GenomeNet

Database: Pfam
Entry: RSF
LinkDB: RSF
Original site: RSF 
#=GF ID   RSF
#=GF AC   PF14876.1
#=GF DE   Respiratory growth transcriptional regulator
#=GF PI   RSF1P;
#=GF AU   Wood V, Coggill P
#=GF SE   Pfam-B_36578 (release 26.0)
#=GF GA   27.00 27.00;
#=GF TC   35.70 34.80;
#=GF NC   24.10 24.10;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   12734673
#=GF RT   Rsf1p, a protein required for respiratory growth of
#=GF RT   Saccharomyces cerevisiae.
#=GF RA   Lu L, Roberts G, Simon K, Yu J, Hudson AP;
#=GF RL   Curr Genet. 2003;43:263-272.
#=GF CC   This is a family of transcriptional regulators that determine
#=GF CC   the transition from fermentative activity to growth on glycerol
#=GF CC   [1].
#=GF SQ   29
#=GS B8XW56_YEASX/1-374    AC B8XW56.1
#=GS E9P9J7_YEASX/1-374    AC E9P9J7.1
#=GS H0GLZ4_9SACH/1-374    AC H0GLZ4.1
#=GS RSF1_YEAS7/1-374      AC A6ZM92.1
#=GS C7GL89_YEAS2/1-374    AC C7GL89.1
#=GS G0WDB1_NAUDC/84-199   AC G0WDB1.1
#=GS E9P9J6_YEASX/1-374    AC E9P9J6.1
#=GS E9P9J5_YEASX/1-374    AC E9P9J5.1
#=GS B8XW48_YEASX/1-374    AC B8XW48.1
#=GS B8XW58_YEASX/1-374    AC B8XW58.1
#=GS H2AQQ5_KAZAF/38-183   AC H2AQQ5.1
#=GS H2ATE6_KAZAF/139-265  AC H2ATE6.1
#=GS RSF1_YEAST/1-374      AC Q05043.1
#=GS B8XW70_YEASX/1-374    AC B8XW70.1
#=GS G2WK81_YEASK/1-374    AC G2WK81.1
#=GS E9P9J8_YEASX/1-374    AC E9P9J8.1
#=GS G0V747_NAUCC/170-305  AC G0V747.1
#=GS C8ZEN6_YEAS8/1-374    AC C8ZEN6.1
#=GS B5VPF8_YEAS6/1-374    AC B5VPF8.1
#=GS E7NLE9_YEASO/1-374    AC E7NLE9.1
#=GS B8XW68_YEASX/1-374    AC B8XW68.1
#=GS E7Q7N3_YEASB/1-374    AC E7Q7N3.1
#=GS E9P9J4_YEASX/1-374    AC E9P9J4.1
#=GS H0GZ78_9SACH/1-329    AC H0GZ78.1
#=GS G0W9T7_NAUDC/174-365  AC G0W9T7.1
#=GS E7LYB1_YEASV/1-374    AC E7LYB1.1
#=GS E9P9J3_YEASX/1-374    AC E9P9J3.1
#=GS E7QJ46_YEASZ/1-229    AC E7QJ46.1
#=GS E7KSH7_YEASL/1-374    AC E7KSH7.1
B8XW56_YEASX/1-374               .............................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETPRILNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV...QRQQQQVVDFIENNMQLLSSETLNFRSDIMKTLELPIPK..RRDIK...G.NHLSKLLFAKSPLTINTYCQFYGRRT....KR.ICNQEMIWK..DKNSREKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSKIAMNDLIEILIDLNIPFSVLDYQPIRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHNSSNLNN..SN..SGTPHNHNQNQH................................
E9P9J7_YEASX/1-374               .............................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETXRTLNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV...QRQQQQVVDFIENNMQLLSSETLNFRSDIMKTLELPIPK..RRDIK...G.NHLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWK..DKNSXEKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSXIAXNDLIEILIDLNIPFSVLDYQPXRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHNSSNLNN..SN..SGTPHNHNQNQH................................
H0GLZ4_9SACH/1-374               .............................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSXTPREEMYLAPNKMETRRTLNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV...QRQQQQVVDFIENNMQLLSSETLNFRSDIMKTLELPIPK..RRDIK...G.NHLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWK..DKNSREKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSEIAMNDLIEILIDLNIPFSVLDYQPMRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHNSSNLNN..SN..SGTPHNHNQNQH................................
RSF1_YEAS7/1-374                 .............................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETPRILNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV...QRQQQQVVDFIENNMQLLSSETLNFRSDIMKTLELPIPK..RRDIK...G.NHLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWK..DKNSREKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSKIAMNDLIEILIDLNIPFSVLDYQPMRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHNSSNLNN..SN..SGTPHNHNQNQH................................
C7GL89_YEAS2/1-374               .............................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETPRILNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV...QRQQQQVVDFIENNMQLLSSETLNFRSDIMKTLELPIPK..RRDIK...G.NHLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWK..DKNSREKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSKIAMNDLIEILIDLNIPFSVLDYQPMRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHNSSNLNN..SN..SGTPHNHNQNQH................................
G0WDB1_NAUDC/84-199              ..............................pqrlhlvfpttsnnk-----------------------------------------------------------------------------------------------------------------...---------------------------------------..--KLS...L.KSLSKFVMAERNDSFNYYCQFYDAKK....QQ.TCNQVLEFQ..TKQSRTSHQADKCTRHLLEEHNYIPDPMTILYQMDHSSTVFQNAYP-----------------------------------------------------------------------------------------------------------------------..--..------------ndtfqkiqqnfemt..................
E9P9J6_YEASX/1-374               .............................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETPRILNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV...QRQQQQVVDFIENNMQLLSSETLNFRSDIMKTLELPIPK..RRDIK...G.NHLSKLLFAKSPLTINTYCQFYXRRT....KR.ICNQEMIWK..DKNSREKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSKIAMNDLIEILIDLNIPFSVLDYQPIRNWLXKYSIISTDTLPDEVYFKTDPGVNELEHNSSNLNN..SN..SGTPHNHNQNQH................................
E9P9J5_YEASX/1-374               .............................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSXTPREEMYLAPNKMETXRXLNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV...QRQQQQVVDFIENNMQLLSSETLNFRSDIMKTLELPIPK..RRDIK...G.NHLSKLLFAKSPLTINTYCQFYXRRT....KR.ICNQEMIWK..DKNSREKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSXIAMNDLIEILIDLNIPFSVLDYQPXRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHNSSNLNN..SN..SGTPHNHNQNQH................................
B8XW48_YEASX/1-374               .............................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETPRILNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV...QRQQQQVVDFIENNMQLLSSETLNFRSDIMKTLELPIPK..RRDIK...G.NHLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWK..DKNSREKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSKIAMNDLIEILIDLNIPFSVLDYQPMRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHNSSNLNN..SN..SGTPHNHNQNQH................................
B8XW58_YEASX/1-374               .............................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETPRILNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV...QRQQQQVVDFIENNMQLLSSETLNFRSDIMKTLELPIPK..RRDIK...G.NYLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWK..DKNSREKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSKIAMNDLIEILIDLNIPFSVLDYQPMRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHNSSNLNN..SN..SGTPHNHNQNQH................................
H2AQQ5_KAZAF/38-183              ...............msqhrltegtnnsldpiyenieienfepnk-----------------------------------------------------------------------------------------------------------------...--------------------------------LRLIIPTasNLKIK...TeNVFLKFIFAGYDDSNDLFCQFFNPNT....NL.ICNKRMHFE..NHKIKISTMARKCKDHLVKSHNFNINDHNYFKFLNLYYPVFKNSYTE----------------------------------------------------------------------------------------------------------------------..--..------------dtlnkvlpmleefevv................
H2ATE6_KAZAF/139-265             .............................ekdnlnlsliwskrkn-----------------------------------------------------------------------------------------------------------------...---------------------------------------..-----...-.-KNPHLMFFSQLDDLTKVCQFYNPIS....HT.ICNYEVVFR..DMTEQRKLAARKCQSHINKYHDLQLDPNSAEKVLKHICPARKD--------------------------------------------------------------------------------------------------------------------------..--..------------ydtlkcivseqekdskdvatldeyspkvklrk
RSF1_YEAST/1-374                 .............................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETPRILNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV...QRQQQQVVDFIENNMQLLSSETLNFRSDIMKTLELPIPK..RRDIK...G.NHLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWK..DKNSREKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSKIAMNDLIEILIDLNIPFSVLDYQPMRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHNSSNLNN..SN..SGTPHNHNQNQH................................
B8XW70_YEASX/1-374               .............................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSXTPREEMYLAPNKMETRRTLNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV...QRQQQQVVDFIENNMQLLSSETLNFRSDIMKTLELPIPK..RRDIK...G.NHLSKLLFAKSPLTINTYCQFYXRRT....KR.ICNQEMIWK..DKNSREKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSXIAMNDLIEILIDLNIPFSVLDYQPXRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHNSSNLNN..SN..SGTPHNHNQNQH................................
G2WK81_YEASK/1-374               .............................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETPRILNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV...QRQQQQVVDFIENNMQLLSSETLNFRSDIMKTLELPIPK..RRDIK...G.NHLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWK..DKNSREKHGSRKYQRHLSRVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSKIAMNDLIEILIDLNIPFSVLDYQPMRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHNSSNLNN..SN..SGTPHNHNQNQH................................
E9P9J8_YEASX/1-374               .............................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETXRXLNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV...QRQQQQVVDFIENNMQLLSSETLNFRSDIMKTLELPIPK..RRDIK...G.NHLSKLLFAKSPLTINTYCQFYXRRT....KR.ICNQEMIWK..DKNSREKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLXRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSKIAMNDLIEILIDLNIPFSVLDYQPXRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHNSSNLNN..SN..SGTPHNHNQNQH................................
G0V747_NAUCC/170-305             ....................................kshlpyltl-----------------------------------------------------------------------------------------------------------------...-----------------------------------ILPS..KTTLKkkaP.NTFAKFLFAQDPHSENLVCQFHTKSK....HAsSTTCNMILKmgNNSIRRRTQARKCRDHLKMEHGIRVTPTNFLNYLDHDSDVFRRSYTDKVLAMIKPLVESFA--------------------------------------------------------------------------------------------------------..--..------------vdydlqrmktmqa...................
C8ZEN6_YEAS8/1-374               .............................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETPRILNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV...QRQQQQVVDFIENNMQLLSSETLNFRSDIMKTLELPIPK..RRDIK...G.NHLSKLLFAKSPLTINTYCQFYGRRT....KR.ICNQEMIWK..DKNSREKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSKIAMNDLIEILIDLNIPFSVLDYQPIRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHNSSNLNN..SN..SGTPHNHNQNQH................................
B5VPF8_YEAS6/1-374               .............................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETRRTLNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV...QRQQQQVVDFIENNMQLLSSETLNFRSDIMKTLELPIPK..RRDIK...G.NHLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWK..DKNSREKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLTRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSKIAMNDLIEILIDLNIPFSVLDYQPMRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHNSSNLNN..SN..SGTPHNHNQNQH................................
E7NLE9_YEASO/1-374               .............................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETXRTLNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV...QRQQQQVVDFIENNMQLLSSETLNFRSDIMKTLELPIPK..RRDIK...G.NHLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWK..DKNSREKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSEIAMNDLIEILIDLNIPFSVLDYQPMRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHNSSNLNN..SN..SGTPHNHNQNQH................................
B8XW68_YEASX/1-374               .............................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETPRILNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV...QRQQQQVVDFIENNMQLLSSETLNFRSDIMKTLELPIPK..RRDIK...G.NHLSKLLFAKSPLTINTYCQFYGRRT....KR.ICNQEMIWK..DKNSREKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSKIAMNDLIEILIXLNIPFSVLDYQPIRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHNSSNLNN..SN..SGTPHNHNQNQH................................
E7Q7N3_YEASB/1-374               .............................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETPRTLNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV...QRQQQQVVDFIENNMQLLSSETLNFRSDIMKTLELPIPK..RRDIK...G.NHLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWK..DKNSREKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSEIAMNDLIEILIDLNIPFSVLDYQPMRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHNSSNLNN..SN..SGTPHNHNQNQH................................
E9P9J4_YEASX/1-374               .............................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETRRTLNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV...QRQQQQVVDFIENNMQLLSSETLNFRSDIMKTLELPIPK..RRDIK...G.NHLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWK..DKNSREKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLTRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSKIAMNDLIEILIDLNIPFSVLDYQPMRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHNSSNLNN..SN..SGTPHNHNQNQH................................
H0GZ78_9SACH/1-329               .............................................---------------------------------------------------METPRILDMSMVPDYLQKENFSPEFSSATVSAGSSPVNVTHDECLPSGVTGSSCKKGYKHAIkwqQQQQQQVADFMD-NMHSLSSGMLCLRSDIMKSLELPVPK..RRDIK...G.NHLSKLLFAKSPLTINTYCQFYDCRT....KC.ICNQEMIWK..DKNSREKHGSRKYQRHLGKVHNVQLTPQNFTQFFDHNSPLFQKCYNYQSSLMSDLFIEPDTKAKEKKRKRAEDITRNDSETGQSFANRQEQQQNILELQSKIAMNDLIENLIDLSIPFSVLDYQPMRDWLIKYSIISTDTLPDEVYFKAGPGVNESEHNRNESNNniSNniSSTPHNHNQNQ-t...............................
G0W9T7_NAUDC/174-365             qrysssslttvhndvssllsqqnndanntnvqeddpqqlmlsqdi-----------------------------------------------------------------------------------------------------------------...-------------------SHLTTFPSSLSKRLSLIIPS..KTTLKkksA.NTFAKFIFAEDRYSDNLICQFYDPNNtnedSS.ICNKIIKMS..SKSIKRRTQARKCKDHLRLEHDIEINPNNYLHYLNHNSELFKKAYTTKTLANVKPLVES----------------------------------------------------------------------------------------------------------..--..------------fsmahdlqkmqnmqayve..............
E7LYB1_YEASV/1-374               .............................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSETPREEMYLAPNKMETRRTLNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV...QRQQQQVVDFIENNMQLLSSETLNFRSDIMKTLELPIPK..RRDIK...G.NHLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWK..DKNSREKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLXRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSXIAMNDLIEILIDLNIPFSVLDYQPMRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHNSSNLNN..SN..SGTPHNHNQNQH................................
E9P9J3_YEASX/1-374               .............................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFAANRSGTPREEMYLAPNKMETPRILNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV...QRQQQQVVDFIENNMQLLSSETLNFRSDIMKTLELPIPK..RRDIK...G.NHLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWK..DKNSREKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSKIAMNDLIEILIDLNIPFSVLDYQPMRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHNSSILNN..SN..SGTPHKHNQNQH................................
E7QJ46_YEASZ/1-229               .............................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETPRILNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV...QRQQQQVVDFIENNMQLLSSETLNFRSDIMKTLELPIPK..RRDIK...G.NXLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWK..DKNSREKHGSRKYQRHLSKVHDVQLTPNNFTEFF-----------------------------------------------------------------------------------------------------------------------------------..--..------------................................
E7KSH7_YEASL/1-374               .............................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSXTPREEMYLAPNKMETXRXLNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV...QRQQQQVVDFIENNMQLLSSETLNFRSDIMKTLELPIPK..RRDIK...G.NHLSKLLFAKSPLTINTYCQFYXRRT....KR.ICNQEMIWK..DKNSREKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSXIAMNDLIEILIDLNIPFSVLDYQPXRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHNSSNLNN..SN..SGTPHNHNQNQH................................
#=GC seq_cons                    .............................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMET.RhLNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV...QRQQQQVVDFIENNMQLLSSETLNFRSDIMKTLELPIPK..RRDIK...G.NHLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWK..DKNSREKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQScIAMNDLIEILIDLNIPFSVLDYQPhRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHNSSNLNN..SN..SGTPHNHNQNQH................................
//
DBGET integrated database retrieval system