GenomeNet

Database: Pfam
Entry: Rhabdo_M1
LinkDB: Rhabdo_M1
Original site: Rhabdo_M1 
#=GF ID   Rhabdo_M1
#=GF AC   PF03342.11
#=GF DE   Rhabdovirus M1 matrix protein (M1 polymerase-associated protein)
#=GF AU   Mifsud W
#=GF SE   Pfam-B_3629 (release 6.5)
#=GF GA   25.00 25.00;
#=GF TC   533.60 533.40;
#=GF NC   22.20 20.00;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   8291243
#=GF RT   The polymerase-associated protein (M1) and the matrix protein
#=GF RT   (M2) from a virulent and an avirulent strain of viral
#=GF RT   hemorrhagic septicemia virus (VHSV), a fish rhabdovirus. 
#=GF RA   Benmansour A, Paubert G, Bernard J, De Kinkelin P; 
#=GF RL   Virology 1994;198:602-612.
#=GF DR   INTERPRO; IPR005010;
#=GF SQ   1
#=GS PHOSP_IHNVW/1-227  AC Q82681.1
PHOSP_IHNVW/1-227             MSDGEGEQFFNLEGEDILRLESRLKTPRNDGQIGKNPRRRKEDQAPQEEPKKTTRRPDKNKGLSQLEQLILKYVEEESCQDALKDFGGLIANIRQAHQAEMTSHLEKVATEHRANLQALTKSQQEHEKVSKEILSAVIAIRSNLNENHSPLPKPLDPDQVKAARALGFGIGYRTALNVFDRIKGVTPDNAGSQEVKNLAIRAAEEDEYEGSPTFFRKVIDAVKKRMK
#=GC seq_cons                 MSDGEGEQFFNLEGEDILRLESRLKTPRNDGQIGKNPRRRKEDQAPQEEPKKTTRRPDKNKGLSQLEQLILKYVEEESCQDALKDFGGLIANIRQAHQAEMTSHLEKVATEHRANLQALTKSQQEHEKVSKEILSAVIAIRSNLNENHSPLPKPLDPDQVKAARALGFGIGYRTALNVFDRIKGVTPDNAGSQEVKNLAIRAAEEDEYEGSPTFFRKVIDAVKKRMK
//
DBGET integrated database retrieval system