GenomeNet

Database: Pfam
Entry: RTBV_P12
LinkDB: RTBV_P12
Original site: RTBV_P12 
#=GF ID   RTBV_P12
#=GF AC   PF06361.6
#=GF DE   Rice tungro bacilliform virus P12 protein
#=GF AU   Moxon SJ
#=GF SE   Pfam-B_14960 (release 9.0)
#=GF GA   25.00 25.00;
#=GF TC   25.50 67.40;
#=GF NC   23.60 18.10;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   2041739
#=GF RT   An analysis of the sequence of an infectious clone of rice
#=GF RT   tungro bacilliform virus, a plant pararetrovirus. 
#=GF RA   Hay JM, Jones MC, Blakebrough ML, Dasgupta I, Davies JW, Hull R; 
#=GF RL   Nucleic Acids Res 1991;19:2615-2621.
#=GF DR   INTERPRO; IPR009417;
#=GF CC   This family consists of several Rice tungro bacilliform virus
#=GF CC   P12 proteins. The function of this family is unknown [1].
#=GF SQ   11
#=GS Q9YRV8_9VIRU/1-110  AC Q9YRV8.1
#=GS Q8QRL2_9VIRU/1-76   AC Q8QRL2.1
#=GS Q8QRL3_9VIRU/1-34   AC Q8QRL3.1
#=GS Q9WQX7_9VIRU/1-110  AC Q9WQX7.1
#=GS Q77RL9_9VIRU/1-110  AC Q77RL9.1
#=GS Q9YRV5_9VIRU/1-110  AC Q9YRV5.1
#=GS P2_RTBVP/1-110      AC P27499.1
#=GS Q8V6W1_9VIRU/1-110  AC Q8V6W1.1
#=GS Q9WQY3_9VIRU/1-110  AC Q9WQY3.1
#=GS Q91DT4_9VIRU/1-111  AC Q91DT4.1
#=GS O90300_9VIRU/1-110  AC O90300.1
Q9YRV8_9VIRU/1-110             MSADYPTFKESLEKFQNLESDTAAKDKFNWVFTLENIKTTADVNLASKGLVQLYALQEIDKKINNLTAQVSKLPTTSGSGS.AGAIVPAGSNTQGQYKAPPKKGIKRKYPA
Q8QRL2_9VIRU/1-76              -----------------------------------GIKTTADVNLASKGLVQLCALQEIDKKINNLSAQVGKIPTTSGSSSsAGAIVPAGSNTQGQYKAPPKKGIKRKYPG
Q8QRL3_9VIRU/1-34              MSADYPTFKEALEKFKDLESETANKDKFGWVFTL-----------------------------------------------.-----------------------------
Q9WQX7_9VIRU/1-110             MSADYPTFKEALEKFKNLESDTASKDKFNWVFTLENIKTTADVNLASKGLVQLYALQEIDKKINNLTAQVSKLPTTSGSSS.AGAIVPAGSNTQGQYKAPPKKGIKRKYPA
Q77RL9_9VIRU/1-110             MSADYPTFKEALEKFKNLESDTAGKDKFNWVFTLENIKSAADVNLASKGLVQLYALQEIDKKINNLTTQVSKLPTTSGSSS.AGAIVPAGSNTQGQYKAPPKKGIKRKYPA
Q9YRV5_9VIRU/1-110             MSADYPTFKEALEKFQNLESDTAAKDKFNWVFNLENIKTTADVNLASKGLVQLYALQEIDKKINNLTAQVSKLPTTSGSSS.AGAIVPAGSNTQGQYKAPPKKGIKRKYPA
P2_RTBVP/1-110                 MSADYPTFKEALEKFKNLESDTAGKDKFNWVFTLENIKSAADVNLASKGLVQLYALQEIDKKINNLTTQVSKLPTTSGSSS.AGAIVPAGSNTQGQYKAPPKKGIKRKYPA
Q8V6W1_9VIRU/1-110             MSADYPTFKEALEKFKNLESDTAAKDKFNWVFTLENIKTTADVNLASKGLVQLYALQEIDKKINNLTAQVSKLPTTSGSSS.AGTIVPAGSNTQGQYKAPPKKGIKRKYPA
Q9WQY3_9VIRU/1-110             MSADYPTFKEALEKFKNLESDTVSKDKFNWVFTLENIKTTADVNLASKGLVQLYALQEIDKKINNLTAQVSKLPTTSGSSS.AGAIVPAGSNTQGQYKAPPKKGIKRKYPA
Q91DT4_9VIRU/1-111             MSADYPTFKEALEKFKDLESETANKDKFGWVFTLQGIKTTADVNLASKGLVQLYALQEIDKKINNLSAQVGKIPTTSGSSSsAGAIVPAGSNTQGQYKAPPKKGIKRKYPG
O90300_9VIRU/1-110             MSADYPTFKEALEKFKNLESDTAAKDKFNWVFTLENIKTTADINLASKGLVQLYALQEIDKTDDILTTQVSKLPTTSGISS.AGAIVPAGSNTQGQYKAPPKKGIKRKYPA
#=GC seq_cons                  MSADYPTFKEALEKFKNLESDTAuKDKFNWVFTLENIKTTADVNLASKGLVQLYALQEIDKKINNLTAQVSKLPTTSGSSS.AGAIVPAGSNTQGQYKAPPKKGIKRKYPA
//
DBGET integrated database retrieval system