLFAKSPLTINTYCQFYGRRT....KR.ICNQEMIWKDKNS..REKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSKIAMNDLIEILIDLNIPFSVLDYQPIRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHN----SSNLNNSNSGTPHNHNQNQ.......................
RSF1_YEAST/1-373                   ..................................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETPRILNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV---QRQQQQVVDFIEnNMQLLSSETLNFRSDIMKTLELPIPKRR..DIK...G.NHLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWKDKNS..REKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSKIAMNDLIEILIDLNIPFSVLDYQPMRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHN----SSNLNNSNSGTPHNHNQNQ.......................
H0GZ78_SACCK/1-328                 ..................................................---------------------------------------------------METPRILDMSMVPDYLQKENFSPEFSSATVSAGSSPVNVTHDECLPSGVTGSSCKKGYKHAIKWQQQQQQQVADFMD.NMHSLSSGMLCLRSDIMKSLELPVPKRR..DIK...G.NHLSKLLFAKSPLTINTYCQFYDCRT....KC.ICNQEMIWKDKNS..REKHGSRKYQRHLGKVHNVQLTPQNFTQFFDHNSPLFQKCYNYQSSLMSDLFIEPDTKAKEKKRKRAEDITRNDSETGQSFANRQEQQQNILELQSKIAMNDLIENLIDLSIPFSVLDYQPMRDWLIKYSIISTDTLPDEVYFKAGPGVNESEHNRNESNNNISNNISSTPHNHNQNQ.......................
E9P9J4_YEASX/1-373                 ..................................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETRRTLNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV---QRQQQQVVDFIEnNMQLLSSETLNFRSDIMKTLELPIPKRR..DIK...G.NHLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWKDKNS..REKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLTRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSKIAMNDLIEILIDLNIPFSVLDYQPMRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHN----SSNLNNSNSGTPHNHNQNQ.......................
E9P9J3_YEASX/1-373                 ..................................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFAANRSGTPREEMYLAPNKMETPRILNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV---QRQQQQVVDFIEnNMQLLSSETLNFRSDIMKTLELPIPKRR..DIK...G.NHLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWKDKNS..REKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSKIAMNDLIEILIDLNIPFSVLDYQPMRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHN----SSILNNSNSGTPHKHNQNQ.......................
G2WK81_YEASK/1-373                 ..................................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETPRILNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV---QRQQQQVVDFIEnNMQLLSSETLNFRSDIMKTLELPIPKRR..DIK...G.NHLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWKDKNS..REKHGSRKYQRHLSRVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSKIAMNDLIEILIDLNIPFSVLDYQPMRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHN----SSNLNNSNSGTPHNHNQNQ.......................
E9P9J6_YEASX/1-373                 ..................................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETPRILNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV---QRQQQQVVDFIEnNMQLLSSETLNFRSDIMKTLELPIPKRR..DIK...G.NHLSKLLFAKSPLTINTYCQFYXRRT....KR.ICNQEMIWKDKNS..REKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSKIAMNDLIEILIDLNIPFSVLDYQPIRNWLXKYSIISTDTLPDEVYFKTDPGVNELEHN----SSNLNNSNSGTPHNHNQNQ.......................
E9P9J5_YEASX/1-373                 ..................................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSXTPREEMYLAPNKMETXRXLNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV---QRQQQQVVDFIEnNMQLLSSETLNFRSDIMKTLELPIPKRR..DIK...G.NHLSKLLFAKSPLTINTYCQFYXRRT....KR.ICNQEMIWKDKNS..REKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSXIAMNDLIEILIDLNIPFSVLDYQPXRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHN----SSNLNNSNSGTPHNHNQNQ.......................
A0A023ZEL4_YEASX/1-373             ..................................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETPRILNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV---QRQQQQVVDFIEnNMQLLSSETLNFRSDIMKTLELPIPKRR..DIK...G.NYLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWKDKNS..REKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSKIAMNDLIEILIDLNIPFSVLDYQPMRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHN----SSNLNNSNSGTPHNHNQNQ.......................
B8XW56_YEASX/1-373                 ..................................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETPRILNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV---QRQQQQVVDFIEnNMQLLSSETLNFRSDIMKTLELPIPKRR..DIK...G.NHLSKLLFAKSPLTINTYCQFYGRRT....KR.ICNQEMIWKDKNS..REKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSKIAMNDLIEILIDLNIPFSVLDYQPIRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHN----SSNLNNSNSGTPHNHNQNQ.......................
E7QJ46_YEASZ/1-229                 ..................................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETPRILNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV---QRQQQQVVDFIEnNMQLLSSETLNFRSDIMKTLELPIPKRR..DIK...G.NXLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWKDKNS..REKHGSRKYQRHLSKVHDVQLTPNNFTEFF----------------------------------------------------------------------------------------------------------------------------------------------------.......................
B8XW70_YEASX/1-373                 ..................................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSXTPREEMYLAPNKMETRRTLNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV---QRQQQQVVDFIEnNMQLLSSETLNFRSDIMKTLELPIPKRR..DIK...G.NHLSKLLFAKSPLTINTYCQFYXRRT....KR.ICNQEMIWKDKNS..REKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSXIAMNDLIEILIDLNIPFSVLDYQPXRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHN----SSNLNNSNSGTPHNHNQNQ.......................
B8XW48_YEASX/1-373                 ..................................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETPRILNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV---QRQQQQVVDFIEnNMQLLSSETLNFRSDIMKTLELPIPKRR..DIK...G.NHLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWKDKNS..REKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSKIAMNDLIEILIDLNIPFSVLDYQPMRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHN----SSNLNNSNSGTPHNHNQNQ.......................
G0V747_NAUCC/144-311               ..................keqttstshphiishrhtlsklekcpkshlpy--------------------------------------------------------------------------------------------------------------------------------.-------------------LTLILPSKT..TLKkkaP.NTFAKFLFAQDPHSENLVCQFHTKSK....HAsSTTCNMILKMGNNsiRRRTQARKCRDHLKMEHGIRVTPTNFLNYLDHDSDVFRRSYTDKVLAMIKPLVESFA-------------------------------------------------------------------------------------------------------------------------vdydlqrmktmqayrelae....
E7LYB1_YEASV/1-373                 ..................................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSETPREEMYLAPNKMETRRTLNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV---QRQQQQVVDFIEnNMQLLSSETLNFRSDIMKTLELPIPKRR..DIK...G.NHLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWKDKNS..REKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLXRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSXIAMNDLIEILIDLNIPFSVLDYQPMRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHN----SSNLNNSNSGTPHNHNQNQ.......................
C7GL89_YEAS2/1-373                 ..................................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETPRILNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV---QRQQQQVVDFIEnNMQLLSSETLNFRSDIMKTLELPIPKRR..DIK...G.NHLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWKDKNS..REKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSKIAMNDLIEILIDLNIPFSVLDYQPMRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHN----SSNLNNSNSGTPHNHNQNQ.......................
G0W9T7_NAUDC/169-368               hqeqiqrysssslttvhndvssllsqqnndanntnvqeddpqqlmlsqdi--------------------------------------------------------------------------------------------------------------------------------.------SHLTTFPSSLSKRLSLIIPSKT..TLKkksA.NTFAKFIFAEDRYSDNLICQFYDPNNtnedSS.ICNKIIKMSSKSI..KRRTQARKCKDHLRLEHDIEINPNNYLHYLNHNSELFKKAYTTKTLANVKPLVESF--------------------------------------------------------------------------------------------------------------------------smahdlqkmqnmqayvelse...
B5VPF8_YEAS6/1-373                 ..................................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETRRTLNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV---QRQQQQVVDFIEnNMQLLSSETLNFRSDIMKTLELPIPKRR..DIK...G.NHLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWKDKNS..REKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLTRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSKIAMNDLIEILIDLNIPFSVLDYQPMRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHN----SSNLNNSNSGTPHNHNQNQ.......................
E9P9J8_YEASX/1-373                 ..................................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETXRXLNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV---QRQQQQVVDFIEnNMQLLSSETLNFRSDIMKTLELPIPKRR..DIK...G.NHLSKLLFAKSPLTINTYCQFYXRRT....KR.ICNQEMIWKDKNS..REKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLXRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSKIAMNDLIEILIDLNIPFSVLDYQPXRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHN----SSNLNNSNSGTPHNHNQNQ.......................
RSF1_YEAS7/1-373                   ..................................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETPRILNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV---QRQQQQVVDFIEnNMQLLSSETLNFRSDIMKTLELPIPKRR..DIK...G.NHLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWKDKNS..REKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSKIAMNDLIEILIDLNIPFSVLDYQPMRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHN----SSNLNNSNSGTPHNHNQNQ.......................
A0A024Y0E0_YEASX/1-373             ..................................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETPRILNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV---QRQQQQVVDFIEnNMQLLSSETLNFRSDIMKTLELPIPKRR..DIK...G.NHLSKLLFAKSPLTINTYCQFYGRRT....KR.ICNQEMIWKDKNS..REKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSKIAMNDLIEILIDLNIPFSVLDYQPIRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHN----SSNLNNSNSGTPHNHNQNQ.......................
J5RTI8_SACK1/1-379                 ..................................................MNNPNLEMEKFTTTEGQSGDSRSMVDIGTLPNFPCNRSSTPREGNNQTPNKMETPRILDMSMVPDYLQKENFSPEFSSATVSAGSSPVNVTHDECLPSGITGSSGKKGYKHAIKWQQQQQQQVADFME.NMHSLSSGMLCLRSDIMKSLELPVPKRR..DIK...G.NHLSKLLFAKSPLTINTYCQFYDCRT....KC.ICNQEMIWKDKNS..REKHGSRKYQRHLSKVHNVQLTPQNFTQFFDHNSPLFQECYNYQSSLMSDLFIEPDTKAKEKKRKRADDITRNDSETGQSFANRPEQQQNILELQSKIAMNDLIENLIDLSIPFSVLDYQPMRDWLIKYSIISTDTLPDEVYFKADPGVNESEHNRNESNNNISNNISSTPHNHNQNQ.......................
G0WDB1_NAUDC/85-196                ..................................qrlhlvfpttsnnkkl--------------------------------------------------------------------------------------------------------------------------------.----------------------------..--S...L.KSLSKFVMAERNDSFNYYCQFYDAKK....QQ.TCNQVLEFQTKQS..RTSHQADKCTRHLLEEHNYIPDPMTILYQMDHSSTVFQNAYP----------------------------------------------------------------------------------------------------------------------------------------ndtfqkiqqnf............
B8XW68_YEASX/1-373                 ..................................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETPRILNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV---QRQQQQVVDFIEnNMQLLSSETLNFRSDIMKTLELPIPKRR..DIK...G.NHLSKLLFAKSPLTINTYCQFYGRRT....KR.ICNQEMIWKDKNS..REKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSKIAMNDLIEILIXLNIPFSVLDYQPIRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHN----SSNLNNSNSGTPHNHNQNQ.......................
W7PBR8_YEASX/1-373                 ..................................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETPRILNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV---QRQQQQVVDFIEnNMQLLSSETLNFRSDIMKTLELPIPKRR..DIK...G.NYLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWKDKNS..REKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSKIAMNDLIEILIDLNIPFSVLDYQPMRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHN----SSNLNNSNSGTPHNHNQNQ.......................
N1NYM4_YEASC/1-373                 ..................................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETPRILNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV---QRQQQQVVDFIEnNMQLLSSETLNFRSDIMKTLELPIPKRR..DIK...G.NHLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWKDKNS..REKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSKIAMNDLIEILIDLNIPFSVLDYQPMRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHN----SSNLNNSNSGTPHNHNQNQ.......................
H0GLZ4_SACCK/1-373                 ..................................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSXTPREEMYLAPNKMETRRTLNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV---QRQQQQVVDFIEnNMQLLSSETLNFRSDIMKTLELPIPKRR..DIK...G.NHLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWKDKNS..REKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSEIAMNDLIEILIDLNIPFSVLDYQPMRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHN----SSNLNNSNSGTPHNHNQNQ.......................
H2AQQ5_KAZAF/56-190                ....................................enieienfepnklr--------------------------------------------------------------------------------------------------------------------------------.---------------------LIIPTASnlKIK...TeNVFLKFIFAGYDDSNDLFCQFFNPNT....NL.ICNKRMHFENHKI..KISTMARKCKDHLVKSHNFNINDHNYFKFLNLYYPVFKNSYTE---------------------------------------------------------------------------------------------------------------------------------------dtlnkvlpmleefevvcdsikie
H2ATE6_KAZAF/140-252               .................................kdnlnlsliwskrknkn--------------------------------------------------------------------------------------------------------------------------------.----------------------------..---...-.---PHLMFFSQLDDLTKVCQFYNPIS....HT.ICNYEVVFRDMTE..QRKLAARKCQSHINKYHDLQLDPNSAEKVLKHICPARK--------------------------------------------------------------------------------------------------------------------------------------------dydtlkcivseqekdskdva...
B8XW58_YEASX/1-373                 ..................................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETPRILNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV---QRQQQQVVDFIEnNMQLLSSETLNFRSDIMKTLELPIPKRR..DIK...G.NYLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWKDKNS..REKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSKIAMNDLIEILIDLNIPFSVLDYQPMRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHN----SSNLNNSNSGTPHNHNQNQ.......................
E9P9J7_YEASX/1-373                 ..................................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETXRTLNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV---QRQQQQVVDFIEnNMQLLSSETLNFRSDIMKTLELPIPKRR..DIK...G.NHLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWKDKNS..XEKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSXIAXNDLIEILIDLNIPFSVLDYQPXRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHN----SSNLNNSNSGTPHNHNQNQ.......................
E7Q7N3_YEASB/1-373                 ..................................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETPRTLNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV---QRQQQQVVDFIEnNMQLLSSETLNFRSDIMKTLELPIPKRR..DIK...G.NHLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWKDKNS..REKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSEIAMNDLIEILIDLNIPFSVLDYQPMRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHN----SSNLNNSNSGTPHNHNQNQ.......................
E7KSH7_YEASL/1-373                 ..................................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSXTPREEMYLAPNKMETXRXLNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV---QRQQQQVVDFIEnNMQLLSSETLNFRSDIMKTLELPIPKRR..DIK...G.NHLSKLLFAKSPLTINTYCQFYXRRT....KR.ICNQEMIWKDKNS..REKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSXIAMNDLIEILIDLNIPFSVLDYQPXRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHN----SSNLNNSNSGTPHNHNQNQ.......................
E7NLE9_YEASO/1-373                 ..................................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETXRTLNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV---QRQQQQVVDFIEnNMQLLSSETLNFRSDIMKTLELPIPKRR..DIK...G.NHLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWKDKNS..REKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSEIAMNDLIEILIDLNIPFSVLDYQPMRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHN----SSNLNNSNSGTPHNHNQNQ.......................
C8ZEN6_YEAS8/1-373                 ..................................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETPRILNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV---QRQQQQVVDFIEnNMQLLSSETLNFRSDIMKTLELPIPKRR..DIK...G.NHLSKLLFAKSPLTINTYCQFYGRRT....KR.ICNQEMIWKDKNS..REKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSKIAMNDLIEILIDLNIPFSVLDYQPIRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHN----SSNLNNSNSGTPHNHNQNQ.......................
#=GC seq_cons                      ..................................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMET.RhLNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV...QRQQQQVVDFIENNMQLLSSETLNFRSDIMKTLELPIPKRR..DIK...G.NHLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWKDKNS..REKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSKIAMNDLIEILIDLNIPFSVLDYQPhRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHN....SSNLNNSNSGTPHNHNQNQ.......................
//
DBGET integrated database retrieval system