GenomeNet

Database: Pfam
Entry: RSF
LinkDB: RSF
Original site: RSF 
#=GF ID   RSF
#=GF AC   PF14876.4
#=GF DE   Respiratory growth transcriptional regulator
#=GF PI   RSF1P;
#=GF AU   Wood V, Coggill P
#=GF SE   Pfam-B_36578 (release 26.0)
#=GF GA   27.00 27.00;
#=GF TC   36.30 36.30;
#=GF NC   24.20 24.20;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   12734673
#=GF RT   Rsf1p, a protein required for respiratory growth of
#=GF RT   Saccharomyces cerevisiae.
#=GF RA   Lu L, Roberts G, Simon K, Yu J, Hudson AP;
#=GF RL   Curr Genet. 2003;43:263-272.
#=GF DR   INTERPRO; IPR027998;
#=GF CC   This is a family of transcriptional regulators that determine
#=GF CC   the transition from fermentative activity to growth on glycerol
#=GF CC   [1].
#=GF SQ   12
#=GS G0V747_NAUCC/144-311  AC G0V747.1
#=GS H2ATE6_KAZAF/140-252  AC H2ATE6.1
#=GS E7LYB1_YEASV/1-373    AC E7LYB1.1
#=GS RSF1_YEAST/1-373      AC Q05043.1
#=GS E7Q7N3_YEASB/1-373    AC E7Q7N3.1
#=GS G0W9T7_NAUDC/169-368  AC G0W9T7.1
#=GS E7KSH7_YEASL/1-373    AC E7KSH7.1
#=GS J5RTI8_SACK1/1-379    AC J5RTI8.1
#=GS E7NLE9_YEASO/1-373    AC E7NLE9.1
#=GS G0WDB1_NAUDC/85-196   AC G0WDB1.1
#=GS E7QJ46_YEASZ/1-229    AC E7QJ46.1
#=GS H2AQQ5_KAZAF/56-190   AC H2AQQ5.1
G0V747_NAUCC/144-311             ..................keqttstshphiishrhtlsklekcpkshlpy--------------------------------------------------------------------------------------------------------------------------------.-------------------LTLILPSKT..TLKkkaP.NTFAKFLFAQDPHSENLVCQFHTKSK....HAsSTTCNMILKMGNNsiRRRTQARKCRDHLKMEHGIRVTPTNFLNYLDHDSDVFRRSYTDKVLAMIKPLVESFA-------------------------------------------------------------------------------------------------------------------------vdydlqrmktmqayrelae....
H2ATE6_KAZAF/140-252             .................................kdnlnlsliwskrknkn--------------------------------------------------------------------------------------------------------------------------------.----------------------------..---...-.---PHLMFFSQLDDLTKVCQFYNPIS....HT.ICNYEVVFRDMTE..QRKLAARKCQSHINKYHDLQLDPNSAEKVLKHICPARK--------------------------------------------------------------------------------------------------------------------------------------------dydtlkcivseqekdskdva...
E7LYB1_YEASV/1-373               ..................................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSETPREEMYLAPNKMETRRTLNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV---QRQQQQVVDFIEnNMQLLSSETLNFRSDIMKTLELPIPKRR..DIK...G.NHLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWKDKNS..REKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLXRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSXIAMNDLIEILIDLNIPFSVLDYQPMRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHN----SSNLNNSNSGTPHNHNQNQ.......................
RSF1_YEAST/1-373                 ..................................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETPRILNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV---QRQQQQVVDFIEnNMQLLSSETLNFRSDIMKTLELPIPKRR..DIK...G.NHLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWKDKNS..REKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSKIAMNDLIEILIDLNIPFSVLDYQPMRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHN----SSNLNNSNSGTPHNHNQNQ.......................
E7Q7N3_YEASB/1-373               ..................................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETPRTLNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV---QRQQQQVVDFIEnNMQLLSSETLNFRSDIMKTLELPIPKRR..DIK...G.NHLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWKDKNS..REKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSEIAMNDLIEILIDLNIPFSVLDYQPMRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHN----SSNLNNSNSGTPHNHNQNQ.......................
G0W9T7_NAUDC/169-368             hqeqiqrysssslttvhndvssllsqqnndanntnvqeddpqqlmlsqdi--------------------------------------------------------------------------------------------------------------------------------.------SHLTTFPSSLSKRLSLIIPSKT..TLKkksA.NTFAKFIFAEDRYSDNLICQFYDPNNtnedSS.ICNKIIKMSSKSI..KRRTQARKCKDHLRLEHDIEINPNNYLHYLNHNSELFKKAYTTKTLANVKPLVESF--------------------------------------------------------------------------------------------------------------------------smahdlqkmqnmqayvelse...
E7KSH7_YEASL/1-373               ..................................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSXTPREEMYLAPNKMETXRXLNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV---QRQQQQVVDFIEnNMQLLSSETLNFRSDIMKTLELPIPKRR..DIK...G.NHLSKLLFAKSPLTINTYCQFYXRRT....KR.ICNQEMIWKDKNS..REKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSXIAMNDLIEILIDLNIPFSVLDYQPXRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHN----SSNLNNSNSGTPHNHNQNQ.......................
J5RTI8_SACK1/1-379               ..................................................MNNPNLEMEKFTTTEGQSGDSRSMVDIGTLPNFPCNRSSTPREGNNQTPNKMETPRILDMSMVPDYLQKENFSPEFSSATVSAGSSPVNVTHDECLPSGITGSSGKKGYKHAIKWQQQQQQQVADFME.NMHSLSSGMLCLRSDIMKSLELPVPKRR..DIK...G.NHLSKLLFAKSPLTINTYCQFYDCRT....KC.ICNQEMIWKDKNS..REKHGSRKYQRHLSKVHNVQLTPQNFTQFFDHNSPLFQECYNYQSSLMSDLFIEPDTKAKEKKRKRADDITRNDSETGQSFANRPEQQQNILELQSKIAMNDLIENLIDLSIPFSVLDYQPMRDWLIKYSIISTDTLPDEVYFKADPGVNESEHNRNESNNNISNNISSTPHNHNQNQ.......................
E7NLE9_YEASO/1-373               ..................................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETXRTLNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV---QRQQQQVVDFIEnNMQLLSSETLNFRSDIMKTLELPIPKRR..DIK...G.NHLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWKDKNS..REKHGSRKYQRHLSKVHDVQLTPNNFTEFFDHNSPLFQECYDYQSRLMRDLLVEPDAKFKEKKKKKKGDVNGNHPETGSSLINHQVQQQNVRELQSEIAMNDLIEILIDLNIPFSVLDYQPMRNWLIKYSIISTDTLPDEVYFKTDPGVNELEHN----SSNLNNSNSGTPHNHNQNQ.......................
G0WDB1_NAUDC/85-196              ..................................qrlhlvfpttsnnkkl--------------------------------------------------------------------------------------------------------------------------------.----------------------------..--S...L.KSLSKFVMAERNDSFNYYCQFYDAKK....QQ.TCNQVLEFQTKQS..RTSHQADKCTRHLLEEHNYIPDPMTILYQMDHSSTVFQNAYP----------------------------------------------------------------------------------------------------------------------------------------ndtfqkiqqnf............
E7QJ46_YEASZ/1-229               ..................................................MKDLNPEMGKFATTKGPPQDNRGMVDIATLPNFPANRSGTPREEMYLAPNKMETPRILNMNMVPDYLQKENFSPDFSSATVSAKSSPVNVTHDESLPLGTIESNSTKDSKYAV---QRQQQQVVDFIEnNMQLLSSETLNFRSDIMKTLELPIPKRR..DIK...G.NXLSKLLFAKSPLTINTYCQFYDRRT....KR.ICNQEMIWKDKNS..REKHGSRKYQRHLSKVHDVQLTPNNFTEFF----------------------------------------------------------------------------------------------------------------------------------------------------.......................
H2AQQ5_KAZAF/56-190              ....................................enieienfepnklr--------------------------------------------------------------------------------------------------------------------------------.---------------------LIIPTASnlKIK...TeNVFLKFIFAGYDDSNDLFCQFFNPNT....NL.ICNKRMHFENHKI..KISTMARKCKDHLVKSHNFNINDHNYFKFLNLYYPVFKNSYTE---------------------------------------------------------------------------------------------------------------------------------------dtlnkvlpmleefevvcdsikie
#=GC seq_cons                    .........................................................................................................................................................................................Sthhsh.Ssl.KpLpL.IPp+p..cIK...u.NpLSKLLFAcsPholNpYCQFYDp+T....+p.ICNQEMIaKDKNS..RcKHuuRKhQRHLsKsHDlQLTPNNFpcFhDHsSPlFpcsYs.ps.h..c.hlEs..................................................................................................................................................
//
DBGET integrated database retrieval system