GenomeNet

Database: Pfam
Entry: Rota_NSP3
LinkDB: Rota_NSP3
Original site: Rota_NSP3 
#=GF ID   Rota_NSP3
#=GF AC   PF01665.11
#=GF DE   Rotavirus non-structural protein NSP3
#=GF AU   Bashton M, Bateman A
#=GF SE   Pfam-B_1010 (release 4.1)
#=GF GA   25.00 25.00;
#=GF TC   53.30 53.10;
#=GF NC   24.50 24.10;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   7871749
#=GF RT   Comparative nucleotide and amino acid sequence analysis of the
#=GF RT   sequence- specific RNA-binding rotavirus nonstructural protein
#=GF RT   NSP3. 
#=GF RA   Rao CD, Das M, Ilango P, Lalwani R, Rao BS, Gowda K; 
#=GF RL   Virology 1995;207:327-333.
#=GF RN   [2]
#=GF RM   1326821
#=GF RT   Characterization of an oligomerization domain and RNA-binding
#=GF RT   properties on rotavirus nonstructural protein NS34. 
#=GF RA   Mattion NM, Cohen J, Aponte C, Estes MK; 
#=GF RL   Virology 1992;190:68-83.
#=GF RN   [3]
#=GF RM   9755181
#=GF RT   Rotavirus RNA-binding protein NSP3 interacts with eIF4GI and
#=GF RT   evicts the poly(A) binding protein from eIF4F. 
#=GF RA   Piron M, Vende P, Cohen J, Poncet D; 
#=GF RL   EMBO J 1998;17:5811-5821.
#=GF DR   INTERPRO; IPR002873;
#=GF DR   SCOP; 1knz; fa;
#=GF CC   This family consist of rotaviral non-structural RNA binding
#=GF CC   protein 34 (NS34 or NSP3). The NSP3 protein has been shown to
#=GF CC   bind viral RNA.  The NSP3 protein consists of 3 conserved
#=GF CC   functional domains; a basic region which binds ssRNA, a region
#=GF CC   containing heptapeptide repeats mediating oligomerisation and a
#=GF CC   leucine zipper motif [2]. NSP3 may play a central role in
#=GF CC   replication and assembly of genomic RNA structures [2].
#=GF CC   Rotaviruses have a dsRNA genome and are a major cause cause of
#=GF CC   acute gastroenteritis in the young of many species [1]. The
#=GF CC   rotavirus non-structural protein NSP3 is a sequence-specific RNA
#=GF CC   binding protein that binds the nonpolyadenylated 3' end of the
#=GF CC   rotavirus mRNAs. NSP3 also interacts with the translation
#=GF CC   initiation factor eIF4GI and competes with the poly(A) binding
#=GF CC   protein [3].
#=GF SQ   508
#=GS Q9WAA7_9REOV/5-283    AC Q9WAA7.1
#=GS B7TAD9_9REOV/1-79     AC B7TAD9.1
#=GS D3JXV0_9REOV/5-282    AC D3JXV0.1
#=GS F8TGX7_9REOV/1-329    AC F8TGX7.1
#=GS B6URI5_9REOV/5-282    AC B6URI5.1
#=GS NSP3_ROTH3/5-282      AC A4ZCW4.2
#=GS D1GH69_9REOV/5-282    AC D1GH69.1
#=GS E2J2K1_9REOV/2-279    AC E2J2K1.1
#=GS F5C4S3_9REOV/2-279    AC F5C4S3.1
#=GS D1GHE1_9REOV/2-279    AC D1GHE1.1
#=GS H2DLU6_9REOV/1-262    AC H2DLU6.1
#=GS D1GHI9_9REOV/2-279    AC D1GHI9.1
#=GS Q91ME6_9REOV/291-568  AC Q91ME6.1
#=GS F5C5B5_9REOV/2-279    AC F5C5B5.1
#=GS G1FVL2_9REOV/2-279    AC G1FVL2.1
#=GS D5J9X1_9REOV/5-282    AC D5J9X1.1
#=GS B6SAI2_9REOV/5-282    AC B6SAI2.1
#=GS D1GH09_9REOV/5-282    AC D1GH09.1
#=GS E3W409_9REOV/2-279    AC E3W409.1
#=GS F5C6B0_9REOV/2-279    AC F5C6B0.1
#=GS B0LJD7_9REOV/5-282    AC B0LJD7.1
#=GS F5C4B6_9REOV/2-279    AC F5C4B6.1
#=GS F6MF92_9REOV/5-282    AC F6MF92.1
#=GS B2BRG8_9REOV/5-282    AC B2BRG8.1
#=GS H8ZHZ8_9REOV/5-282    AC H8ZHZ8.1
#=GS NSP3_ROTHT/5-282      AC Q82053.1
#=GS NSP3_ROTHW/5-282      AC Q82054.1
#=GS H8ZHZ0_9REOV/5-282    AC H8ZHZ0.1
#=GS D5GU57_9REOV/5-282    AC D5GU57.1
#=GS G1FW55_9REOV/2-279    AC G1FW55.1
#=GS C7B6T2_9REOV/5-282    AC C7B6T2.1
#=GS D9D7M0_9REOV/5-282    AC D9D7M0.1
#=GS Q71G68_9REOV/5-282    AC Q71G68.1
#=GS D7NN33_9REOV/5-282    AC D7NN33.1
#=GS C6ZNX8_9REOV/240-500  AC C6ZNX8.1
#=GS D1GHK1_9REOV/2-279    AC D1GHK1.1
#=GS H9N190_9REOV/5-282    AC H9N190.1
#=GS D1GHM5_9REOV/5-282    AC D1GHM5.1
#=GS C6ZNX8_9REOV/2-245    AC C6ZNX8.1
#=GS E3W3Z8_9REOV/2-279    AC E3W3Z8.1
#=GS B2BMB6_9REOV/5-282    AC B2BMB6.1
#=GS C6L885_9REOV/5-282    AC C6L885.1
#=GS B2BME9_9REOV/5-282    AC B2BME9.1
#=GS E3UMI3_9REOV/2-279    AC E3UMI3.1
#=GS F5C518_9REOV/2-279    AC F5C518.1
#=GS C7B6S6_9REOV/5-282    AC C7B6S6.1
#=GS F5C664_9REOV/2-279    AC F5C664.1
#=GS D1GG96_9REOV/5-282    AC D1GG96.1
#=GS D1GHN7_9REOV/5-282    AC D1GHN7.1
#=GS Q9IVI3_9REOV/1-56     AC Q9IVI3.1
#=GS H2FJ32_9REOV/5-282    AC H2FJ32.1
#=GS F5CRE5_9REOV/2-279    AC F5CRE5.1
#=GS E3W4X0_9REOV/2-279    AC E3W4X0.1
#=GS B8XQW8_9REOV/5-282    AC B8XQW8.1
#=GS NSP3_ROTSH/5-282      AC A2T3N5.1
#=GS B6SAP8_9REOV/5-282    AC B6SAP8.1
#=GS C3TUM9_ROTHU/5-282    AC C3TUM9.1
#=GS B7TAF0_9REOV/1-75     AC B7TAF0.1
#=GS G3CEQ2_9REOV/4-281    AC G3CEQ2.1
#=GS F5C5U2_9REOV/2-279    AC F5C5U2.1
#=GS D9YRI9_9REOV/5-282    AC D9YRI9.1
#=GS D1GHR1_9REOV/5-282    AC D1GHR1.1
#=GS G1FVW9_9REOV/2-279    AC G1FVW9.1
#=GS C0JLW0_9REOV/5-282    AC C0JLW0.1
#=GS Q85015_9REOV/5-282    AC Q85015.1
#=GS G1FW08_9REOV/2-279    AC G1FW08.1
#=GS F5C797_9REOV/2-279    AC F5C797.1
#=GS F5C4Y3_9REOV/2-279    AC F5C4Y3.1
#=GS Q88292_9REOV/5-282    AC Q88292.1
#=GS B3SRT7_9REOV/2-279    AC B3SRT7.1
#=GS D1GGL5_9REOV/5-282    AC D1GGL5.1
#=GS F5C5W9_9REOV/2-279    AC F5C5W9.1
#=GS E2J343_9REOV/2-279    AC E2J343.1
#=GS F5C566_9REOV/2-279    AC F5C566.1
#=GS C0JLU9_9REOV/5-282    AC C0JLU9.1
#=GS E7CUG6_9REOV/5-282    AC E7CUG6.1
#=GS F5C4U7_9REOV/2-279    AC F5C4U7.1
#=GS Q53IY9_9REOV/5-282    AC Q53IY9.1
#=GS H9N111_9REOV/5-282    AC H9N111.1
#=GS D0TZ90_9REOV/5-282    AC D0TZ90.1
#=GS H9C1C4_9REOV/1-189    AC H9C1C4.1
#=GS I0B175_9REOV/1-208    AC I0B175.1
#=GS F6LP38_9REOV/5-282    AC F6LP38.1
#=GS F5C6H1_9REOV/2-279    AC F5C6H1.1
#=GS NSP3_ROTAD/2-279      AC B3SRS1.1
#=GS C3U202_9REOV/1-101    AC C3U202.1
#=GS NSP3_ROTHC/1-329      AC Q9PY95.1
#=GS G0YY13_9REOV/5-282    AC G0YY13.1
#=GS G3FZF2_9REOV/2-279    AC G3FZF2.1
#=GS Q85013_9REOV/5-282    AC Q85013.1
#=GS H6VV40_9REOV/2-279    AC H6VV40.1
#=GS F5C4G4_9REOV/2-279    AC F5C4G4.1
#=GS B6URJ1_9REOV/5-282    AC B6URJ1.1
#=GS G0YY25_9REOV/5-282    AC G0YY25.1
#=GS F5C506_9REOV/2-279    AC F5C506.1
#=GS C7B6T5_9REOV/5-282    AC C7B6T5.1
#=GS E2EA87_9REOV/5-282    AC E2EA87.1
#=GS F8SZ00_9REOV/2-279    AC F8SZ00.1
#=GS B2CQB0_9REOV/5-282    AC B2CQB0.1
#=GS C0IUY1_9REOV/5-248    AC C0IUY1.1
#=GS C3U208_9REOV/1-100    AC C3U208.1
#=GS B6URK3_9REOV/5-282    AC B6URK3.1
#=GS E2J3A3_9REOV/2-279    AC E2J3A3.1
#=GS D1GG84_9REOV/2-279    AC D1GG84.1
#=GS D1GGS5_9REOV/2-279    AC D1GGS5.1
#=GS F5C4W9_9REOV/2-279    AC F5C4W9.1
#=GS D1GGJ1_9REOV/5-282    AC D1GGJ1.1
#=GS F5C626_9REOV/2-279    AC F5C626.1
#=GS F8UF71_9REOV/5-282    AC F8UF71.1
#=GS F5C5G6_9REOV/2-279    AC F5C5G6.1
#=GS F5CRK5_9REOV/2-279    AC F5CRK5.1
#=GS C7SYG0_9REOV/2-279    AC C7SYG0.1
#=GS D9MWZ7_9REOV/2-279    AC D9MWZ7.1
#=GS C3U209_9REOV/1-100    AC C3U209.1
#=GS NSP3_ROTHP/2-279      AC B3SRV3.1
#=GS F5C6J6_9REOV/2-279    AC F5C6J6.1
#=GS G4XNL8_9REOV/5-282    AC G4XNL8.1
#=GS B7UFA4_9REOV/1-101    AC B7UFA4.1
#=GS F5C6Q5_9REOV/2-279    AC F5C6Q5.1
#=GS H6VLH1_9REOV/5-282    AC H6VLH1.1
#=GS C0IUY1_9REOV/243-503  AC C0IUY1.1
#=GS B2BRH2_9REOV/5-282    AC B2BRH2.1
#=GS F5C6F8_9REOV/2-279    AC F5C6F8.1
#=GS E7CF32_9REOV/1-100    AC E7CF32.1
#=GS E2J2T5_9REOV/2-279    AC E2J2T5.1
#=GS F5C4C9_9REOV/2-279    AC F5C4C9.1
#=GS D1GH81_9REOV/5-282    AC D1GH81.1
#=GS F5C4A5_9REOV/2-279    AC F5C4A5.1
#=GS B2BM94_9REOV/5-282    AC B2BM94.1
#=GS D1GHG5_9REOV/2-279    AC D1GHG5.1
#=GS A3DSI0_9REOV/2-279    AC A3DSI0.1
#=GS F5C4T5_9REOV/2-279    AC F5C4T5.1
#=GS D5J9Y2_9REOV/5-282    AC D5J9Y2.1
#=GS A4ZD82_9REOV/1-195    AC A4ZD82.1
#=GS E2EBU5_9REOV/118-293  AC E2EBU5.1
#=GS B6URI7_9REOV/5-282    AC B6URI7.1
#=GS H2EHT6_9REOV/1-273    AC H2EHT6.1
#=GS D1GGG7_9REOV/2-279    AC D1GGG7.1
#=GS F5C4M5_9REOV/2-279    AC F5C4M5.1
#=GS NSP3_ROTW3/5-282      AC B2BRG4.1
#=GS F5C639_9REOV/2-279    AC F5C639.1
#=GS E3W533_9REOV/2-279    AC E3W533.1
#=GS I1E474_9REOV/1-252    AC I1E474.1
#=GS F5C6P3_9REOV/2-279    AC F5C6P3.1
#=GS F5C4F2_9REOV/2-279    AC F5C4F2.1
#=GS NSP3_ROTS1/5-282      AC P03536.1
#=GS NSP3_ROTS1/5-282      DR PDB; 1KNZ B; 5-153;
#=GS NSP3_ROTS1/5-282      DR PDB; 1KNZ A; 7-163;
#=GS NSP3_ROTS1/5-282      DR PDB; 1KNZ M; 7-163;
#=GS NSP3_ROTS1/5-282      DR PDB; 1LJ2 A; 207-282;
#=GS NSP3_ROTS1/5-282      DR PDB; 1KNZ I; 7-163;
#=GS NSP3_ROTS1/5-282      DR PDB; 1KNZ N; 5-153;
#=GS NSP3_ROTS1/5-282      DR PDB; 1LJ2 B; 206-282;
#=GS NSP3_ROTS1/5-282      DR PDB; 1KNZ D; 5-153;
#=GS NSP3_ROTS1/5-282      DR PDB; 1KNZ C; 7-163;
#=GS NSP3_ROTS1/5-282      DR PDB; 1KNZ J; 5-153;
#=GS C7B6S8_9REOV/5-282    AC C7B6S8.1
#=GS F5C6C2_9REOV/2-279    AC F5C6C2.1
#=GS F5C4E1_9REOV/2-279    AC F5C4E1.1
#=GS F5C759_9REOV/2-279    AC F5C759.1
#=GS B6SAK4_ROTCU/5-282    AC B6SAK4.1
#=GS E2J2G5_9REOV/2-279    AC E2J2G5.1
#=GS B6URJ3_9REOV/5-282    AC B6URJ3.1
#=GS F5C5J9_9REOV/2-279    AC F5C5J9.1
#=GS B6RGK7_9REOV/2-279    AC B6RGK7.1
#=GS H6VLI2_9REOV/5-282    AC H6VLI2.1
#=GS E9NAY9_9REOV/5-282    AC E9NAY9.1
#=GS E3W4R0_9REOV/2-279    AC E3W4R0.1
#=GS D1GHL3_9REOV/5-282    AC D1GHL3.1
#=GS F5C6V4_9REOV/2-279    AC F5C6V4.1
#=GS H8ZHF3_9REOV/1-275    AC H8ZHF3.1
#=GS E5KJH9_9REOV/1-329    AC E5KJH9.1
#=GS A4ZD95_9REOV/2-279    AC A4ZD95.1
#=GS F8SYW7_9REOV/2-279    AC F8SYW7.1
#=GS F6LP49_9REOV/5-282    AC F6LP49.1
#=GS F5C5C7_9REOV/2-279    AC F5C5C7.1
#=GS F1B1F4_9REOV/5-282    AC F1B1F4.1
#=GS F5C531_9REOV/2-279    AC F5C531.1
#=GS D7NN31_9REOV/5-282    AC D7NN31.1
#=GS A3DSL6_9REOV/2-279    AC A3DSL6.1
#=GS F5C7B0_9REOV/2-279    AC F5C7B0.1
#=GS D3HU62_9REOV/5-282    AC D3HU62.1
#=GS D5J9Y9_9REOV/5-282    AC D5J9Y9.1
#=GS F5C4K0_9REOV/2-279    AC F5C4K0.1
#=GS C7B6R2_9REOV/5-282    AC C7B6R2.1
#=GS E2J2I9_9REOV/2-279    AC E2J2I9.1
#=GS F5C555_9REOV/2-279    AC F5C555.1
#=GS NSP3_ROTWI/5-282      AC Q82049.1
#=GS B6URJ6_9REOV/5-282    AC B6URJ6.1
#=GS F5C649_9REOV/2-279    AC F5C649.1
#=GS F5C6E8_9REOV/2-279    AC F5C6E8.1
#=GS D3JIR0_9REOV/5-282    AC D3JIR0.1
#=GS B6SAM6_9REOV/5-282    AC B6SAM6.1
#=GS E3W546_9REOV/2-279    AC E3W546.1
#=GS F5C4P9_9REOV/2-279    AC F5C4P9.1
#=GS E2J2M5_9REOV/2-279    AC E2J2M5.1
#=GS E3W581_9REOV/2-279    AC E3W581.1
#=GS NSP3_ROT41/5-282      AC Q3ZK63.1
#=GS B6SAL5_ROTD9/5-282    AC B6SAL5.1
#=GS F8U677_9REOV/2-279    AC F8U677.1
#=GS F5C5X9_9REOV/2-279    AC F5C5X9.1
#=GS F1B1F3_9REOV/5-282    AC F1B1F3.1
#=GS E2J2X1_9REOV/2-279    AC E2J2X1.1
#=GS B6URI3_9REOV/5-282    AC B6URI3.1
#=GS F8SPX2_9REOV/5-282    AC F8SPX2.1
#=GS C9DQ51_9REOV/5-282    AC C9DQ51.1
#=GS G4XR48_9REOV/5-282    AC G4XR48.1
#=GS F1B1F5_9REOV/5-282    AC F1B1F5.1
#=GS H9C1C3_9REOV/1-189    AC H9C1C3.1
#=GS D1GGC0_9REOV/5-282    AC D1GGC0.1
#=GS F5C4I9_9REOV/2-279    AC F5C4I9.1
#=GS F5C773_9REOV/2-279    AC F5C773.1
#=GS Q9ICZ6_9REOV/1-56     AC Q9ICZ6.1
#=GS E3W4Y6_9REOV/2-279    AC E3W4Y6.1
#=GS H2EHT7_9REOV/1-273    AC H2EHT7.1
#=GS F8SPZ4_9REOV/5-282    AC F8SPZ4.1
#=GS G1FW65_9REOV/2-279    AC G1FW65.1
#=GS G4WMJ2_9REOV/2-279    AC G4WMJ2.1
#=GS E2J269_ROTHU/2-279    AC E2J269.1
#=GS F8SRJ6_9REOV/2-279    AC F8SRJ6.1
#=GS E1CJG5_9REOV/5-282    AC E1CJG5.1
#=GS F1B1F2_9REOV/5-282    AC F1B1F2.1
#=GS E3W4K4_9REOV/2-279    AC E3W4K4.1
#=GS D1GHP9_9REOV/5-282    AC D1GHP9.1
#=GS O55587_9REOV/2-275    AC O55587.1
#=GS NSP3_ROTBU/5-282      AC P04514.1
#=GS Q82047_9REOV/5-282    AC Q82047.1
#=GS NSP3_ROTHS/5-282      AC Q82052.1
#=GS B1NFL1_9REOV/5-282    AC B1NFL1.1
#=GS A3DSJ1_9REOV/2-279    AC A3DSJ1.1
#=GS H2DLU9_9REOV/5-282    AC H2DLU9.1
#=GS E2J355_9REOV/2-279    AC E2J355.1
#=GS F6KWD3_9REOV/5-282    AC F6KWD3.1
#=GS D7NN30_9REOV/5-282    AC D7NN30.1
#=GS Q29U89_9REOV/1-329    AC Q29U89.1
#=GS E2J2R1_9REOV/2-279    AC E2J2R1.1
#=GS F8U666_9REOV/2-279    AC F8U666.1
#=GS E3UMH9_9REOV/2-279    AC E3UMH9.1
#=GS E2J391_9REOV/2-279    AC E2J391.1
#=GS D1GHB7_9REOV/5-282    AC D1GHB7.1
#=GS E3W554_9REOV/2-279    AC E3W554.1
#=GS D2DXN2_9REOV/1-262    AC D2DXN2.1
#=GS NSP3_ROTBS/1-329      AC P34717.1
#=GS F5CRI0_9REOV/2-279    AC F5CRI0.1
#=GS B0LJD8_9REOV/5-282    AC B0LJD8.1
#=GS E7CF41_9REOV/1-100    AC E7CF41.1
#=GS A4ZD72_9REOV/2-270    AC A4ZD72.1
#=GS E7D4P0_9REOV/2-279    AC E7D4P0.1
#=GS D1GGN9_9REOV/2-279    AC D1GGN9.1
#=GS NSP3_ROTHL/5-282      AC A3DSK9.2
#=GS D1GG48_9REOV/2-279    AC D1GG48.1
#=GS E2J3C7_9REOV/2-279    AC E2J3C7.1
#=GS E7CF23_9REOV/1-100    AC E7CF23.1
#=GS E7D6K4_ROTHU/2-279    AC E7D6K4.1
#=GS E2GK16_9REOV/5-282    AC E2GK16.1
#=GS Q29U87_9REOV/1-329    AC Q29U87.1
#=GS A2T3N1_9REOV/5-282    AC A2T3N1.1
#=GS G1FW82_9REOV/2-279    AC G1FW82.1
#=GS D1GHF3_9REOV/5-282    AC D1GHF3.1
#=GS F5C6D6_9REOV/2-279    AC F5C6D6.1
#=GS Q719L5_9REOV/5-282    AC Q719L5.1
#=GS D1GGE4_9REOV/2-279    AC D1GGE4.1
#=GS A3DSK2_9REOV/2-279    AC A3DSK2.1
#=GS F5C5V7_9REOV/2-279    AC F5C5V7.1
#=GS C7B6R8_9REOV/5-282    AC C7B6R8.1
#=GS G4WMK3_9REOV/5-282    AC G4WMK3.1
#=GS NSP3_ROTHK/5-282      AC Q82050.1
#=GS A2T3N2_9REOV/5-282    AC A2T3N2.1
#=GS F5C590_9REOV/2-279    AC F5C590.1
#=GS H6UF93_9REOV/1-265    AC H6UF93.1
#=GS I0B174_9REOV/1-250    AC I0B174.1
#=GS F5C5Z1_9REOV/2-279    AC F5C5Z1.1
#=GS D3G8E9_9REOV/2-279    AC D3G8E9.1
#=GS F5C616_9REOV/2-279    AC F5C616.1
#=GS D7NN32_9REOV/5-282    AC D7NN32.1
#=GS D1GG60_9REOV/2-279    AC D1GG60.1
#=GS E3W510_9REOV/2-279    AC E3W510.1
#=GS NSP3_ROTH6/5-282      AC Q82051.1
#=GS E9K9T7_9REOV/5-282    AC E9K9T7.1
#=GS B6URI0_9REOV/5-282    AC B6URI0.1
#=GS NSP3_ROTP5/5-282      AC Q85014.1
#=GS E3W4E3_9REOV/2-279    AC E3W4E3.1
#=GS E2J2F3_9REOV/2-279    AC E2J2F3.1
#=GS G0YVY2_9REOV/5-282    AC G0YVY2.1
#=GS F5C4L3_9REOV/2-279    AC F5C4L3.1
#=GS B6URI1_9REOV/5-282    AC B6URI1.1
#=GS B6URK4_9REOV/5-282    AC B6URK4.1
#=GS NSP3_ROTH7/2-279      AC B3SRR3.1
#=GS B6SAJ3_9REOV/5-282    AC B6SAJ3.1
#=GS F5C604_9REOV/2-279    AC F5C604.1
#=GS F5C5D9_9REOV/2-279    AC F5C5D9.1
#=GS H9LJA6_9REOV/2-279    AC H9LJA6.1
#=GS E3W480_9REOV/2-279    AC E3W480.1
#=GS B2BM83_9REOV/5-282    AC B2BM83.1
#=GS F5C5H5_9REOV/2-279    AC F5C5H5.1
#=GS D1L621_9REOV/2-279    AC D1L621.1
#=GS F6MF82_9REOV/1-260    AC F6MF82.1
#=GS E3W521_9REOV/2-279    AC E3W521.1
#=GS D1GGM7_9REOV/5-282    AC D1GGM7.1
#=GS Q91ME6_9REOV/2-279    AC Q91ME6.1
#=GS NSP3_ROTHD/5-282      AC A1YTU9.1
#=GS F5C6U2_9REOV/2-279    AC F5C6U2.1
#=GS D2CSV2_ROTHU/1-265    AC D2CSV2.1
#=GS B5APV2_9REOV/5-282    AC B5APV2.1
#=GS F5C5A1_9REOV/2-279    AC F5C5A1.1
#=GS G9JLW3_9REOV/2-279    AC G9JLW3.1
#=GS E2J2N7_9REOV/2-279    AC E2J2N7.1
#=GS A0MD57_9REOV/5-282    AC A0MD57.1
#=GS Q29U88_9REOV/1-329    AC Q29U88.1
#=GS F5C4V9_9REOV/2-279    AC F5C4V9.1
#=GS D1GHC9_9REOV/5-282    AC D1GHC9.1
#=GS D5J9V5_9REOV/2-249    AC D5J9V5.1
#=GS B1NFL3_9REOV/5-282    AC B1NFL3.1
#=GS E3W5A6_9REOV/2-279    AC E3W5A6.1
#=GS C3RX23_9REOV/5-282    AC C3RX23.1
#=GS A3DSF8_9REOV/2-279    AC A3DSF8.1
#=GS D1GH93_9REOV/2-279    AC D1GH93.1
#=GS NSP3_ROTRF/5-282      AC Q86504.1
#=GS F5C480_9REOV/2-279    AC F5C480.1
#=GS D7NN29_9REOV/5-282    AC D7NN29.1
#=GS F5C4Z5_9REOV/2-279    AC F5C4Z5.1
#=GS B2WWU8_9REOV/2-279    AC B2WWU8.1
#=GS B7SY74_9REOV/2-279    AC B7SY74.1
#=GS F5C7D2_9REOV/2-279    AC F5C7D2.1
#=GS B6URK0_9REOV/5-282    AC B6URK0.1
#=GS G1CDA6_9REOV/5-282    AC G1CDA6.1
#=GS G1FWD8_9REOV/2-279    AC G1FWD8.1
#=GS G1FW29_9REOV/2-279    AC G1FW29.1
#=GS Q9IVI1_9REOV/1-56     AC Q9IVI1.1
#=GS D1GGA8_9REOV/2-279    AC D1GGA8.1
#=GS Q9IVI0_9REOV/1-56     AC Q9IVI0.1
#=GS F5C702_9REOV/2-279    AC F5C702.1
#=GS D1GGD2_9REOV/2-279    AC D1GGD2.1
#=GS D1GHA5_9REOV/2-279    AC D1GHA5.1
#=GS E9NAZ0_9REOV/5-282    AC E9NAZ0.1
#=GS E8ZBR1_9REOV/2-279    AC E8ZBR1.1
#=GS D1GGU9_9REOV/5-282    AC D1GGU9.1
#=GS F5CRJ8_9REOV/2-279    AC F5CRJ8.1
#=GS D7NN28_9REOV/5-282    AC D7NN28.1
#=GS G1FW21_9REOV/2-279    AC G1FW21.1
#=GS NSP3_ROTBN/5-282      AC Q65701.1
#=GS G8FNI6_9REOV/5-282    AC G8FNI6.1
#=GS F5C7E6_9REOV/2-279    AC F5C7E6.1
#=GS D1GG36_9REOV/5-282    AC D1GG36.1
#=GS B2BMA5_9REOV/5-282    AC B2BMA5.1
#=GS F5C579_9REOV/2-279    AC F5C579.1
#=GS E2J331_9REOV/2-279    AC E2J331.1
#=GS NSP3_ROTAM/2-279      AC Q9ICB2.1
#=GS Q9IVH7_9REOV/1-56     AC Q9IVH7.1
#=GS H8ZHF2_9REOV/1-217    AC H8ZHF2.1
#=GS B6URI9_9REOV/5-282    AC B6URI9.1
#=GS F5C687_9REOV/2-279    AC F5C687.1
#=GS D1GH33_9REOV/5-282    AC D1GH33.1
#=GS E3W570_9REOV/2-279    AC E3W570.1
#=GS NSP3_ROTS4/5-282      AC Q00721.1
#=GS E3W459_9REOV/2-279    AC E3W459.1
#=GS D1GGR3_9REOV/2-279    AC D1GGR3.1
#=GS F5C748_9REOV/2-279    AC F5C748.1
#=GS G8FNI5_9REOV/5-282    AC G8FNI5.1
#=GS I1E4A9_9REOV/2-279    AC I1E4A9.1
#=GS F5C6S9_9REOV/2-279    AC F5C6S9.1
#=GS D3JTT9_9REOV/1-250    AC D3JTT9.1
#=GS D6N168_9REOV/5-282    AC D6N168.1
#=GS E8ZBR2_9REOV/2-279    AC E8ZBR2.1
#=GS F5C6X8_9REOV/2-279    AC F5C6X8.1
#=GS D1GGF5_9REOV/2-279    AC D1GGF5.1
#=GS D1GH21_9REOV/5-282    AC D1GH21.1
#=GS G4WMH0_9REOV/5-282    AC G4WMH0.1
#=GS D1GHH7_9REOV/2-279    AC D1GHH7.1
#=GS E3W4U6_9REOV/2-279    AC E3W4U6.1
#=GS F5C6N1_9REOV/2-279    AC F5C6N1.1
#=GS B2BMC7_9REOV/5-282    AC B2BMC7.1
#=GS E9NIB3_9REOV/5-282    AC E9NIB3.1
#=GS D7F7N0_9REOV/2-279    AC D7F7N0.1
#=GS B3SRW1_9REOV/2-279    AC B3SRW1.1
#=GS C7SB28_9REOV/2-279    AC C7SB28.1
#=GS C7B6R5_9REOV/5-282    AC C7B6R5.1
#=GS H6B4C9_9REOV/5-282    AC H6B4C9.1
#=GS F5C4N7_9REOV/2-279    AC F5C4N7.1
#=GS F5C5N5_9REOV/2-279    AC F5C5N5.1
#=GS C3U206_9REOV/1-100    AC C3U206.1
#=GS B2BRF2_9REOV/5-282    AC B2BRF2.1
#=GS E7D6K9_ROTHU/2-279    AC E7D6K9.1
#=GS B7TAC8_9REOV/1-76     AC B7TAC8.1
#=GS F5C543_9REOV/2-279    AC F5C543.1
#=GS E5FXI4_9REOV/5-282    AC E5FXI4.1
#=GS D3K8X9_9REOV/5-282    AC D3K8X9.1
#=GS F5C6Z0_9REOV/2-279    AC F5C6Z0.1
#=GS F5C5I7_9REOV/2-279    AC F5C5I7.1
#=GS H6VLJ3_9REOV/5-282    AC H6VLJ3.1
#=GS NSP3_ROTRH/5-282      AC Q8UZL8.1
#=GS G1FVY4_9REOV/2-279    AC G1FVY4.1
#=GS D1GGY5_9REOV/2-279    AC D1GGY5.1
#=GS F5C5Q8_9REOV/2-279    AC F5C5Q8.1
#=GS D1GGZ7_9REOV/2-279    AC D1GGZ7.1
#=GS B6URJ5_9REOV/5-282    AC B6URJ5.1
#=GS F5CRF7_9REOV/2-279    AC F5CRF7.1
#=GS G3FZH4_9REOV/5-282    AC G3FZH4.1
#=GS E7CF50_9REOV/1-100    AC E7CF50.1
#=GS E2J2Y3_9REOV/2-279    AC E2J2Y3.1
#=GS D1GH57_9REOV/2-279    AC D1GH57.1
#=GS H6B4E0_9REOV/5-282    AC H6B4E0.1
#=GS Q9IVH9_9REOV/1-56     AC Q9IVH9.1
#=GS C3U207_9REOV/1-100    AC C3U207.1
#=GS F5C5F1_9REOV/2-279    AC F5C5F1.1
#=GS F5C785_9REOV/2-279    AC F5C785.1
#=GS C0JLT8_9REOV/5-282    AC C0JLT8.1
#=GS C7B6S2_9REOV/5-282    AC C7B6S2.1
#=GS H9LI51_9REOV/1-169    AC H9LI51.1
#=GS B2CQB4_9REOV/5-282    AC B2CQB4.1
#=GS I0B172_9REOV/1-251    AC I0B172.1
#=GS F6LR29_9REOV/5-282    AC F6LR29.1
#=GS E2J3B5_9REOV/2-279    AC E2J3B5.1
#=GS Q82048_9REOV/5-282    AC Q82048.1
#=GS F5C676_9REOV/2-279    AC F5C676.1
#=GS H9C1C5_9REOV/1-189    AC H9C1C5.1
#=GS D1GGX3_9REOV/5-282    AC D1GGX3.1
#=GS E5KJJ0_9REOV/1-329    AC E5KJJ0.1
#=GS B2CQA9_9REOV/5-282    AC B2CQA9.1
#=GS F5C6K7_9REOV/2-279    AC F5C6K7.1
#=GS F5C5P5_9REOV/2-279    AC F5C5P5.1
#=GS E2EA98_9REOV/5-282    AC E2EA98.1
#=GS Q9IVH8_9REOV/1-56     AC Q9IVH8.1
#=GS F5C5L1_9REOV/2-279    AC F5C5L1.1
#=GS E2J2P9_9REOV/2-279    AC E2J2P9.1
#=GS C7B6S9_9REOV/5-282    AC C7B6S9.1
#=GS E7BKX2_9REOV/5-282    AC E7BKX2.1
#=GS F8U688_9REOV/2-279    AC F8U688.1
#=GS B2CQB2_9REOV/5-282    AC B2CQB2.1
#=GS D1GGW1_9REOV/2-279    AC D1GGW1.1
#=GS F5C6I4_9REOV/2-279    AC F5C6I4.1
#=GS G1CDD0_9REOV/5-282    AC G1CDD0.1
#=GS G1FWA6_9REOV/2-279    AC G1FWA6.1
#=GS E3W4G3_9REOV/2-279    AC E3W4G3.1
#=GS F5C694_9REOV/2-279    AC F5C694.1
#=GS F5C6M0_9REOV/2-279    AC F5C6M0.1
#=GS G1FVM6_9REOV/2-279    AC G1FVM6.1
#=GS C3U205_9REOV/1-100    AC C3U205.1
#=GS E3W4H6_9REOV/2-279    AC E3W4H6.1
#=GS Q8UZL7_9REOV/5-282    AC Q8UZL7.1
#=GS Q82046_9REOV/5-282    AC Q82046.1
#=GS F5C5T1_9REOV/2-279    AC F5C5T1.1
#=GS G3G3W4_9REOV/5-282    AC G3G3W4.1
#=GS E3UMI0_9REOV/2-279    AC E3UMI0.1
#=GS F5CRG8_9REOV/2-279    AC F5CRG8.1
#=GS F8SPY3_9REOV/5-282    AC F8SPY3.1
#=GS E3UMI2_9REOV/2-279    AC E3UMI2.1
#=GS D1GG12_9REOV/2-279    AC D1GG12.1
#=GS D1GG00_9REOV/2-279    AC D1GG00.1
#=GS F5C726_9REOV/2-279    AC F5C726.1
#=GS G3FZG3_9REOV/5-282    AC G3FZG3.1
#=GS E3W5E1_9REOV/2-279    AC E3W5E1.1
#=GS B2BRG0_9REOV/5-282    AC B2BRG0.1
#=GS C0J9W4_9REOV/5-282    AC C0J9W4.1
#=GS F5C6W3_9REOV/2-279    AC F5C6W3.1
#=GS D3JTU0_9REOV/1-250    AC D3JTU0.1
#=GS F5C493_9REOV/2-279    AC F5C493.1
#=GS F5C469_9REOV/2-279    AC F5C469.1
#=GS Q9IVI2_9REOV/1-56     AC Q9IVI2.1
#=GS F5C5M2_9REOV/2-279    AC F5C5M2.1
#=GS D1GGQ1_9REOV/5-282    AC D1GGQ1.1
#=GS G0YZG9_9REOV/5-282    AC G0YZG9.1
#=GS B6URK5_9REOV/5-282    AC B6URK5.1
#=GS C3U203_9REOV/1-101    AC C3U203.1
#=GS E2J319_9REOV/2-279    AC E2J319.1
#=GS E7CF14_9REOV/1-100    AC E7CF14.1
#=GS NSP3_ROTPC/1-329      AC P27586.1
#=GS E9NIC2_9REOV/5-282    AC E9NIC2.1
#=GS A3DSG9_9REOV/2-279    AC A3DSG9.1
#=GS H6B4F1_9REOV/5-282    AC H6B4F1.1
#=GS D1GGT7_9REOV/2-279    AC D1GGT7.1
#=GS E5KJH0_9REOV/1-329    AC E5KJH0.1
#=GS C3TTS4_9REOV/2-273    AC C3TTS4.1
#=GS H9LGH1_9REOV/1-262    AC H9LGH1.1
#=GS D1GG24_9REOV/5-282    AC D1GG24.1
#=GS F5C4H6_9REOV/2-279    AC F5C4H6.1
#=GS E3UMI1_9REOV/2-279    AC E3UMI1.1
#=GS D5LG78_9REOV/5-282    AC D5LG78.1
#=GS D1GG72_9REOV/2-279    AC D1GG72.1
#=GS G1FVT6_9REOV/2-279    AC G1FVT6.1
#=GS E3W4T8_9REOV/2-279    AC E3W4T8.1
#=GS Q5Q1N5_9REOV/5-282    AC Q5Q1N5.1
#=GS C7SYE8_9REOV/2-279    AC C7SYE8.1
#=GS E3W4V8_9REOV/2-279    AC E3W4V8.1
#=GS H8ZHF1_9REOV/1-273    AC H8ZHF1.1
#=GS F5C7C0_9REOV/2-279    AC F5C7C0.1
#=GS E2J2L3_9REOV/2-279    AC E2J2L3.1
#=GS B6URJ9_9REOV/5-282    AC B6URJ9.1
#=GS Q9IVH6_9REOV/1-56     AC Q9IVH6.1
#=GS F5C4R0_9REOV/2-279    AC F5C4R0.1
#=GS E2J367_9REOV/2-279    AC E2J367.1
#=GS F5C5R9_9REOV/2-279    AC F5C5R9.1
#=GS E8ZBR3_9REOV/2-279    AC E8ZBR3.1
#=GS B6SAN7_9REOV/5-282    AC B6SAN7.1
#=GS E5E7S2_9REOV/2-280    AC E5E7S2.1
#=GS C3U204_9REOV/1-100    AC C3U204.1
#=GS H9N1B2_9REOV/5-282    AC H9N1B2.1
#=GS E2J379_9REOV/2-279    AC E2J379.1
#=GS D1GH45_9REOV/5-282    AC D1GH45.1
#=GS Q1L7J7_9REOV/5-282    AC Q1L7J7.1
#=GS E3W4M8_9REOV/2-279    AC E3W4M8.1
#=GS F5C735_9REOV/2-279    AC F5C735.1
#=GS F6MF71_9REOV/5-282    AC F6MF71.1
#=GS F5C6R8_9REOV/2-279    AC F5C6R8.1
#=GS F5C714_9REOV/2-279    AC F5C714.1
#=GS H9N1A0_9REOV/5-282    AC H9N1A0.1
#=GS Q1WK40_9REOV/5-282    AC Q1WK40.1
#=GS C5IAV4_9REOV/5-282    AC C5IAV4.1
#=GS E3W5D0_9REOV/2-279    AC E3W5D0.1
#=GS Q9IM70_9REOV/2-279    AC Q9IM70.1
#=GS D1GGH9_9REOV/5-282    AC D1GGH9.1
#=GS E9NAZ1_9REOV/5-282    AC E9NAZ1.1
#=GS C7B6T4_9REOV/5-282    AC C7B6T4.1
#=GS I0B173_9REOV/1-248    AC I0B173.1
#=GS C4MQ12_ROTHU/5-282    AC C4MQ12.1
#=GS D4PBN0_9REOV/2-279    AC D4PBN0.1
#=GS B8Y8B5_9REOV/5-282    AC B8Y8B5.1
#=GS D1GGK3_9REOV/2-279    AC D1GGK3.1
Q9WAA7_9REOV/5-283               .........ESTQQMASSIINASFEAAVVAATSTLELMGIQYDYNE.VYARVKSKFDYIMDDSGVKNNLLGKAATIEQALNGKFGSAARNRNLMADTRTTARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKQRV...........NEKYTSWV.....QKAQKVNENMYSLQNVISQQQNQIAD...LQHYCNKLEVES..YKIKSSSQVSSVEWYMKSMELPDEVKTDIEQQLNSIDVINPINAIDAFE.............................
B7TAD9_9REOV/1-79                .........-------------------------------QYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGID-----------------------.......................--------------.------.-----------...---------------------...........--------.....--------------------------...------------..-------------------------------------------------.............................
D3JXV0_9REOV/5-282               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSTIRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKARYDQLEKRFESLKQRV...........NEKYNSWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKISSLVSSVEWYLRSMELSDDVKTDIEQQLNSIDAINPINAIDDLE.............................
F8TGX7_9REOV/1-329               .........MATQASVEWIFNVAGSAASSSLDRAIKDAGGSESFSKyVIAKFYDNYKNCIDDSGVYNACIGRAKTIDKALNNP-KAAERNEEWYTNVATISRLDLELAELKLMLSNLGIKREERVLNSMFSVVREKGRSSNVImmkqnavkmieegklkikverneTYTESLKNKIEELEcIIDAFE.KGKDITIDLDA...MNGEVKLDGNSCSYNATAAFVstilgtpikmyNESGQPLFdvgnyMNPKTIIEKMTELEIPIFKSDYRNDEspdFDGWNERSNLKI..ISVNDCHAICIFKFENYWWCFDDGRLKKHNGTGYPLIVANSKFQIDKI-lisgdie......................
B6URI5_9REOV/5-282               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSTIRMRSWMLDSKTVAKLDEDVNNLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKARYDQLEKRFESLKQRV...........NEKYNSWV.....QKTKEVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKISSLVSSVEWYLRSMELSDDVKTDIEQQLNSIDAINPINAIDDLE.............................
NSP3_ROTH3/5-282                 .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDLVMDDSGVKNNLMGKAITIDQALNGKFGSAIRNRNWMADSRTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRVPGKSSSIV.......................KCTKLMKDKLERGE.-VEVDD.SFVEEKMEVDT...INWKLRYDQLEKRFESLKHRV...........NEKYNTWV.....VKARKVNENMNSLQNVISQQQAHINE...LQMYNNKLE-RD..LQSKIGSVVSSIEWYLRSMELSDDVKVDIEQQLNSIDQLNPVNAIDDFE.............................
D1GH69_9REOV/5-282               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAMTIDQALNGKFGSVVRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNNWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQQYCSKLE-ND..LQNKISSLVSSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
E2J2K1_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMSIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTIAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C4S3_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKLRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D1GHE1_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKTDIEQQLNSIDLINPINAIDDIE.............................
H2DLU6_9REOV/1-262               .........----------------AAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSAVRNRNWMADTRTIARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKQRV...........NEKYTSWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQHYCNKLE-VD..LQNKISSLVSSVEWYMKSMELPDEVKTDIEQQLNSIDVINPINAIDDFE.............................
D1GHI9_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFEALKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
Q91ME6_9REOV/291-568             ....rtflm-----LVSSIINTSFESAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C5B5_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGVQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
G1FVL2_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLKSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D5J9X1_9REOV/5-282               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKNKFDYVMDDSGVKNNLLGKAITIDQALNGRFGSAVRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........SEKYNNWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCSKLE-AD..LQGKISSLVSSVEWYLRSMELSDDVKTDIEQQLNSIDAINPINAIDDLE.............................
B6SAI2_9REOV/5-282               .........ESTQQMATSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDLIMDDSGVKNNLMGKATTIDQALNGKFNSAIRNRNWMTDSRTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSIV.......................KCTRLMKDKLERGE.-VEVDD.SFVEEKMEIDT...IDWKLRYEQLEKRFESLKHRV...........NEKYNNWV.....IKARKVNENMNSLQNVISQQQAHINE...LQMYNNKLE-RD..LQSKIGSVVSSIEWYLRSMELSDDVKADIEQQLNSIDQLNPVNAMDDFE.............................
D1GH09_9REOV/5-282               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAMTIDQALNGKFGSVVRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNNWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQQYCSKLE-ND..LQNKISSLVTSVEWYLRSMELSDDIKNDIEQQLNSIDAINPINAIDDFE.............................
E3W409_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C6B0_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYIDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
B0LJD7_9REOV/5-282               .........ESTRQMVDSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMGDSGVKNNLLGKAATIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKARYDQLEKRFESLKQRV...........NEKYNSWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKISSLVSSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
F5C4B6_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F6MF92_9REOV/5-282               .........ESTQQMVGSIVNTSFEAAVVAATSTLELMGVQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSAMRNRNWMTDSKTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNSWV.....HKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQNKINSLVSSIEWYLRSMELSDDVKTDIEQQLNSIDAINPINAIDDLE.............................
B2BRG8_9REOV/5-282               .........ESTQQMATSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYVIDDSGVKNNLLGKAATIDQALNGKFGSAARNRNWMADTRTTARLDEDVNKLRMMLSSKGIDQKIRVLNACFNVKRVPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRLDSLKQRV...........NEKYTSWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQNYCNKLE-VD..LHNKISSLVSSVEWYLKSMELPDEIKTDIEHQLNSIDVINPINAIDDFE.............................
H8ZHZ8_9REOV/5-282               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAMTIDQALNGKFGSVMRNRNWMTDSKTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGE.-VEVDD.SFVDEKMEVDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNSWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKIGSLVSSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
NSP3_ROTHT/5-282                 .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIAQALNGKFGSAIRNRNWMSDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKTDIEQQLNSIDLINPINAIDDIE.............................
NSP3_ROTHW/5-282                 .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIAQALNGKFGSAIRNRNWMTDSKTVAKLDEDVSKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIEGGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFEALKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQISD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDAINPINAIDDIE.............................
H8ZHZ0_9REOV/5-282               .........ESTQQMVGSVINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAMTIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGE.-VEVDD.SFVDEKMEVDT...IDWKSRYDQLEKRFESLKQRV...........NEKYSSWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-TD..LQNKISSLVSSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
D5GU57_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.IYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSAARNRNWMTDTRTTARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKQRV...........NEKYTNWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQHYCNKLE-VD..LQNKISSLVSSVEWYMKSMELPDEVKTDIEQQLNSIDVINPINAIDDFE.............................
G1FW55_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGVQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKFNSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
C7B6T2_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAVDDIE.............................
D9D7M0_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSAVRNRNWMADTRTIARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKQRV...........NEKYTSWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQHYCNKLE-VD..LQNKISSLVSSVEWYMKSMELPDEVKTDIEQQLNSIDVINPINAIDDFE.............................
Q71G68_9REOV/5-282               .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDFVMDDSGVKNNLIGKAATIDQALNGKFSSSIRNRNWMTDSKTVARLDEDVNKLRLLLSSKGIDQKMRVLNACFNVKRVPGKSSSII.......................KCTRLMKEKIERGE.-VEVDD.AFIEEKMEIDT...IDWKSRYDQLERRFESLKQRV...........NEKYNNWV.....IKARKVNENMNSLQNVISQQQAHINE...LQIYNNKLE-RD..LQSKIGSVISSIEWYLRSMELSDDIKSDIEQQLNSIDHINPVNAFDDFE.............................
D7NN33_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.IYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSVMRNKNWMTDSRTVAKLDEDVNKLRMMLSSKGIDQKMRLLNPCFSVKRIPGKSSSVI.......................KCTRLMKDKIERGA.-VEVDD.SFAEEKMEVDT...VDWKSRYDQLERRFESLKQRV...........NEKYTTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQNYCSKLE-AD..LQNKVGSLVSSVEWYLKSMELPDEVKTDIEQQLNSIDTISPINAIDDLE.............................
C6ZNX8_9REOV/240-500             .......ss-------------------IDATSALENMGIEYDYQD.IYSRVKNKFDFVMDDSGVKNNLIGKAITIDQALNNKFGSAIRNRNWLADTSRAAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMRDKLERGE.-VEVDD.SFVDEKMEVDT...IDWKSRYEQLEQRFESLKSRV...........NEKYNNWV.....LKARKMNENMHSLQNVISQQQAHIAE...LQVYNNKLE-RD..LQNKIGSLTSSIEWYLRSMELDPEIKADIEQQINSIDAINPLHAFDDLE.............................
D1GHK1_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVVATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKTDIEQQLNSIDLINPINAIDDIE.............................
H9N190_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSAARNRNWMADTRTTARLDEDVNKLRMMLSSKGIDQKMRVLNACFNVKRVPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKQRV...........NEKYTSWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQNYCNKLE-VD..LQNKISSLVSSVEWYLKSMELPDEIKTDIEQQLNSIDVINPINAIDDFE.............................
D1GHM5_9REOV/5-282               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAMTIDQALNGKFGSVVRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNNWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQQYCSKLE-ND..LQNKISSLVTSVEWYLRSMELSDDIKNDIEQQLNSIDAINPINAIDDFE.............................
C6ZNX8_9REOV/2-245               .........ESTQQMAVSIINSSFEAAVVAATSALENMGIEYDYQD.IYSRVKNKFDFVMDDSGVKNNLIGKAITIDQALNNKFGSAIRNRNWLADTSRAAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMRDKLERGE.-VEVDD.SFVDEKMEVDT...IDWKSRYEQLEQRFESLKSRV...........NEKYNNWV.....LKARKMNENMHSLQNVISQQQAHIAE...LQVYNNKLE-RD..LQNKIGSLTSSID------------------------------------at...........................
E3W3Z8_9REOV/2-279               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAVDDIE.............................
B2BMB6_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSAARNRNWMADTRTTARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKQRV...........NEKYTSWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQHYCNKLE-VD..LQNKISSLVSSVEWYMKSMELPDEVKTDIEQQLNSIDVINPINAIDDFE.............................
C6L885_9REOV/5-282               .........ESTQQMAISIINSSFEAAVVAATSTLELMGIEYDYNE.VYTRVKSKFDYVMDDSGVKNNLIGKAITVDQALNGRFSSAIRNRNWMSDSRTVAKLDEDVNKLRIMLSSKGIDQKMRVLNACFSVKRTPGKSSSII.......................KCTKLMKDKLERGE.-VEVDD.SFVDEKMDVDS...IDWKARYDQLEKRFESLKQRV...........NEKYNNWV.....YKAKKVNENMHSLQDVIARQQAYIND...LQIHNNKLE-KD..LQNKVNSLASSVEWYLRSMELPEEIKSDIEQQINSIDLINPVNAIDDLE.............................
B2BME9_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSAARNRNWMADTRTTARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SFVEEKMEVDT...TDWKSRYEQLEKRFESLKQRV...........NEKYTSWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQHYCNKLE-VD..LQNKISSLVSSVEWYMKSMELPDEVKTDIEQQLNSIDVINPINAIDDFE.............................
E3UMI3_9REOV/2-279               .........ESTQQMASSIINSAFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDFVMDDSGVKNNLIGKAATIDQALNGKFSSSIRNRNWMTDSKTVARLDEDVNKLRLLLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCSRLMKEKIERGE.-VEVDD.AFIEEKMEIDT...IDWKSRYDQLERRFESLKQRV...........NEKYNNWV.....IKARKVNENMNSLQNVISQQQAHINE...LQIYNNKLE-RD..LQSKIGSVISSIEWYLRSMELSDDIKSDIEQQLNSIDHINPVNAFDDFE.............................
F5C518_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMKDKIERGE.-VEVDD.SYIDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-TD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
C7B6S6_9REOV/5-282               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQQMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQDKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C664_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D1GG96_9REOV/5-282               .........ESTQQMVNSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAVTIDQALNGKFSSAVRNRNWMTDSKTVAKLDEDVNKLRMMLSSKGIDQRMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........SEKYNNWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-TD..LQNKISLLVSSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
D1GHN7_9REOV/5-282               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAMTIDQALNGKFGSVVRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNNWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQQYCSKLE-ND..LQNKISSLVTSVEWYLRSMELSDDIKNDIEQQLNSIDAINPINAIDDFE.............................
Q9IVI3_9REOV/1-56                .........-------------------------------------.------------------------------------------------------------------------------------------------.......................--------------.------.-----------...---------------------...........--------.....--------------------------...----CNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDVEQQLNSIDLINPINAIDDIE.............................
H2FJ32_9REOV/5-282               .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDFVMDDSGVKNNLMGKAVTIDQALNGKFSSAIRNRNWMTDSQTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSIV.......................KCTKLMKNKLERGE.-VEVDD.SFIEEKMETDT...IDWKLRYEHLEKRFESLKLRV...........NEKYNNWV.....IKARKVNENMNSLQNIISQQQAHINE...LQMYNNKLE-RD..LQSKIGSVVSSIEWYLRSMELSDDVKSDIEQQLNSIDQLNPVNALDDFE.............................
F5CRE5_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAN...LQQYCNNLE-AD..LQGKFSSLVSSVEWYLRSMELPNDVKNDIEQQLNSIDLINPINAIDDIE.............................
E3W4X0_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFELLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
B8XQW8_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSAARNRNWMADTRTTARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKQRV...........NEKYTSWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQNYCNKLE-VD..LQNKISSLVSSVEWYLKSMELPDEIKTDIEQQLNSIDVINPINAIDDFE.............................
NSP3_ROTSH/5-282                 .........ESTQQMAVSIINSSFEAAVVAATSALENMGIEYDYQD.IYSRVKNKFDFVMDDSGVKNNLIGKAITIDQALNNKFGSAIRNRNWLADTSRAAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMRDKLERGE.-VEVDD.SFVDEKMEVDT...IDWKSRYEQLEQRFESLKSRV...........NEKYNNWV.....LKARKMNENMHSLQNVISQQQAHIAE...LQVYNNKLE-RD..LQNKIGSLTSSIEWYLRSMELDPEIKADIEQQINSIDAINPLHAFDDLE.............................
B6SAP8_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSAARNRNWMTDTRTTARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SFVEEKMEVAT...IDWKSRYEQLEKRFESLKQRV...........NEKYTSWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQHYCNKLE-VD..LQNKISSLVSAVEWYMKSMELPDEVKTDIEQQLNSIDVINPINAIDDLE.............................
C3TUM9_ROTHU/5-282               .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDFVMDDSGVKNNLIGKAATIDQALNGKFSSSIRNRNWMTDSKTVARLDEDVNKLRLLLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMKEKIERGE.-VEVDD.AFIEEKMEIDT...IDWKSRYDQLERRFESLKQRV...........NEKYNNWV.....IKARKVNENMNSLQNVISQQQAHINE...LQIYNNKLE-RD..LQSKIGSVISSIEWYLRSMELSDDIKSDIEQQLNSIDHINPVNAFDDFE.............................
B7TAF0_9REOV/1-75                .........--------------------------------YDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSK--------------------------.......................--------------.------.-----------...---------------------...........--------.....--------------------------...------------..-------------------------------------------------.............................
G3CEQ2_9REOV/4-281               ........q-SSQQMANSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRIKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSAARNRNWMTDTRTTARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKQRV...........NEKYTSWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQHYCNKLE-VD..LQNKISSLVSSVEWYMKSMELPDEVKTDIEQQLNSIDVINPINAIDDFE.............................
F5C5U2_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQHCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D9YRI9_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.IYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSVMRNKNWMTDSRTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGA.-VEVDD.SFAEEKMEVDT...VDWKSRYDQLERRFESLKQRV...........NEKYTTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQNYCSKLE-AD..LQNKVGSLVSSVEWYLKSMELPDEVKTDIEQQLNSIDTISPINAIDDLE.............................
D1GHR1_9REOV/5-282               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAMTIDQALNGKFGSVVRNRNWMTDSKTVAKLDEDVNKLRMILSSKGINQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNNWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQQYCSKLE-ND..LQNKISSLVTSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
G1FVW9_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPVNAIDDIE.............................
C0JLW0_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSAVRNRNWMADTRTVARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRITGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SFVEEKMEIDT...IDWKSRYEQLEKRFESLKQRV...........NEKYTSWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQHYCNKLE-VD..LQNKISSLVSSVEWYMKSMELPDEVKTDIEQQLNSIDVINPINAIDDFE.............................
Q85015_9REOV/5-282               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSSIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKARYDQLEKRFESLKQRV...........NEKYNSWV.....QKAKKVNENMYSLQNVTSQQQNQIAG...LQQYCNKLE-AD..LQSKISSLVSSVEWYLRSMELSDDIKTDIEQQLNSIDLINPINAIDDLE.............................
G1FW08_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVTKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINSINAIDDIE.............................
F5C797_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTIAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C4Y3_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
Q88292_9REOV/5-282               .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDLVMDDSGVKNNLIGKAITIDQALNGKFSSAIRNRNWMTDSRTVAKLDEDVNKLRIMLSSKGIDQKMRVLNACFSVKRIPGKSSSIV.......................KCTRLMKDKLERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKHRV...........NEKYNHWV.....LKARKGNENMTLFQNVISQQQAHINE...LQMYNNKLE-RD..LQSKIGSVVSSIEWYLRSMELFDNVKSDIEQQLNSIDQLNPVNAIDDFE.............................
B3SRT7_9REOV/2-279               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAMTIDQALNGKFGSVVRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNNWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQQYCSKLE-ND..LQNKLSSLVSSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
D1GGL5_9REOV/5-282               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAMTIDQALNGKFGSVVRNRNWMTDSKTVAKLDEDVNKLRMILSSKGINQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNNWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQQYCSKLE-TD..LQNKISSLVSSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
F5C5W9_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYIDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
E2J343_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFEALKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C566_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEIDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
C0JLU9_9REOV/5-282               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSAIRNRNWMTDTRTTARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGE.-VEVDD.SFVEEKMEIDT...IDWKSRYEQLEKRFESLKQRV...........NEKYTNWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQHYCNKLE-VD..LQNKISSLVSSVEWYIKSMELPDEVKTDIEQQLNSIDVINPINAIDDFE.............................
E7CUG6_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYIMDDSGVKNNLLGKAATIDQALNGKFGSAARNRNWMADTRTTARLDEDVNKLRMMLSSKGIGQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMKDKLERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFEALKQRV...........SEKYTSWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQHYCNKLE-VD..LQNKISSLVSSVEWYMKSMELPDEIKTDIEQQLNSIDVINPINAIDDFE.............................
F5C4U7_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKLRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
Q53IY9_9REOV/5-282               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWI.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFNSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
H9N111_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.IYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSVMRNKNWMTDSRTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGA.-VEVDD.SFAEEKMEVDT...VDWKSRYDQLERRFESLKQRV...........NEKYTTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQNYCSKLE-AD..LQNKVGSLVSSVEWYLKSMELPDEVKTDIEQQLNSIDTISPINAIDDLE.............................
D0TZ90_9REOV/5-282               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFASVIRNRNWMADSKTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFEALKQRV...........NEKYNSWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-TD..LQNKIGSLVSSVEWYLRSMELSDDVKTDIEQQLNSIDAINPINAIDDLE.............................
H9C1C4_9REOV/1-189               .........MATQASVEWIFNVAGSAAASSLDKAIKDAGGSENFSKyVITKFYDNYKDCIDDSGVYNACIGRAKTIDKALNNP-KVAERNEEWYTNVATISRLDLELAELKLMLSNLGIKREERVLNSMFSVVREKGRSSNVImmkqnavkmieegklkikverndTYTESLKNKIEELEcIIDAFE.RGKDITIDLDA...M--------------------...........--------.....--------------------------...------------..-------------------------------------------------.............................
I0B175_9REOV/1-208               .........-------------------------------------.---------------------------------NGKFNSSIRNRNWMTDSKTVARLDEDVNKLRLLLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMKEKIERGE.-VEVDD.AFIEEKMEIDT...IDWKSRYDQLERRFESLKQRV...........NEKYNNWV.....IKARKVNENMSSLQNVISQQQAHINE...LQMYNNKLE-RD..LQSKIGSVISSIEWYLRSMELSDDIKSDIEQQLNSIDHINPVNAFDDFE.............................
F6LP38_9REOV/5-282               .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDFVMDDSGVKNNLMGKAATIDQALNGKFSSSIRNRNWMTDSKTVARLDEDVNKLRLLLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMKEKIERGE.-VEVDD.TFIEERMEIDT...IDWKSRYDQLERRFESLKQRV...........NEKYNNWV.....IKARKVNENMNSLQNVISQQQAHINE...LQTYNNKLE-RD..LQSKIGSVISSIEWYLRSMELSDDIKSDIEQQLNSIDHINPVNAFDDFE.............................
F5C6H1_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYIDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
NSP3_ROTAD/2-279                 .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFEALKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
C3U202_9REOV/1-101               ........a----------------------TSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSV-----------.......................--------------.------.-----------...---------------------...........--------.....--------------------------...------------..-------------------------------------------------.............................
NSP3_ROTHC/1-329                 .........MATQASVEWIFNVAGSAASSSLDKAIKDAGGSENFSKyVITKFYDNYKDCIDDSGVYNACIGRAKTIDKALNDP-KVAERNEEWYTNVATISRLDLELAELKLMLSNLGIKREERVLNSMFSVVREKGRSSNVImmkqnavkmieegklkikverneTYTESLKNKIEELEcIIDAFE.KGKDITIDLDA...MNGEVKLDGNSCSYNSTAALVstilgtpikmyNESGQPLFdvgnyMNPKNIIEKMIELEIPIFKSDYRNNEspdFDSWNERSNLKI..VSVNDCHAICIFKFENNWWCFDDGRLKKHNGAGYPLIVANSKFQIDKI-lisgdie......................
G0YY13_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.IYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSVMRNKNWMTDSRTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGA.-VEVDD.SFAEEKMEVDT...VDWKSRYDQLERRFESLKQRV...........NEKYTTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQNYCSKLE-AD..LQNKVGSLVSSVEWYLKSMELPDEVKTDIEQQLNSIDTISPINAIDDLE.............................
G3FZF2_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFSSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRMPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKYRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQNIISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
Q85013_9REOV/5-282               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGLFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........SENYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELSDDVKNDIEQQLNSIDLINPINAIDDIE.............................
H6VV40_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C4G4_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFGSLVSSVEWYLRSMELSDDVKNDIEQQLNSIDLINPINAIDDIE.............................
B6URJ1_9REOV/5-282               .........ESTQQMVSSLINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSTIRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKARYDQLEKRFESLKQRV...........NEKYNSWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKISSLVSSVEWYLRSMELSDDVKTDIEQQLNSIDAINPINAIDDLE.............................
G0YY25_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.IYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSVMRNKNWMTDSRTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGA.-VEVDD.SFAEEKMEVDT...VDWKSRYDQLERRFESLKQRV...........NEKYTTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQNYCSKLE-AD..LQNKVGSLVSSVEWYLKSMELPDEVKTDIEQQLNSIDTISPINAIDDLE.............................
F5C506_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKPRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
C7B6T5_9REOV/5-282               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
E2EA87_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFEYVMDDSGVKNNLLGKAATIDQALNGKFGSAARNRNWMADTRTTARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRAPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKQRV...........NEKYTSWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQNYCNKLE-VD..LQNKISSLVSSVEWYLKSMELPDEIKTDIEQQLNSIDVINPINAIDDFE.............................
F8SZ00_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDKDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKFSSLLSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
B2CQB0_9REOV/5-282               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSTIRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKARYDQLEKRFESLKQRV...........NEKYNSWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKISSLVSSVEWYLRSMELSDDVKTDIEQQLNSIDAINPINAIDDLE.............................
C0IUY1_9REOV/5-248               .........ESTQQMAVSIINSSFEAAVVAATSALENMGIEYDYQD.IYSRVKNKFDFVMDDSGVKNNLIGKAITIDQALNNKFGSAIRNRNWLADTSRAAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMRDKLERGE.-VEVDD.SFVDEKMEVDT...IDWKSRYEQLEQRFESLKSRV...........NEKYNNWV.....LKARKMNENMHSLQNVISQQQAHIAE...LQVYNNKLE-RD..LQNKIGSLTSSIE------------------------------------at...........................
C3U208_9REOV/1-100               ........a----------------------TSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACL-------------.......................--------------.------.-----------...---------------------...........--------.....--------------------------...------------..-------------------------------------------------v............................
B6URK3_9REOV/5-282               .........ESTQQMVSSTINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSTIRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKARYDQLEKRFESLKQRV...........NEKYNSWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKISSLVSSVEWYLRSMELSDDVKTDIEQQLNSIDAINPINAIDDLE.............................
E2J3A3_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFEALKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D1GG84_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFEALKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D1GGS5_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKFSSLVSSVEWYLRSMELPDDVKTDIEQQLNSIDLINPINAIDDIE.............................
F5C4W9_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKPRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D1GGJ1_9REOV/5-282               .........ESTQQMVNSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAVTIDQALNGKFSSAVRNRNWMTDSKTVAKLDEDVNKLRMMLSSKGIDQRMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........SEKYNNWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-TD..LQNKISLLVSSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
F5C626_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYIDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F8UF71_9REOV/5-282               .........ESTQQMAVSIINSSFEAAVVAATSALENMGIEYDYQD.IYSRVKNKLDFVMDDSGVKNNLIGKAITIDQALNNKFGSAIRNRNWLADTSRAAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMRDKLERGE.-VEVDD.SFVDEKMEVDT...IDWKSRYEQLEQRFESLKSRV...........NEKYNNWV.....LKARKMNENMHSLQNVISQQQAHIAE...LQVYNNKLE-RD..LQNKIGSLTSSIEWYLRSMELDPEIKADIEQQINSIDAINPLHAFDDLE.............................
F5C5G6_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGVQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5CRK5_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFSSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMKDKIERGE.-VEVDD.SYIDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNIWV.....QKAKKVNENMYSLQNVISQQQNQITD...LQQYCNKLE-TD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
C7SYG0_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D9MWZ7_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
C3U209_9REOV/1-100               ........a----------------------TSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACL-------------.......................--------------.------.-----------...---------------------...........--------.....--------------------------...------------..-------------------------------------------------v............................
NSP3_ROTHP/2-279                 .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........SEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELSDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C6J6_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
G4XNL8_9REOV/5-282               .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDFVMDDSGVKNNLIGKAVTIDQALNGKFSSSIRNRNWMTDSKTVARLDEDVNKLRLLLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMKEKIERGE.-VEVDD.AFIEEKMEIDT...IDWKSRYDQLERRFESLKQRV...........NEKYNNWV.....IKAGKVNENMNSLQNVISQQQAHINE...LQIYNNKLE-RD..LQSKIGSVISSIEWYLRSMELSDDIKSDIEQQLNSIDHINPVNAFDDFE.............................
B7UFA4_9REOV/1-101               ........a----------------------TSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTFSSKGIDQKMRVLNACFSV-----------.......................--------------.------.-----------...---------------------...........--------.....--------------------------...------------..-------------------------------------------------.............................
F5C6Q5_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
H6VLH1_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYIMDDSGVKNNLLGKAATIDQALNGKFGSAARNRNWMADTRTTARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKQRV...........NEKYTSWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQHYCNKLE-VD..LQNKISSLVSSVEWYMKSMELPDEVKTDIEQQLNSIDVINPINAIDDFE.............................
C0IUY1_9REOV/243-503             .......ss-------------------IEATSALENMGIEYDYQD.IYSRVKNKFDFVMDDSGVKNNLIGKAITIDQALNNKFGSAIRNRNWLADTSRAAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMRDKLERGE.-VEVDD.SFVDEKMEVDT...IDWKSRYEQLEQRFESLKSRV...........NEKYNNWV.....LKARKMNENMHSLQNVISQQQAHIAE...LQVYNNKLE-RD..LQNKIGSLTSSIEWYLRSMELDPEIKADIEQQINSIDAINPLHAFDDLE.............................
B2BRH2_9REOV/5-282               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTKVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C6F8_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYIDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
E7CF32_9REOV/1-100               ........a----------------------TSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFS------------.......................--------------.------.-----------...---------------------...........--------.....--------------------------...------------..-------------------------------------------------.............................
E2J2T5_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSVIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-SD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C4C9_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQDVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D1GH81_9REOV/5-282               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAMTIDQALNGKFGSVVRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNNWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQQYCSKLE-ND..LQNKISSLVSSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
F5C4A5_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
B2BM94_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSAARNRSWMADTRTAARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKQRV...........NEKYTSWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQNYCNKLE-VD..LQNKISSLVSSVEWYLKSMELPDEIKTDIEQQLNSIDVINPINAIDDFE.............................
D1GHG5_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKTDIEQQLNSIDLINPINAIDDIE.............................
A3DSI0_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIVD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C4T5_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKPRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D5J9Y2_9REOV/5-282               .........ESTQQMVSSIINTSSEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFGSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
A4ZD82_9REOV/1-195               .........-------------------------------------.----------------------------------------------MTDSKTVARLDEDVNKLRLLLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKEKIERGE.-VEVDD.AFIEEKMEIDT...IDWKSRYDQLERRFESLKQRV...........NEKYNNWV.....IKARKVNENMNSLQNVISQQQAHINE...LQIYNNKLE-RD..LQSKIGSVISSIEWYLRSMELSDDIKSDIEQQLNSIDHINPVNAFDDFE.............................
E2EBU5_9REOV/118-293             sgsnlealm--------------FHGAICG-RKILRGQGFTPDVKS.LHDDIAMKFESMLEESGVKNSVFGRAKTVDEAINGKFFSAQKNRRYMTTIETVKNLESDLYRMRMMLENMDIKRDARVLSSLFQIEKKTGKSGSVI.......................LADASVYDKLEKGE.IVRVDM.-----------...---------------------...........--------.....--------------------------...------------..-------------------------------------------------gkiesenscklrqiidqkdelisklknei
B6URI7_9REOV/5-282               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSTIRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKARYGQLEKRFESLKQRV...........NEKYNSWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKISSLVSSVEWYLRSMELSDDVKTDIEQQLNSIDAINPINAIDDLE.............................
H2EHT6_9REOV/1-273               .........-----MASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDFVMDDSGVKNNLMGKAVTIDQALNGKFSSAIRNRNWMTDSQTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSIV.......................KCTKLMKNKLERGE.-VEVDD.SFIEEKMETDT...IDWKLRYEQLEKRFESLKLRV...........NEKYNNWV.....IKARKVNENMNSLQNIISQQQAHINE...LQMYNNKLE-RD..LQSKIGSVVSSIEWYLRSMELSDDVKSDIEQQLNSIDQLNPVNALDDFE.............................
D1GGG7_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKTDIEQQLNSIDLINPINAIDDIE.............................
F5C4M5_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKPRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
NSP3_ROTW3/5-282                 .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFEYVMDDSGVKNNLLGKAATIDQALNGKFGSAARNRNWMADTRTTARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRAPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKQRV...........NEKYTSWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQNYCNKLE-VD..LQNKISSLVSSVEWYLKSMELPDEIKTDIEQQLNSIDVINPINAIDDFE.............................
F5C639_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYIDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
E3W533_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPNDVKNDIEQQLNSIDLINPINAIDDIE.............................
I1E474_9REOV/1-252               .........--------------------------ELMGIQYDYNE.VYTRVKSKFDYIMDDSGVKNNLLGKAATIDQALNGKFGSAARNRNWMVDTRTTARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKQRV...........NEKYISWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQNYCNKLE-VD..LQNKIGSLVSSVEWYLKSMELPDEIKTDIEQQLNSIDVINPINAIDDFE.............................
F5C6P3_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKNKFDYVMDDSGVKNNLLGKAITIDQALNGKFSSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNETMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFGSLVSSVEWYLRSMELSDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C4F2_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
NSP3_ROTS1/5-282                 .........ESTQQMAVSIINSSFEAAVVAATSALENMGIEYDYQD.IYSRVKNKFDFVMDDSGVKNNPIGKAITIDQALNNKFGSAIRNRNWLADTSRPAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMRDKLERGE.-VEVDD.SFVDEKMEVDT...IDWKSRYEQLEQRFESLKSRV...........NEKYNNWV.....LKARKMNENMHSLQNVIPQQQAHIAE...LQVYNNKLE-RD..LQNKIGSLTSSIEWYLRSMELDPEIKADIEQQINSIDAINPLHAFDDLE.............................
#=GR NSP3_ROTS1/5-282      SS    .........THHHHHHHHHHHHHHHHHHHHHHHHHHHTT----HHH.HHHHHHHHHHHHHCHTSTTHHHHHHHHHHHHHHTTXTHHHHHHHHHHH-TTHHHHHHHHHHHHHHHHHHTT-HHHHHHHHHHEEEE--TTSSSEEE.......................EE-HHHHHHHTTS-.-EEEEH.HHHHHTXXXXX...XXXXXXXXXXXXXXXXXXXXX...........XXXXXXXX.....XXXXXXXXXXXXHHHHHHHHHHHHHH...HHHHHHHHH-HH..HHHHHHHHHHHHHHHHHTSXXXHHHHHHHHHHHCTSXSSXHHHHHHHHH.............................
C7B6S8_9REOV/5-282               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQDKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C6C2_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C4E1_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........SEKYNIWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAVDDIE.............................
F5C759_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTIAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
B6SAK4_ROTCU/5-282               .........ESTQQMATSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDLIMDDSGVRNNLMGKATTIDQALNGKFSSTIRNRNWMTDSRTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSIV.......................KCTRLMKDKLERGE.-VEVDD.SFVEEKMEIDT...IDWKSRYEQLEKRFESLKHRV...........NEKYNNWV.....IKARKVNENMNSLQNVISQQQAHINE...LQMYNNKLE-RD..LQSKIESVVSSIEWYLRSMELSDDVKADIEQQLNSIDQLNPVNAMDDFE.............................
E2J2G5_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTIAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
B6URJ3_9REOV/5-282               .........ESTQQMVSSIINTSFEAAVVADTSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSTIRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKARYDQLEKRFESLKQRV...........NEKYNSWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-VD..LQSKISSLVSSVEWYLRSMELSDDVKTDIEQQLNSIDAINPINAIDDLE.............................
F5C5J9_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
B6RGK7_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEVDT...IDWKSRYDQLERRFESLKQRV...........SEKYNAWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-VD..LQGKFSSLVSSVEWYLRSMELPDDVKTDIEQQLNSIDLINPINAVDDIE.............................
H6VLI2_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSAARNRSWMADTKTTARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKQRV...........NEKYTSWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQHYCNKLE-VD..LQNKISSLVSSVEWYMKSMELPDEVKTDIEQQLNSIDVINPINAIDDFE.............................
E9NAY9_9REOV/5-282               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRIKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
E3W4R0_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D1GHL3_9REOV/5-282               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAMTIDQALNGKFGSVVRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNNWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQQYCSKLE-ND..LQNKISSLVTSVEWYLRSMELSDDIKNDIEQQLNSIDAINPINAIDDFE.............................
F5C6V4_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEIDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
H8ZHF3_9REOV/1-275               .........---QQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLLSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
E5KJH9_9REOV/1-329               .........MATQASVEWIFNVAGSAASSSLDKAIKDAGGSENFSKyVITKFYDNYKDCIDDSGVYNACIGRAKTVDKALNNP-KIAERNEEWYTNVATISRLDLELAELKLMLSNLGVKREERVLNSMFSVVREKGRSSNVImmkqnavkmieegklkikverneTYTESLKNKIEELEcIIDAFE.KGKNITIDLDA...MNGEVKLDGNSCSYNSTAAFVstilgtpikmyNESGQPLFdvgnyMNPKTIIEKMVELEIPIFKSDYRNNEspdFDSWNERSNLKI..VSVNDCHAICIFKFENNWWCFDDGRLKKHNGVGYPLIVANSKFQIDKI-lisgdie......................
A4ZD95_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F8SYW7_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F6LP49_9REOV/5-282               .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDFVMDDSGVKNNLMGKAVTIDQALNGKFSSSIRNRNWMTDSKTVARLDEDVNKLRLLLSSKGIDQKMRVLNACFNVKRVPGKSSSVI.......................KCTRLMKEKIERGE.-VEVDD.TFVEERMEIDT...IDWKSRYDQLERRFESLKQRV...........NEKYNNWV.....IKARKLNENMNSLQNVISQQQAHINE...LQIYNNKLE-RD..LQSKIGSVISSIEWYLRSMELSDDIKSDIEQQLNSIDHINPVNAFDDFE.............................
F5C5C7_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGVQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F1B1F4_9REOV/5-282               .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.IYTRVKSKFDFVMDDSGVKNNLLGKAATIDQALNGKFGSVMRNKNWMTDSRTVAKLDEDVNKLRIIISSKGIDQKMRVLNACFSVKRVPGKSSSVI.......................KCTRLMKEKIERGE.-VEVDD.AFIEEKMEIDT...VDWKSRYDHLERRFESLKQRV...........NEKYNNWV.....LKARKVNENMNSLQNVISQQQAQIAD...LQNYCSKLE-AD..LQNKVGSLVSSVEWYLKSMELPDEVKTDIEQQLNSIDTISPINAIDDLE.............................
F5C531_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGVQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D7NN31_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.IYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSVMRNKNWMTDSRTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGA.-VEVDD.SFAEEKMEVDT...VDWKSRYDQLERRFESLKQRV...........NEKYTTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQNYCSKLE-AD..LQNKVGSLVSSVEWYLKSMELPDEVKTDIEQQLNSIDTISPINAIDDLE.............................
A3DSL6_9REOV/2-279               .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDFVMDDSGVKNNLMGKATTIDQALNGKFGSAIRNRNWMTNSQTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSIV.......................KCTRLMKDKLEHGE.-VEVDD.SFVEEKMEVDT...IDWKLRYEQLEKRFESLKHRV...........NEKYNHWV.....LKARKVNENMNSLQNVISQQQAHINE...LQMYNNKLE-RD..LQSKIGSVVSSIEWYLRSMELSDDVKSDIEQQLNSIDQLNPVNAIDDFE.............................
F5C7B0_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTIAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D3HU62_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSAVRNRNWMADTRTTARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKQRV...........NEKYTSWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQHYCDKLE-VD..LQNKISSLVSSVEWYMKSMELPDEVKTDIEQQLNSIDVINPINAIDDFE.............................
D5J9Y9_9REOV/5-282               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYVMDDSGVKNNLLGKAMTIDQALNGKFGSVVRNRNWMTDSKIVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........SEKYNNWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-TD..LQSKISSLVSSVEWYLRSMELSDDVKTDIEQQLNSIDAINPINAIDDLE.............................
F5C4K0_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
C7B6R2_9REOV/5-282               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
E2J2I9_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTIAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C555_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGVQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
NSP3_ROTWI/5-282                 .........ESTQQMVISVINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKLGSAIRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKFRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYRNKLE-TD..LQGKFSSLVSSVEWYLRSMELPDDVKTDIEQQLNSIDLINSINAIDDIE.............................
B6URJ6_9REOV/5-282               .........ESTQQMASSIIYTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSAARNRNWMVDTRTTARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKQRV...........NEKYTSWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQNYCNKLE-VD..LQNKISSLVSSVEWYLKSMELPDEIKTDIEQQLNSIDVINPINAIDDFE.............................
F5C649_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNIISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C6E8_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFGSLVSSVEWYLRSMELSDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D3JIR0_9REOV/5-282               .........ESTQQMANSIINTSFEAAVVAATSTLELMGIQYDYNE.IYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSATRNRNWMTDSKTVARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYDQLEKRFESLKQRV...........NEKYASWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQNYCNKLE-AD..LQNKIGSLVSSVEWYLKSMELPDEVKTDIEQQLNSIDTISPINAIDDFE.............................
B6SAM6_9REOV/5-282               .........ESTQQMATSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDLIMDDSGVRNNLMGKATTIDQALNGKFSSAIRNRNWMTDSRTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSIV.......................KCTRLMKDKLERGE.-VEVDD.SFVEEKMEIDT...IDWKSRYEQLEKRFESLKHRV...........NEKYNNWV.....IKARKVNENMNSLQNVISQQQAHINE...LQMYNNKLE-RD..LQSKIGSVVSSIEWYLRSMELSDDVKADIEQQLNSIDQLNPVNAMDDFE.............................
E3W546_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C4P9_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKPRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
E2J2M5_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINSINAIDDIE.............................
E3W581_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSIELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
NSP3_ROT41/5-282                 .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSAVRNRNWMTDTRTTARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKQRV...........NEKYTSWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQHYCNKLE-VD..LQNKISSLVSSIEWYMKSMELPDEVKTDIEQQLNSIDVINPINAIDDFE.............................
B6SAL5_ROTD9/5-282               .........ESTQQMATSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDLIMDDSGVRNNLMGKATTIDQALNGKFSSAIRNRNWMTDSRTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSIV.......................KCTRLMKDKLERGE.-VEVDD.SFVEEKMEIDT...IDWKSRYEQLEKRFESLKHRV...........NEKYNNWV.....IKARKVNENMNSLQNVISQQQAHINE...LQMYNNKLE-RD..LQSKIGSVVSSIEWYLRSMELSDDVKADIEQQLNSIDQLNPVNAMDDFE.............................
F8U677_9REOV/2-279               .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDFVMDDSGVKNNLMGKAITIDQALNGKFSSAIRNRNWMTDSRTAAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSIV.......................KCTRLMKDKLERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKHRV...........NEKYNHWV.....LKARKVNENMNSLQNVISQQQAHINE...LQMYNNKLE-RD..LQSKIGSVVSSIEWYLRSMELSDDIKSDIEQQLNSIDQLNPANAMDDFE.............................
F5C5X9_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYIDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQDKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F1B1F3_9REOV/5-282               .........ESTQQMVGCIINSSFAAAVAAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSAIRNRNWMTDSKTVARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDHLERRFESLKQRV...........NEKYNSWV.....LKAKKVNENMYSLQNVISHQQNQIAD...LQQYCNKLE-TD..LQNKIRSLVSSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
E2J2X1_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEIDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
B6URI3_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSAARNRNWMVDTRTTARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKQRV...........NEKYTSWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQNYCNKLE-VD..LQNKISSLVSSVEWYLKSMELPDEIKTDIEQQLNSIDVINPINAIDDFE.............................
F8SPX2_9REOV/5-282               .........ESTQQMATSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDLIMDDSGVRNNLMGKATTIDQALNGKFSSAIRNRNWMTDSRTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRVPGKSSSIV.......................KCTRLMKDKLERGE.-VEVDD.SFVEEKMEIDT...IDWKSRYEQLEKRFESLKHRV...........NEKYNNWV.....IKARKVNENMNSLQNVISQQQAHINE...LQMYNNKLE-RD..LQSKIGSVVSSIEWYLRSMELSDDVKADIEQQLNSIDQLNPVNAMDDFE.............................
C9DQ51_9REOV/5-282               .........ESTQQMVSSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDFVMDDSGVKNNLIGKAATIDQALNGKFSSSIRNRNWMTDSKTVARLDEDVNKLRLLLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMKEKIERGE.-VEVDD.AFIEEKMEIDT...IDWKSRYDQLERRFESLKQRV...........NEKYNNWV.....IKARKVNENMNSLQNVISQQQAHINE...LQIYNNKLE-RD..LQSKIGSVISSIEWYLRSMELSDDIKSDIEQQLNSIDHINPVNAFDDFE.............................
G4XR48_9REOV/5-282               .........ESTQQMAVSIINSSFEAAVVAATSALENMGIEYDYQD.IYSRVKNKFDFVMDDSGVKNNLIGKAITIDQALNNKFGSAIRNRNWLADTSRAAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMRDKLERGE.-VEVDD.SFVDEKMEVDT...IDWKSRYEQLEQRFESLKSRV...........NEKYNNWV.....LKARKMNENMHSLQNVISQQQAHIAE...LQVYNNKLE-RD..LQNKIGSLTSSIEWYLRSMELDPEIKADIEQQINSIDAINPLHAFDDLE.............................
F1B1F5_9REOV/5-282               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVRNNLLGKATTIDQALNGLFGSAIRNRNWMTDSKTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKRRV...........NEKYNSWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELSDDVKNDIEQQLNSIDLINPINAIDDIE.............................
H9C1C3_9REOV/1-189               .........MATQASVEWIFNVAGSAAASSLDKAIKDAGGSENFSKyVITKFYDNYKDCIDDSGVYNACIGRAKTIDKALNNP-KVAERNEEWYTNVATISRLDLELAELKLMLSNLGIKREERVLNSMFSVVREKGRSSNVImmkqnavkmieegklkikverneTYTESLKNKIEELEcIIDAFE.RGKDITIDLDA...M--------------------...........--------.....--------------------------...------------..-------------------------------------------------.............................
D1GGC0_9REOV/5-282               .........ESTQQMVGSIINTSFEAAVVAVTSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAMTIDQALNGKFGSVVRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNNWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQQYCSKLE-TD..LQNKISSLVSSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
F5C4I9_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFGSLVSSVEWYLRSMELSDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C773_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMKDKIERGE.-VEVDD.SYIDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-TD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
Q9ICZ6_9REOV/1-56                ........c-------------------------------------.------------------------------------------------------------------------------------------------.......................--------------.------.-----------...---------------------...........--------.....--------------------------...-----SKLE-TD..LQNKISSLVSSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDVE.............................
E3W4Y6_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGVQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
H2EHT7_9REOV/1-273               .........-----MASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKNKFDFVMDDSGVRNNLMGKAVTIDQALNGKFSSAIRNRNWMTDSQTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSIV.......................KCTKLMKNKLERGE.-VEVDD.SFIEEKMETDT...IDWKSRYEQLEKRFESLKLRV...........NEKYNTWV.....IKARKVNENMNSLQNIISQQQAHINE...LQMYNNKLE-RD..LQSKIGSVVSSIEWYLRSMELSDDVKSDIEQQLNSIDQLNPVNALDDFE.............................
F8SPZ4_9REOV/5-282               .........ESTQQMATSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDLIMDDSGVRNNLMGKATTIDQALNGKFNSAIRNRNWMTDSRTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSIV.......................KCTKLMKDKLERGE.-VEVDD.SFVEEKMEIDT...IDWKSRYEQLEKRFESLKHRV...........NEKYNNWV.....IKARKVNENMNSLQNVISQQQAHINE...LQMYNNKLE-RD..LQSKIGSVVSSVEWYLRSMELSDDVKADIEQQLNSIDQLNPVNAIDDFE.............................
G1FW65_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVTRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
G4WMJ2_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
E2J269_ROTHU/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F8SRJ6_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKGKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
E1CJG5_9REOV/5-282               .........ESTQQMAVSIINSSFEAAVVAATSTLELMGIEYDYNE.VYTRVKSKFDYVMDDSGVKNNLIGKAITVDQALNGRFSSAIRNRNWMSDSKTVAKLDEDVNKLRIMLSSKGIDQKMRVLNACFSVKRAPGKSSSII.......................KCTKLMKDKLERGE.-VEVDD.SFVDEKMDVDS...IDWKARYDQLEKRFESLKQRV...........NEKYNNWV.....YKAKKVNENMHSLQDVMARQQAYIND...LQIHNNKLE-KD..LQNKVNSLVSSVEWYLRSMELPEEIKSDMEQQINSIDLINPVNAIDDLE.............................
F1B1F2_9REOV/5-282               .........ESTQQMVGCIINTSFEAAVVAATSTLELMDVQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAATIDPALNGKFGSVMRNRNWMTDSKTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMDIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNSWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-TD..LQNKISSLVSSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
E3W4K4_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMKDKIERGE.-VEVDD.SYIDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-TD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D1GHP9_9REOV/5-282               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAMTIDQALNGKFGSVVRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNNWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQQYCSKLE-ND..LQNKISSLVTSVEWYLRSMELSDDIKNDIEQQLNSIDAINPINAIDDFE.............................
O55587_9REOV/2-275               .........ETTVLAVKSILSAAFDCAVATTKSILDEQHITYDSAE.IEAKIRCKMNLILDDSGVQANMLGKAATIDQALSGKMASVNRNANWMTTQYTVAKLDEDVNRLRMMLSAKNIDQKMRVLNSCFKVQRNPTKSSSII.......................TCTKLLKEKLKRGE.VIEVED.Q-EDIKMDVDVkedIDWKGKFERAKMKFQ------...........-EKYNSWV.....MKARKVADSVKNMQLTIANQQAMINS...FE---EKLMQKDieYKTRIVSLIAALEWKLNSKQFEDEIRQDYLQELETMTVIDVNDGVANIE.............................
NSP3_ROTBU/5-282                 .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.IYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSVMRNKNWMTDSRTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGA.-VEVDD.SFVEEKMEVDT...VDWKSRYDQLERRFESLKQRV...........NEKYTTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQNYCSKLE-AD..LQNKVGSLVSSVEWYLKSMELPDEVKTDIEQQLNSIDTISPINAIDDLE.............................
Q82047_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYVYNE.VYTRVKSKFDYIMDDSGVKNNLLGKAATIDQALNGKFGSAARNRNWMADTRIVARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVRRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKQRV...........NEKYASWV.....QKAKKANENMYSLQNVISQQQSQIAD...LQHYCNKLE-VD..LQNKISSLVSSVEWYLKSMELPDEIKTDIEQQLNSIDVINPINAIDDFE.............................
NSP3_ROTHS/5-282                 .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDFVMDDSGVENNLMGKAATIDQALNGKFSSSIRNRNWMTDSKTVARLDEDVNKLRLLLSSKGIDQKMRVLNACFSVKRVPGKSSSVI.......................KCTRLMKEKIERGE.-VEVDD.TFIEERMEIDT...IDWKSRYDQLERRFESLKQRV...........NEKYNNWV.....IKARKVNENMNSLQNVISQQQAHINE...LQIYNNKLE-RD..LQSKIGSVISSIEWYLRSMELSDDIKSDIEQQLNSIDLINPVNAFDDFE.............................
B1NFL1_9REOV/5-282               .........ESTQQMAVSIINSSFEAAVVAATSALENMGIEYDYQD.IYSRVKNKFDFVMDDSGVKNNLIGKAITIDQALNNKFGSAIRNRNWLADTSRAAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMRDKLERGE.-VEVDD.SFVDEKMEVDT...IDWKSRYEQLEQRFESLKSRV...........NEKYNNWV.....LKARKMNENMHSLQNVISQQQAHIAE...LQVYNNKLE-RD..LQNKIGSLTSSIEWYLRSMELDPEIKADIEQQINSIDAINPLHAFDDLE.............................
A3DSJ1_9REOV/2-279               .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDFVMDDSGIKNNLIGKAATIDQALNGKFSSSIRNRNWMTDSKTVARLDEDVNKLRLLLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMKEKIERGE.-VEVDD.AFIEEKMEIDT...IDWKSRYDQLERRFESLKQRV...........NEKYNNWV.....IKARKVNENMNSLQNVISQQQAHINE...LQIYNNKLE-RD..LQSKIGSVISSIEWYLRSMELSDDIKSDIEQQLNSIDHINPINAFDDFE.............................
H2DLU9_9REOV/5-282               .........ESTQQMANSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSAVRNRNWMIDTRTTARLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRTPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SFVEEKMEVDT...VDWKSRYEQLEKRFESLKQRV...........SEKYTSWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQHYCNKLE-VD..LQNKISSLVSSVEWYMKSMELPDEVKTDIEQQLNSIDVINPINAIDDFE.............................
E2J355_9REOV/2-279               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAMTIDQALNGKFGSVVRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNNWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQQYCSKLE-ND..LQNKISSLVSSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
F6KWD3_9REOV/5-282               .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFGFVMDDSGVKNNLMGKAATIDQALNGKFSSSIRNRNWMTDSKTVSRLDEDVNKLRLLLSSKGIDQKMRVLNACFSVKRVPGKSSSVI.......................KCTRLMKEKIERGE.-VEVDD.TFVEERMEIDT...IDWKSRYDQLERRFESLKQRV...........NEKYNNWV.....IKARKVNENMNSLQNVISQQQAHINE...LQIYNNKLE-RD..LQSKIGSVISSIEWYLRSMELSDDIKSDIEQQLNSIDHINPVNAFDDFE.............................
D7NN30_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.IYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSVMRNKNWMTDSRTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGA.-VEVDD.SFAEEKMEVDT...VDWKSRYDQLERRFESLKQRV...........NEKYTTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQNYCSKLK-AY..LQNKVGSLVSSVEWYLKSMELPDEVKTDIEQQLNSIDTISPINAIDDLE.............................
Q29U89_9REOV/1-329               .........MATQASVEWIFNVAGSAASSSLDRAIKDAGGSESFSKyVITKFYDNYKDCIDDSGVYNACIGRAKTIDKALNNP-KAAERNEEWYTNVATISRLDLELAELKLMLSNLGIKREERVLNSMFSVVREKGRSSNVImmkqnavkmieegklkikverneTYTESLKNKIEELEcIIDAFE.KGKDITIDLDA...MNGEVKLDGNSCSYNATAAFVstilgtpikmyNESGQPLFdvgnyMNPKTIIEKMTELEIPIFKSDYRNDEspdFDGWNERSNLKI..ISVNDCHAICIFKFENNWWCFDDGRLKKHNGTGYPLIVANSKFQIDKI-lisgdie......................
E2J2R1_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F8U666_9REOV/2-279               .........ESTQQLANSIMNSSFEAAVVAATSTLELMGIQYDYNE.IYTRVKSKFDFVMDDSGVKNNLIGKAITVDQALNNKLGSAIRNRNWMTDSRTIAKLDEDVNKLRMMLSSKGIDQKMRVLNNCFSVKRTPGKSSSII.......................KCTKLMKDKLERGE.-VEIDD.ALIDEKDCTNT...VNWKEKYEQLEKRFESLKRRI...........NEKYTGWV.....AKAKKVHESANLLQNTIIRQQEYINE...LQLYNKKLE-SD..LQTKISTIASSIEWYLRSMELPNEIKIDIEQQINSIDQINPINALDDLE.............................
E3UMH9_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKATTIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
E2J391_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFEALKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D1GHB7_9REOV/5-282               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAMTIDQALNGKFGSVVRNRNWMTDSKTVAKLDEDVNKLRMILSSKGINQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNNWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQQYCSKLE-TD..LQNKISSLVSSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
E3W554_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGVQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFDSLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D2DXN2_9REOV/1-262               .........----------------AAVVAATSTLELMGIQYDYNE.VYTRVKSKFDFVMDDSGVKNNLIGKAATIDQALNGKFSSSIRNRNWMTDSKTVARLDEDVNKLRLLLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMKEKIERGE.-VEVDD.AFIEEKMEIDT...IDWKSRYDQLERRFESLKQRV...........NEKYNNWV.....IKARKVNENMNSLQNVISQQQAHINE...LQIYNNKLE-RD..LQSKIGSVISSIEWYLRSMELSDDIKSDIEQQLNSIDHINPVNAFDDFE.............................
NSP3_ROTBS/1-329                 .........MATQASVEWIFNVAGSAASASLAKSIKDAGGSEDFAKyVVARFYDNYKDSIDDSGIYNACMGRARTVDKALNDS-RLAERNEEWHTNLATIRRLDLELAELKLMLSNLGMKREERVLNSMFSVTREEGRSSNVVmlkqnavkmieegklkikvekneNYTESLKNKIEELEcIIGAFE.KGKEINIALDA...MTGEVRLDGDSCSYNSTAAFVstimgtpikmyDESNKPLFdvgkyINPKHVIDKMIESEIPIFKSDYRNNEspdFDAWNENSNLKI..VSVNDCHAICVFKFENEWWCFDDGRLRKYNGIGNPLIVANSKFQIDRI-lisgdie......................
F5CRI0_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTIAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
B0LJD8_9REOV/5-282               .........ESTRQMVDSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKARYDQLEKRFESLKQRV...........NEKYNSWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKISSLVSSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
E7CF41_9REOV/1-100               ........a----------------------TSTLELMGFQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFS------------.......................--------------.------.-----------...---------------------...........--------.....--------------------------...------------..-------------------------------------------------.............................
A4ZD72_9REOV/2-270               .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDFVMDDSGVKNNLIGKAATIDQALNGKFSSSIRNRNWMTDSKTVARLDEDVNKLRLLLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMKEKIERGE.-VEVDD.AFIEEKMEIDT...IDWKSRYDQLERRFESLKQRV...........NEKYNNWV.....IKARKVNENMNSLQNVISQQQAHINE...LQIYNNKLE-RD..LQSKIGSVISSIEWYLRSMELSDDIKSDIEQQLNSIDHIN---------.............................
E7D4P0_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPNDVKNDIEQQLNSIDLINPINAIDDIE.............................
D1GGN9_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKFSSLVSSVEWYLRSMELPDDVKTDIEQQLNSIDLINPINAIDDIE.............................
NSP3_ROTHL/5-282                 .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDFVMDDSGVKNNLMGKAATIDQALNGKFSSSIRNRNWMTDSKTVARLDEDVNKLRLLLSSKGIDQKMRVLNACFNVKRVPGKSSSVI.......................KCTRLMKDKIERGE.-VEVDD.TFVEERMEIDT...IDWKSRYDQLERRFESLKQRV...........NEKYNNWV.....IKARKVNENMNSLQNVISQQQAHINE...LQIYNNKLE-RD..LQSKIGSVISSIEWYLRSMELSDDIKSDIEQQLNSIDHINPVNAFDDFE.............................
D1GG48_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKFSSLVSSVEWYLRSMELPDDVKTDIEQQLNSIDLINPINAIDDIE.............................
E2J3C7_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFGSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
E7CF23_9REOV/1-100               ........a----------------------TSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFS------------.......................--------------.------.-----------...---------------------...........--------.....--------------------------...------------..-------------------------------------------------.............................
E7D6K4_ROTHU/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-TD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
E2GK16_9REOV/5-282               .........ESTQQMANSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSAVRNRNWMIDTRTTARLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRTPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SFVEEKMEVDT...VDWKSRYEQLEKRFESLKQRA...........SEKYTSWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQHYCNKLE-VD..LQNKISSLVSSVEWYMKSMELPDEVKTDIEQQLNSIDVINPINAIDDFE.............................
Q29U87_9REOV/1-329               .........MATQASVEWIFNVAGSAASSSLDRAIKDAGGSESFSKyVITKFYDNYKDCIDDSGVYNACIGRAKTIDKALNNP-KAAERNEEWYTNVATISRLDLELAELKLMLSNLGIKREERVLNSMFSVVREKGRSSNVImmkqnavkmieegkfkikverneTYTESLKNKIEELEcIIDAFE.KGKDITIDLDA...MNGEVKLDGNSCSYNSTAAFVstilgtpikmySESGQPLFdvgnyMNPKTIIEKMIELEIPIFKSDYRNDEspdFDSWNERSNLKI..ISVNDCHAICIFKFENNWWCFDDGRLKKHNGVGYPLIVANSKFQIDKI-lisgdie......................
A2T3N1_9REOV/5-282               .........ESTQQMAVSIINSSFEAAVVAATSALENMGIEYDYQD.IYSRVKNKFDFVMDDSGVKNNLIGKAITIDQALNNKFGSAIRNRNWLADTSRAAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMRDKLERGE.-VEVDD.SFVDEKMEVDT...IDWKSRYEQLEQRFESLKSRV...........NEKYNNWV.....LKARKMNENMHSLQNVISQQQAHIAE...LQVYNNKLE-RD..LQNKIGSLTSSIEWYLRSMELDPEIKADIEQQINSIDAINPLHAFDDLE.............................
G1FW82_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGVQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D1GHF3_9REOV/5-282               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAMTIDQALNGKFGSVVRNRNWMTDSKTVAKLDEDVNKLRMILSSKGINQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNNWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQQYCSKLE-TD..LQNKISSLVSSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
F5C6D6_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYIDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
Q719L5_9REOV/5-282               .........ESTQQMVGSIINTSFEAAVVAATSTMELMGIQYDYNE.VFTRVKSKFDYIMDDSGVKNNLLGKAVTIDQALNGKFGSVIRNRNWMTDSKTVAKLDEDVNKLRMMLSSKGIDQKIRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNSWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-TD..LQNKISSLVSSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
D1GGE4_9REOV/2-279               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAMTIDQALNGKFGSVVRNRNWMTDSKTVAKLDEDVNKLRMILSSKGINQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNNWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQQYCSKLE-TD..LQNKISSLVSSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
A3DSK2_9REOV/2-279               .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDFVMDDSGVKNNLIGKAATIDQALNGKFSSSIRNRNWMTDSKTVARLDEDVNKLRLLLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMKEKIERGE.-VEVDD.AFIEEKMEIDT...IDWKSRYDQLERRFESLKQRV...........NEKYNNWV.....IKARKVNENMNSLQNVISQQQAHINE...LQIYNNKLE-RD..LQSKIGSVISSIEWYLRSMELSDDIKSDIEQQLNSIDHINPINAFDDFE.............................
F5C5V7_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYIDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
C7B6R8_9REOV/5-282               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWI.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
G4WMK3_9REOV/5-282               .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDFVMDDSGVKNNLIGKAATIDQALNGKFSSSIRNRNWMTDSKTVARLDEDVNKLRLLLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMKEKIERGE.-VEVDD.AFIEEKMEIDT...IDWKSRYDQLERRFESLKQRV...........NEKYNNWV.....IKARKVNENMNSLQNVISQQQAHINE...LQIYNNKLE-RD..LQSKIGSVISSIEWYLRSMELSDDIKSDIEQQLNSIDYINPVNAFDDFE.............................
NSP3_ROTHK/5-282                 .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMIDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKLERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNAWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-VD..LQGKFSSLVSSVEWYLRSMELPDDVKTDVEQQLNSIDLINPINAIDDIE.............................
A2T3N2_9REOV/5-282               .........ESTQQMAVSIINSSFEAALVAATSALENMGIEYDYQD.IYSRVKNKFDFVMDDSGVKNNLIGKAITIDQALNNKFGSAIRNRNWLADTSRAAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMRDKLERGE.-VEVDD.SFVDEKMEVDT...IDWKSRYEQLEQRFESLKSRV...........NEKYNNWV.....LKARKMNENMHSLQNVISQQQAHIAE...LQVYNNKLE-RD..LQNKIGSLTSSIEWYLRSMELDPEIKADIEQQINSIDAINPLHAFDDLE.............................
F5C590_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFDSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKPRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
H6UF93_9REOV/1-265               .........-------------SFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFNVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
I0B174_9REOV/1-250               .........----------------------------MGIQYDYNE.VYTRVKSKFDFVMDDSGVKNNLMGKAVTIDQALNGKFNSSIRNRNWMTDSKTVARLDEDVNKLRLLLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMKEKIERGE.-VEVDD.AFIEEKMEIDT...IDWKSRYDQLERRFESLKQRV...........NEKYNNWV.....IKARKVNENMSSLQNVISQQQAHINE...LQMYNNKLE-RD..LQSKIGSVISSIEWYLRSMELSDDIKSDIEQQLNSIDHINPVNAFDDFE.............................
F5C5Z1_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEIDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D3G8E9_9REOV/2-279               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYIMDDSGVKNNLIGKAITIDQALNGKFGSVVRNRNWMTDSRTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........SEKYNNWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-TD..LQNKISSLVSSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
F5C616_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYIDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D7NN32_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.IYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSVMRNKNWMTDSRTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGA.-VEVDD.SFAEEKMEVDT...VDWKSRYDQLERRFESLKQRV...........NEKYTTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQNYCSKLE-AD..LQNKVGSLVSSVEWYLKSMELPDEVKTDIEQQLNSIDTISPINAIDDLE.............................
D1GG60_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKFSSLVSSVEWYLRSMELPDDVKTDIEQQLNSIDLINPINAIDDIE.............................
E3W510_9REOV/2-279               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYYQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAVDDIE.............................
NSP3_ROTH6/5-282                 .........ESTQQMVSSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDLVMDDSGVKNNLMGKAATIDQALNGKFSSSIRNRNWMTDSKTDARLDEDVNKLRLLLSSKGIDQKMRVLNACFNVKRIPGKSSSVI.......................RCTRLMKEKIERGE.-VEVDD.AFVEEKMEVDT...IDWKSRYEQLEKRFESLKQRV...........NEKYNNWV.....IKARKDNENMYSLQNVISQQQAHINE...LQIYNNKLE-RD..LQSKIGSVISSIEWYLRSMELSDDIKSDIEQQLNSIDQINPVNAYDDFE.............................
E9K9T7_9REOV/5-282               .........ESTQQMAVSIINSSFEAAVVAATSALENMGIEYDYQD.IYSRVKNKFDFVMDDSGVKNNLIGKAITIDQALNNKFGSAIRNRNWLADTSRAAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMRDKLERGE.-VEVDD.SFVDEKMEVDT...IDWKSRYEQLEQRFESLKSRV...........NEKYNNWV.....LKARKMNENMHSLQNVISQQQAHIAE...LQVYNNKLE-RD..LQNKIGSLTSSIEWYLRSMELDPEIKADIEQQINSIDAINPLHAFDDLE.............................
B6URI0_9REOV/5-282               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSTIRNRNWMTDSKTVAKLDEDVNNLCMILSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKARYDQLEKRFESLKQRV...........NEKYNSWV.....QKSKERNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKISSLVSSVEWYLRSMELSDDVKTDIEQQLNSIDAINPINAIDDLE.............................
NSP3_ROTP5/5-282                 .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSTIRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKARYDQLEKRFESLKQRV...........NEKYNSWV.....QKSKERNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKISSLVSSVEWYLRSMELSDDVKTDIEQQLNSIDAINPINAIDDLE.............................
E3W4E3_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGVQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMKDKIERGE.-VEIDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
E2J2F3_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
G0YVY2_9REOV/5-282               .........ESTQQMANSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSAARNRNWMVDTRTTVRLDEDVNKLRMMLSSKGIDQRMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFIEEKMEVDT...IDWKSRYEQLEKRFESLKQRV...........NEKYTSWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQHYCNKLE-VD..LQNKISSLVSSVEWYMKSMELPDEIKTDIEQQLNSIDVINPINAIDDFE.............................
F5C4L3_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKPRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
B6URI1_9REOV/5-282               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSTIRKRSWMTGSKTVAKLDEDVNNLCMILSSKGIDQKMRVLNACFSVKRIPGESSSVI.......................KCTRLMKDKIERGE.-VEVDD.SFVDENMEIDT...IDWKARYDQLKKRFESLKQRV...........NEKYNSWV.....QKSKERNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKISSLVSSVEWYLRSMELSDDVKTDIEQQLNSIDAINPINAIDDLE.............................
B6URK4_9REOV/5-282               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSTIRNRNWMTDSKTVAKLDEDVNNLRMILSSKGIDQKMRVLNSCFSVKRIQGKSSSVI.......................KCARLMKDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKARYDQLEKRFESLKQRV...........NEKYNSWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKISSLVSSVEWYLRSMELSDDVKTDIEQQLNSIDAINPINAIDDLE.............................
NSP3_ROTH7/2-279                 .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYIMDDSGVKNNLLGKAATIDQALNGKFGSAVRNRNWMADTRTTARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKQRV...........NEKYTSWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQHYCNKLE-VD..LQNKISSLVSSVEWYMKSMELPGEIKTDIEQQLNSIDVINPINAIDDFE.............................
B6SAJ3_9REOV/5-282               .........ESTQQMATSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDLIMDDSGVKNNLMGKATTIDQALNGKFNSAIRNRNWMTDSRTVAKLDEDVNKLRIMLSSKGIDQKMRVLNACFSVKRIPGKSSSIV.......................KCTRLMKDKLERGE.-VEVDD.SFVEEKMEIDT...IDWKSRYEQLEKRFESLKHRV...........NEKYNNWV.....IKARKVNENMNSLQNVISQQQAHINE...LQMYNNKLE-RD..LQSKIGSVVSSIEWYLRSMELSDDVKADIEQQLNSIDQLNPVNAMDDFE.............................
F5C604_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEIDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C5D9_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGVQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
H9LJA6_9REOV/2-279               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLVGKAITIDQALNGKFGSVARNRNWMTDSRTVAKLDEDVNKLRMMLSSKGIDQKMRVLSACFSVKRIPGKSSSII.......................KCTRLMRDKMERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........SEKYNNWV.....QKAKKVNENMYSLQNVISQQQNQITD...LQQYCNKLE-TD..LQNKISSLVSSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
E3W480_9REOV/2-279               .........ESTQQMVSSIINTSCEAAVVAATSTLELMGVQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
B2BM83_9REOV/5-282               .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDFVMDDSGVKNNLIGKAATIDQALNGKFSSSIRNRNWMTDSKTVARLDEDVNKLRLLLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMKEKIERGE.-VEVDD.AFIEEKMETDT...IDWKSRYDQLERRFESLKQRV...........NEKYNNWV.....IKARKVNENMNSLQNVISQQQAHINE...LQIYNNKLE-RD..LQSKIGSVISSIEWYLRSMELSDDIKSDIEQQLNSIDHINPVNAFDDFE.............................
F5C5H5_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGVQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D1L621_9REOV/2-279               .........ESTQQMASSIINSSFEAAVVAATSTLELMGIEYDYNE.VFTRVKSKFEFVMDDSGVRNNLMGKAFTIDQALNNRFNSAMRNRNWMCDSKTISKLDEDVNKLRMMLSSKGIDQKMRVLNSCFSVKRIPGKSSSII.......................RCTRLMRDKLERGE.-VEVDD.SFVEERMETDT...IDWKSRYEQLEKRFETSKQKT...........TEKYNAWA.....AKAKKANENLNALQSVITQQQKTIME...LQEQNRRIE-AE..LQAKLSSVTGSIEWFLRSLELPDDAKLDVEQQLNSIDLVNPSSALDDIE.............................
F6MF82_9REOV/1-260               .........------------------VVAATSTLELMGIQYDYNE.VYTRVKSKFDLIMDDSGVRNNLMGKATTIDQALNGKFNSAIRNRNWMTDSRTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSIV.......................KCTRLMKDKLERGE.-VEVDD.SFVEEKMEIDT...IDWKSRYEQLEKRFESLKHRV...........NEKYNNWV.....IKARKVNENMNSLQNVISQQQAHINE...LQMYNNKLE-HD..LQSKIGSVVSSIEWYLRSMELSDDVKADIEQQLNSIDQLNPVNAMDDFE.............................
E3W521_9REOV/2-279               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVTKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAVDDIE.............................
D1GGM7_9REOV/5-282               .........ESTQQMVNSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAVTIDQALNGKFSSAVRNRNWMTDSKTVAKLDEDVNKLRMMLSSKGIDQRMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........SEKYNNWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-TD..LQNKISLLVSSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
Q91ME6_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
NSP3_ROTHD/5-282                 .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDFVMDDSGVKNNLMGKAATIDQALNGKFSSSIRNRNWMTDSKTVSRLDEDVNKLRLLLSSKGIDQKMRVLNACFSVKRVPGKSSSVI.......................KCTRLMKEKIERGE.-VEVDD.TFVEERMEIDT...IDWKSRYDQLERRFESLKQRV...........NEKYNNWV.....IKARKVNENMNSLQNVISQQQAHINE...LQIYNNKLE-RD..LQSKIGSVISSIEWYLRSMELSDDIKSDIEQQLNSIDHINPVNAFDDFE.............................
F5C6U2_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D2CSV2_ROTHU/1-265               .........-------------SFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
B5APV2_9REOV/5-282               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C5A1_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AG..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
G9JLW3_9REOV/2-279               .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDFVIDDSGVKNNLMGKAITIDQALNGKFSSAIRNRNWMTDSRTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSIV.......................KCTRLMKDKLERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKHRV...........NEKYNHWV.....LKARKVNENMNSLQNVISQQQAHINE...LQMYNNKLE-RD..LQSKIGSVVSSIEWYLRSMELSDDIKSDIEQQLNSIDQLNPANAMDDFE.............................
E2J2N7_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLTSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
A0MD57_9REOV/5-282               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSTIRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSFI.......................KCTRLMKDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKARYDQLEKRFESLKQRV...........NEKYNSWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKISSLVSSVEWYLRSMELSDDVKTDIEQQLNSIDAINPINAIDDLE.............................
Q29U88_9REOV/1-329               .........MATQASVEWIFNVAGSGASSSLDKAIKDAGGSENFSKyVITKFYNNYKDCIDDSGVYNACIGRAKTIDKALNNP-KAAERNEEWYTNVATISRLDLELAELKLMLSNLGIKREERVLNSMFSVVREKGRSSNVImmkqnavkmieegklkikverheTYTESLKNKIEELEcIIDAFE.KGKDITIDLDA...MNGEVKLDGNSCSYNSTAAFVstilgtpikmySESGQPWVdvgnyMNPKNIIEKMIELEIPIFKSDYRNDEspdFDSWNEKSNLKI..ISVNDCHAICIFKFENNWWCFDDGRLKKHNGVGYPLIVANSKFQIDKI-lisgdie......................
F5C4V9_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKPRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D1GHC9_9REOV/5-282               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAMTIDQALNGKFGSVVRNRNWMTDSKTVAKLDEDVNKLRMILSSKGINQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNNWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQQYCSKLE-TD..LQNKISSLVSSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
D5J9V5_9REOV/2-249               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQIQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSM------------------------------.............................
B1NFL3_9REOV/5-282               .........ESTQQMAVSIINSSFEAAVVAATSALENMGIEYDYQD.IYSRVKNKFDFVMDDSGVKNNLIGKAITIDQALNNKFGSAIRNRNWLADTSRAAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMRDKLERGE.-VEVDD.SFVDEKMEVDT...IDWKSRYEQLEQRFESLKSRV...........NEKYNNWV.....LKARKMNENMHSLQNVISQQQAHIAE...LQVYNNKLE-RD..LQNKIGSLPSSIEWYLRSMELDPEIKADIEQQINSIDAINPLHAFDDLE.............................
E3W5A6_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVHD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWI.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
C3RX23_9REOV/5-282               .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDLVMDDSGVKNNLIGKAITIDQALNGKFSSAIRNRNWMTDSRTVAKLDEDVNKLRIMLSSKGIDQKMRVLSACFSVKRIPGKSSSIV.......................KCTRLMKDKLERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKHRV...........NEKYNHWV.....LKARKVNENMNSLQNVISQQQAHINE...LQMYNNKLE-RD..LQSKIGSVVSSIEWYLRSMELSDDVKSDIEQQLNSIDQLNPVNAIDDFE.............................
A3DSF8_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPNDVKNDIEQQLNSIDLINPINAIDDIE.............................
D1GH93_9REOV/2-279               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAMTIDQALNGKFGSVVRNRNWMTDSKTVAKLDEDVNKLRMILSSKGINQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNNWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQQYCSKLE-ND..LQNKISSLVTSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
NSP3_ROTRF/5-282                 .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSAARNRNWMADTRTTARLDEDVNKLRMMLSSKGIDQKMRVLNACFNVKRVPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKQRV...........NEKYTSWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQNYCNKLE-VD..LQNKISSLVSSVEWYLKSMELPDEIKTDIEQQLNSIDVINPINAIDDFE.............................
F5C480_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFGSLVSSVEWYLRSMELSDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D7NN29_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.IYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSVMRNKNWMTDSRTVAKLDEDVNKLRMMLSSKGIDQKMRLLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGA.-VEVDD.SFAEEKMEVDT...VDWKSRYDQLERRFESLKQRV...........NEKYTTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQNYCSKLE-AD..LQNKVGSLVSSVEWYLKSMELPDEVKTDIEQQLNSIDTISPINAIDDLE.............................
F5C4Z5_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKPRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
B2WWU8_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWI.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
B7SY74_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFGSLVSSVEWYLRSMELSDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C7D2_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTIAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
B6URK0_9REOV/5-282               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSTIRNRNWMTDSKTVAKLDEDVNNLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKARYDQLEKRFESLKQRV...........NEKYNSWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKISSLVSSVEWYLRSMELSDDVKTDIEQQLNSIDAINPINAIDDLE.............................
G1CDA6_9REOV/5-282               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAMTIDQALNGKFGSVIRNRNWMTDSKTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGE.-VEVDD.SFVDEKMEVDT...IDWKSRYDQLEKRFESLKQRV...........SEKYNSWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQNKISSLVSSVEWYLRSMELSDDIKTDIEQQLNPIDAINPINAIDDLE.............................
G1FWD8_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDTE.............................
G1FW29_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAVDDIE.............................
Q9IVI1_9REOV/1-56                .........-------------------------------------.------------------------------------------------------------------------------------------------.......................--------------.------.-----------...---------------------...........--------.....--------------------------...----CNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D1GGA8_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKFSSLVSSVEWYLRSMELPDDVKTDIEQQLNSIDLINPINAIDDIE.............................
Q9IVI0_9REOV/1-56                .........-------------------------------------.------------------------------------------------------------------------------------------------.......................--------------.------.-----------...---------------------...........--------.....--------------------------...----CNRLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C702_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINSINAIDDIE.............................
D1GGD2_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVVATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKTDIEQQLNSIDLINPINAIDDIE.............................
D1GHA5_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAVDDIE.............................
E9NAZ0_9REOV/5-282               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFSSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCSKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
E8ZBR1_9REOV/2-279               .........ESTQQMANSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFGSLVSSVEWYLRSMELPDDVKTDIEQQLNSIDLINPINAIDDIE.............................
D1GGU9_9REOV/5-282               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAMTIDQALNGKFGSVVRNRNWMTDSKTVAKLDEDVNKLRMILSSKGINQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNNWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQQYCSKLE-ND..LQNKISSLVTSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
F5CRJ8_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTIAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDI-q............................
D7NN28_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.IYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSVMRNKNWMTDSRTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGA.-VEVDD.SFAEEKMEVDT...VDWKSRYDQLERRFESLKQRV...........NEKYTTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQNYCSKLE-AD..LQNKVGSLVSSVEWYLKSMELPDEVKTDIEQQLNSIDTISPINAIDDLE.............................
G1FW21_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVRRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
NSP3_ROTBN/5-282                 .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYVMDDSGVKNNLLGKAATYDQALNGKFGSAARNRNWMADTRTTARLDEDVNKLRMMLSSKGIDQKMRVLNACFNVKRVPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKQRV...........NEKYTSWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQNYCNKLE-VD..LQNKISSLVSSVEWYLKSMELPDEIKTDIEQQLNSIDVINPINAIDDFE.............................
G8FNI6_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGIKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C7E6_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTIAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D1GG36_9REOV/5-282               .........ESTQQMVNSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAVTIDQALNGKFSSAVRNRNWMTDSKTVAKLDEDVNKLRMMLSSKGIDQRMRVLNACFSVKRVPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEVDT...IDWKSRYDQLEKRFESLKQRV...........SEKYNNWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-TD..LQNKISLLVSSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
B2BMA5_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSAARNRNWMADTRTTARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKQRV...........NEKYTSWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQHYCNKLE-VD..LQNKISSLVSSVEWYIKSMELPDEVKTDIEQQLNSIDVINPINAIDDFE.............................
F5C579_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKPRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
E2J331_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
NSP3_ROTAM/2-279                 .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
Q9IVH7_9REOV/1-56                .........-------------------------------------.------------------------------------------------------------------------------------------------.......................--------------.------.-----------...---------------------...........--------.....--------------------------...----CNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
H8ZHF2_9REOV/1-217               .........-------------------------------------.------------------------KAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLLSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
B6URI9_9REOV/5-282               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSTIRNRNWMTDSNTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRMPGKSSSVI.......................KCTRLMKDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKARYDQLEKRFESLKQRV...........NEKYNSWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKISSLVSSVEWYLRSMELSDDVKTDIEQQLNSIDAINPINAIDDLE.............................
F5C687_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYIDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D1GH33_9REOV/5-282               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAMTIDQALNGKFGSVVRNRNWMTDSKTVAKLDEDVNKLRMILSSKGINQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNNWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQQYCSKLE-ND..LQNKISSLVTSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
E3W570_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFNVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
NSP3_ROTS4/5-282                 .........ESTQQMAVSIINSSFEAAVVAATSALENMGIEYDYQD.IYSRVKNKFDFVMDDSGVKNNLIGKAITIDQALNNKFGSAIRNRNWLADTSRPAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMRDKLERGE.-VEVDD.SFVDEKMEVDT...IDWKSRYEQLEQRFESLKSRV...........NEKYNNWV.....LKARKMNENMHSLQNVISQQQAHIAE...LQVYNNKLE-RD..LQNKIGSLTSSIEWYLRSMELDPEIKADIEQQINSIDAINPLHAFDDLE.............................
E3W459_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEIDD.SYVDEKMEVDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D1GGR3_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKTDIEQQLNSIDLINPINAIDDIE.............................
F5C748_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTIAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
G8FNI5_9REOV/5-282               .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDFVMDDSGVKNNLIGKAVTIDQALNGKFNSSIRNRNWMTDSKTVARLDEDVNKLRLLLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMKEKIERGE.-VEVDD.AFIEEKMEIDT...IDWKSRYDQLERRFESLKQRV...........NEKYNNWV.....IKARKVNENMSSLQNVISQQQAHINE...LQMYNNKLE-RD..LQSKIGSVISSIEWYLRSMELSDDIKSDIEQQLNSIDHINPVNAFDDFE.............................
I1E4A9_9REOV/2-279               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLVGKAITIDQALNGKFGSVARNRNWMTDSRTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKMERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........SEKYNNWV.....QKAKKVNENMYSLQNVISQQQNQITD...LQQYCNKLE-TD..LQNKISSLVSSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
F5C6S9_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEIDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D3JTT9_9REOV/1-250               .........----------------------------MGIQYDYNE.VYTRVKSKFDYIMDDSGVKNNLLGKAATIDQALNGKFGSVARNRNWMADTRTTARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSKYEQLEKRFESLKQRV...........NEKYTSWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQHYCNKLE-VD..LQNKISSLVSSVEWYIKSMELPDEIKTDIEQQLNSIDVINPINAIDDFE.............................
D6N168_9REOV/5-282               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYHE.VFTRVKSKFDYVMDDSGVKNNLLGKAMTIDQALNGKFGSVIRNRNWMTDSKTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGE.-VEVDD.SFVDEKMEVDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNNWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-TD..LQNKIGSLVSSVEWYLRSMELADDIKTDIEQQLNSIDAINPINAIDDLE.............................
E8ZBR2_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNIWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C6X8_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTIAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D1GGF5_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFEALKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D1GH21_9REOV/5-282               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAMTIDQALNGKFGSVVRNRNWMTDSKTVAKLDEDVNKLRMILSSKGINQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNNWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQQYCSKLE-ND..LQNKISSLVTSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
G4WMH0_9REOV/5-282               .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDFVMDDSGVKNNLIGKAATIDQALNGKFSSSIRNRNWMTDSKTVARLDEDVNKLRLLLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMKEKIERGE.-VEVDD.AFIEEKMEIDT...IDWKSRYDQLERRFESLKQRV...........NEKYNNWV.....IKARKVNENMNSLQNVISQQQAHINE...LQIYNNKLE-RD..LQSKIGSVISSIEWYLRSMELSDDIKSDIEQQLNSIDHINPVNAFDDFE.............................
D1GHH7_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFEALKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
E3W4U6_9REOV/2-279               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRILNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAVDDIE.............................
F5C6N1_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
B2BMC7_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYIMDDSGVKNNLLGKAATIDQALNGKFGSAARNRNWMADTRTTARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKQRV...........NEKYTSWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQHYCNKLE-VD..LQNKISSLVSSIEWYMKSMELPDEIKTDIEQQLNSIDVINPINAIDDFE.............................
E9NIB3_9REOV/5-282               .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDHNE.VYTRVKSKFDFVMDDSGVKNNLIGKAATIDQALNGKFSSSIRNRNWMTDSKTVARLDEDVNKLRLLLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMKEKIERGE.-VEVDD.AFIEEKMEIDT...IDWKSRYDQLERRFESLKQRV...........NEKYNNWV.....IKARKVNENMNSLQNVISQQQAHINE...LQIYNNKLE-RD..LQSKIGSVISSIEWYLRSMELSDDIKSDIEQQLNSIDHINPVNAFDDFE.............................
D7F7N0_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCSRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPNDVKNDIEQQLNSIDLINPINAIDDIE.............................
B3SRW1_9REOV/2-279               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSAMRNRNWMTDSKTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKPRYDQLEKRFESLKQRV...........NEKYNSWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQNKINSLVSSVEWYLRSMELSDDVKTDIEQQLNSIDAINPINAIDDLE.............................
C7SB28_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFSSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCSKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
C7B6R5_9REOV/5-282               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQLAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
H6B4C9_9REOV/5-282               .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDFVMDDSGVKNNLIGKAVTIDQALNGKFNSSIRNRNWMTDSKTVARLDEDVNKLRLLLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMKEKIERGE.-VEVDD.AFIEEKMEIDT...IDWKSRYDQLERRFESLKQRV...........NEKYNNWV.....IKARKVNENMSSLQNVISQQQAHINE...LQMYNNKLE-RD..LQSKIGSVISSIEWYLRSMELSDDIKSDIEQQLNSIDHINPVNAFDDFE.............................
F5C4N7_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKPRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C5N5_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYIDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
C3U206_9REOV/1-100               ........a----------------------TSTLGLMGIQYDYNE.LFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACL-------------.......................--------------.------.-----------...---------------------...........--------.....--------------------------...------------..-------------------------------------------------l............................
B2BRF2_9REOV/5-282               .........ESTHHMVSSIINTSFEAGVVAATSTLGFMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAATIDHALNGKFGSTIRNRNWMTDSKTVVRLDEDVNKLRMILSSKGIDHRMRVLNACFSVKRIPGKSSSMI.......................KCTRLMKDKIERGE.-VEVDD.SLVDEKMEIDT...IDWKARYDQLGKRFESLKQRV...........NEKYNSWV.....QKSKGRIENMYSLQNVMRQQQNHIAD...LQQYCNKLE-AD..LQSKISSFVSSVEWYLRSMELSDDVRTEIGQQLNSIDAINPINAIDDL-g............................
E7D6K9_ROTHU/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
B7TAC8_9REOV/1-76                .........---------------------------------DYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGI------------------------.......................--------------.------.-----------...---------------------...........--------.....--------------------------...------------..-------------------------------------------------.............................
F5C543_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGVQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
E5FXI4_9REOV/5-282               .........ESTQQMAVSIINSSFEAAVVAATSALENMGIEYDYQD.VYSRVKNKFDFVMDDSGVKNNLIGKAITIDQALNNKFGSAIRNRNWLADTSRAAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSIV.......................KCTKLMRDKLERGE.-VEVDD.TFVDEKMEVDT...IDWKSRYEQLEQRFESLKSRV...........NEKYNNWV.....LKARKMNENMHSLQNVISQQQAHIAE...LQVYNNKLE-RD..LQNKIGSLTSSIEWYLRSMELDSEIKADIEQQINSIDAINPLHAFDDLE.............................
D3K8X9_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVXSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSAAKNRNWMVDARTTARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRAPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKQRV...........SEKYTSWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQHYCNKLE-VD..LQNKISSLVSSVEWYMKSMELPDEIKTDIEQQLNSIDVINPINAIDDFE.............................
F5C6Z0_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFSSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLISPINAIDDIE.............................
F5C5I7_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYIDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
H6VLJ3_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYIMDDSGVKITLLGKAATIDQALNGKFGSAARNRNWMADTRTTARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKQRV...........NEKYTSWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQHYCNKLE-VD..LQNKISSLVSSVEWYMKSMELPDEVKTDIEQQLNSIDVINPINAIDDFE.............................
NSP3_ROTRH/5-282                 .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDLVMDDSGVKNNLIGKAITIDQALNGKFSSAIRNRNWMTDSRTVAKLDEDVNKLRIMLSSKGIDQKMRVLNACFSVKRIPGKSSSIV.......................KCTRLMKDKLERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKHRV...........NEKYNHWV.....LKARKVNENMNSLQNVISQQQAHINE...LQMYNNKLE-RD..LQSKIGSVVSSIEWYLRSMELSDDVKSDIEQQLNSIDQLNPVNAIDDFE.............................
G1FVY4_9REOV/2-279               .........ESTQQMVSSVINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNIWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKFSSLVSSVEWYLRSMELSDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D1GGY5_9REOV/2-279               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAMTIDQALNGKFGSVVRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNNWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQQYCSKLE-ND..LQNKISSLVTSVEWYLRSMELSDDIKNDIEQQLNSIDAINPINAIDDFE.............................
F5C5Q8_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYIDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D1GGZ7_9REOV/2-279               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAMTIDQALNGKFGSVVRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNNWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQQYCSKLE-ND..LQNKISSLVTSVEWYLRSMELSDDIKNDIEQQLNSIDAINPINAIDDFE.............................
B6URJ5_9REOV/5-282               .........ESTQQMVSSIINTSFGAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSTIRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKARYDQLEKRFESLKQRV...........NEKYNSWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKISSLVSSVEWYLRSMELSDDVKTDIEQQLNSIDAINPINAIDDLE.............................
F5CRF7_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAN...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPNDVKNDIEQQLNSIDLINPINAIDDIE.............................
G3FZH4_9REOV/5-282               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKATTIDQALNGKFGSVMRNRNWMTDSKTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........SEKYNNWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-TD..LQNKVSSLVSSVEWYLRSMELSDDIKTDIEQQLNSIDAINPTNAVDDLE.............................
E7CF50_9REOV/1-100               ........a----------------------TSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFS------------.......................--------------.------.-----------...---------------------...........--------.....--------------------------...------------..-------------------------------------------------.............................
E2J2Y3_9REOV/2-279               .........ESTQQMVSSIINTSFETAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D1GH57_9REOV/2-279               .........ESTQQMVSSIINTSFETAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKTDIEQQLNSIDLINPINAIDDIE.............................
H6B4E0_9REOV/5-282               .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDFVMDDSGVKNNLMGKAVTIDQALNGKFNSSIRNRNWMTDSKTVARLDEDVNKLRLLLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMKEKIERGE.-VEVDD.AFIEEKMEIDT...IDWKSRYDQLERRFESLKQRV...........NEKYNNWV.....IKARKVNENMSSLQNVISQQQAHINE...LQMYNNKLE-RD..LQSKIGSVISSIEWYLRSMELSDDIKSDIEQQLNSIDHINPVNAFDDFE.............................
Q9IVH9_9REOV/1-56                .........-------------------------------------.------------------------------------------------------------------------------------------------.......................--------------.------.-----------...---------------------...........--------.....--------------------------...----CNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
C3U207_9REOV/1-100               ........a----------------------TSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACL-------------.......................--------------.------.-----------...---------------------...........--------.....--------------------------...------------..-------------------------------------------------v............................
F5C5F1_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGVQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C785_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSIEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
C0JLT8_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYIMDDSGVKNNLLGKAATIDQALNGKFGSATRNRNWMTDTRTTARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKQRV...........NEKYTSWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQHYCNKLE-VD..LQNKISSLVSSVEWYMKSMELPDEIKTDIEQQLNSIDVINPINAIDDFE.............................
C7B6S2_9REOV/5-282               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQDKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
H9LI51_9REOV/1-169               .........-------------------------------------.------------------------------------------------------------------------DQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKQRV...........NEKYTSWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQHYCNKLE-VD..LQNKMRKLESSVEWYMKSMELPDEIKTDIEQQLNSIDVINPINAIDDFE.............................
B2CQB4_9REOV/5-282               .........ESTQQMVSXIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNSLLGKAATIDQALNGKFGSTIRNRNXMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKARYDQLEKRFESLKQRV...........NEKYNSWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKISSLVSSVEWYLRSMELSDDVKTDIEQQLNSIDAINPINAIDDLE.............................
I0B172_9REOV/1-251               ........l----------------------------MGIQYDYNE.VYTRVKSKFDFVMDDSGVKNNLMGKAVTIDQALNGKFNSSIRNRNWMTDSKTVARLDEDVNKLRLLLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMKEKIERGE.-VEVDD.AFIEERMEIDT...IDWKSRYDQLERRFESLKQRV...........NEKYNNWV.....IKARKVNENMSSLQNVISQQQAHINE...LQMYNNKLE-RD..LQSKIGSVISSIEWYLRSMELSDDIKSDIEQQLNSIDHINPVNAFDDFE.............................
F6LR29_9REOV/5-282               .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDLVMDDSGVKNNLMGKAVTIDQALNGKFGSAIRNRNWMTDSQTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSIV.......................KCTKLMKDKLERGE.-VEVDD.SFVEEKMEVDT...INWKLRYDQLEKRFESLKHRV...........NEKYNTWV.....VKARKVNENMNSLQNVISQQQAHINE...LQMYNNKLE-RD..LQSKIGSVVSSIEWYLRSMELSDDVKVDIEQQLNSIDQLNPVNAIDDFE.............................
E2J3B5_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFEALKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
Q82048_9REOV/5-282               .........ESTQQMVSSVINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRISGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...VDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-VD..LQGKFSSLVSSVEWYLRSMELPDDVKTDIEQQLNSIDLINPINAIDDIE.............................
F5C676_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
H9C1C5_9REOV/1-189               .........MATQASVEWIFNVAGSAAASSLDKAIKDAGGSENFSKyVITKFYDNYKDCIDDSGVYNACIGRAKTIDKALNNP-KVAERNEEWYTNVATISRLDLELAELKLMLSNLGIKREERVLNSMFSVVREKGRSSNVImmkqnavkmieegklkikverneTYTESLKNKIEELEcIIDAFE.RGKDITIDLDA...M--------------------...........--------.....--------------------------...------------..-------------------------------------------------.............................
D1GGX3_9REOV/5-282               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAMTIDQALNGKFGSVVRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNNWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQQYCSKLE-ND..LQNKISSLVTSVEWYLRSMELSDDIKNDIEQQLNSIDAINPINAIDDFE.............................
E5KJJ0_9REOV/1-329               .........MATQASVEWIFNVAGSAASSSLDKAIKDAGGSENFSKyVITKFYDNYKDCIDDSGVYNACIGRAKTIDKALNNP-KIAKRNEEWYTNVATISRLDLELAELKLMLSNLGVKREERVLNSMFSVVREKGRSSNVImmkqnavkmieegklkikverneTYTESLKNKIEELEcIIDAFE.KGKDITIDLDA...MNGEVKLDGNSCSYNSTAAFVstilgtpikmyNESGQPLFdvgnyMNPKTIIEKMVELEIPIFKSDYRNNEspdFDSWNERSNLKI..VSVNDCHAICIFKFENNWWCFDDGRLKKHNGVGYPLIVANSKFQIDKI-lisgdie......................
B2CQA9_9REOV/5-282               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSTIRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKARYDQLEKRFESLKQRV...........NEKYNSWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKISSLVSSVEWYXRSMELSDDVKTDIEQQLNSIDAINPINAIDDLE.............................
F5C6K7_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C5P5_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
E2EA98_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSAARNRNWMADTRTTDRLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRAPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKQRV...........NEKYTSWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQNYCNKLE-VD..LQNKISSLVSSVEWYLKSMELPDEIKTDIEQQLNSIDVINPINAIDDFE.............................
Q9IVH8_9REOV/1-56                ........c-------------------------------------.------------------------------------------------------------------------------------------------.......................--------------.------.-----------...---------------------...........--------.....--------------------------...-----SKLE-TD..LQNKISSLVSSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDVE.............................
F5C5L1_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFDSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKPRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
E2J2P9_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGVQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
C7B6S9_9REOV/5-282               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLKERFESLKLRV...........TEKYNTWI.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
E7BKX2_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYIMDDSGVKNNLLGKAATIDQALNGKFGSAVRNRNWMADTKTTARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKQRV...........NEKYTSWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQHYCNKLE-VD..LQNKISSLVSSVEWYMKSMELPDEIKTDIEQQLNSIDIINPINAIDDFE.............................
F8U688_9REOV/2-279               .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDFVMDDSGVKNNLMGKAITIDQALNGKFSSSIRNRNWMTDSQTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSIV.......................KCTRLMKDKLERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKHRV...........NEKYNHWV.....LKARKVNENMNSLQNVISQQQAHINE...LQMYNNKLE-RD..LQSKIGSVVSSIEWYLRSMELSDDIKSDIEQQLNSIDQLNPANAMDDFE.............................
B2CQB2_9REOV/5-282               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSTIRNRNWMTDSKTVAKLDEVVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGE.-GEVDD.SFVDEKMEIDT...IDWKARYDQLEKRFESLKQRV...........NEKYNSWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKISSLVSSVEWYLRSMELSDDVKTDIEQQLNSIDAINPINAIDDLE.............................
D1GGW1_9REOV/2-279               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAMTIDQALNGKFGSVVRNRNWMTDSKTVAKLDEDVNKLRMILSSKGINQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNNWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQQYCSKLE-ND..LQNKISSLVTSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
F5C6I4_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEIDD.SYVDEKMEVDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
G1CDD0_9REOV/5-282               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSVMRNRNWMTDSKTVARLDEDVSKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SFVDEKMEVDT...IDWKSRYDQLEKRFESLKQRV...........SEKYNSWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKISSLVSSIEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
G1FWA6_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVIDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPNDVKNDIEQQLNSIDLINPINAIDDIE.............................
E3W4G3_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGVQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C694_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C6M0_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEIDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
G1FVM6_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCSKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINSINAIDDIE.............................
C3U205_9REOV/1-100               ........a----------------------TSTLGLMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACL-------------.......................--------------.------.-----------...---------------------...........--------.....--------------------------...------------..-------------------------------------------------v............................
E3W4H6_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRIKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVVKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMKDKIERGE.-VEVDD.SYIDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-TD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
Q8UZL7_9REOV/5-282               .........ESTQQMAVSIINSSFEAAVVAATSALENMGIEYDYQD.IYSRVKNKFDFVMDDSGVKNNLIGKAITIDQALNNKFGSAIRNRNWLADTSRAAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMRDKLERGE.-VEVDD.SFVDEKMEVDT...IDWKSRYEQLEQRFESLKSRV...........NEKYNNWV.....LKARKMNENMHSLQNVISQQQAHIAE...LQVYNNKLE-RD..LQNKIGSLTSSIEWYLRSMELDPEIKADIEQQINSIDAINPLHAFDDLE.............................
Q82046_9REOV/5-282               .........ESTQQIGISIINSSFEAAVCRCTSTLELMGIQYDYNE.VYTRVKSKFDFVMVDSGVKNNLIGKAATIDQALIGKFSSSIRNRNWMTDSKTVARLDEDVNKLRLLLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMKEKIERGE.-VEVDD.AFIEERMEIDT...IDWKSRYDQLERRFESLKQRV...........NEKYNNWV.....IKARKDNENMNSLQNVISQQQAHINE...LQIYNNKLE-RD..LQSKIGSVISSIEWYLRSMELSDDIKSDIEQQFNSIDHINPVNAFDDFE.............................
F5C5T1_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
G3G3W4_9REOV/5-282               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAMTIDQALNGKFSSVMRNRNWMTDSKTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGE.-VEVDD.SFVDEKMEVDT...IDWKSRYDQLEKRFESLKQRV...........SEKYNNWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKIGSLVSSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
E3UMI0_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5CRG8_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTIAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F8SPY3_9REOV/5-282               .........ESTQQMATSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFNLIMDDSGVRNNLMGKATTIDQALNGKFNSAIRNRNWMTDSRTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSIV.......................KCTRLMKDKLERGE.-VEVDD.SFVEEKMEIDT...IDWKSRYEQLEKRFESLKHRV...........NEKYNNWV.....IKARKVNENMNSLQNVISQQQAHINE...LQMYNNKLE-RD..LQSKIGSVVSSVEWYLRSMELSDDVKADIEQQLNSIDQLNPVNAIDDFE.............................
E3UMI2_9REOV/2-279               .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDFVMDDSGVKNNLIGKAATIDQALNGKFSSSIRNRNWMTDSKTVARLDEDVNKLRLLLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMKEKIERGE.-VEVDD.AFIEEKMEIDT...IDWKSRYDQLERRFESLKQRV...........NEKYNNWV.....IKARKVNENMNSLQNVISQQQAHINE...LQIYNNKLE-RD..LQSKIGSVISSIEWYLRSMELSDDIKSDIEQQLNSIDHINPVNAFDDFE.............................
D1GG12_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........SEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELSDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D1GG00_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C726_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTIAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
G3FZG3_9REOV/5-282               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQHVISQQQNQIAD...LQQYCNKLE-AD..LQGKFNSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
E3W5E1_9REOV/2-279               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.LYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAVDDIE.............................
B2BRG0_9REOV/5-282               .........ESTHHMVSSIINTSFEAAVVAATSTLGFMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAATIDHALNGKFGSTIRNRNWMTDSKTVARLDEDVNKLRMILSSKGIDHRMRVLNACFSVKRIPGKSSSMI.......................KCTRLMKDKIERGE.-VEVDD.SLVDEKMEIDT...IDWKARYDQLGKRFESLKQRV...........NEKYNSWV.....QKSKERNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKISSFVSSVEWYLRSMELSDDVKTEIGQQLNSIDAINPINAIDDL-g............................
C0J9W4_9REOV/5-282               .........ESTQQMANSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSAARNRNWMVDTRTTVRLDEDVNKLRMMLSSKGIDQRMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFIEGKMEVDT...IDWKSRYEQLEKRFESLKQRV...........NEKYTSWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQHYCNKLE-VD..LQNKISSLVSSVEWYMKSMELPDEIKTDIEQQLNSIDVINPINAIDDFE.............................
F5C6W3_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKNKFDYVMDDSGVKNNLLGKAITIDQALNGKFSSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNNWV.....QKAKKVNETMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFGSLVSSVEWYLRSMELSDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D3JTU0_9REOV/1-250               .........----------------------------MGIQYDYNE.VYTRVKSKFDYIMDDSGVKNNLLGKAATIDQALNGKFDSAARNRNWMADTRTTARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLKKRFESLKQRV...........NEKYTSWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQHYCNKLE-VD..LQNKISSLVSSVEWYIKSMELPDEIKTDIEQQLNSIDVINPINAIDDFE.............................
F5C493_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C469_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFGSLVSSVEWYLRSMELSDDVKNDIEQQLNSIDLINPINAIDDIE.............................
Q9IVI2_9REOV/1-56                .........-------------------------------------.------------------------------------------------------------------------------------------------.......................--------------.------.-----------...---------------------...........--------.....--------------------------...----CNKLE-AD..LQGKFSSLMSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C5M2_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKLRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D1GGQ1_9REOV/5-282               .........ESTQQMVNSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAVTIDQALNGKFSSAVRNRNWMTDSKTVAKLDEDVNKLRMMLSSKGIDQRMRVLNACFSVKRVPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEVDT...IDWKSRYDQLEKRFESLKQRV...........SEKYNNWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-TD..LQNKISLLVSSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
G0YZG9_9REOV/5-282               .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDLVMDDSGVKNNLIGKAITIDQALNGKFSSAIRNRNWMTDSRTVAKLDEDVNKLRIMLSSKGIDQKMRVLNACFSVKRIPGKSSSIV.......................KCTRLMKDKLERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKHRV...........NEKYNHWV.....LKARKVNENMNSLQNVISQQQAHINE...LQMYNNKLE-RD..LQSKIGSVVSSIEWYLRSMELSDDVKSDIEQQLNSIDQLNPVNAIDDFE.............................
B6URK5_9REOV/5-282               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSTIRNRNWMTDSKTVAKLDEDVNKLRMILSFKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKARYDQLEKRFESLKQRV...........NEKYNSWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKISSLVSSVEWYLRSMELSDDVKTDIEQQLNSIDDINPINAIDDLE.............................
C3U203_9REOV/1-101               ........a----------------------TSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSV-----------.......................--------------.------.-----------...---------------------...........--------.....--------------------------...------------..-------------------------------------------------.............................
E2J319_9REOV/2-279               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAMTIDQALNGKFGSVVRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNNWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQQYCSKLE-TD..LQNKISSLVSSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
E7CF14_9REOV/1-100               ........a----------------------TSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFS------------.......................--------------.------.-----------...---------------------...........--------.....--------------------------...------------..-------------------------------------------------.............................
NSP3_ROTPC/1-329                 .........MATQASVEWIFNIAGSAASASIAKAIKDAGGSEDFAKyVIARFYDNYKDSVDDTGVYNACIGRARTVDKALDDS-RKAERNEDWHTNLETISRLDLELAELKLILSNLGIKREDRVLNSMFSVVREEGKSSNTVmlkqnavrmieegklkirverneNYTASLKNKIEELEcMIDAFE.KGKEIIISLDA...MNGEVKRDGNSCSYNSTAAFVstivgnpikmyDESGKPLFdvgdyLNPKHIIDKMIENEIPIFKSDYRNNEspdFDVWNERSNLKI..VSINDCHAICVFKFENAWWCFDDGVLNKYSGNGNPLIVANAKFQIDKI-lisgdve......................
E9NIC2_9REOV/5-282               .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDFVMDDSGVKNNLIGKAVTIDQALNGKFSSSIRNRNWMTDSKTVARLDEDVNKLRLLLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMKEKIERGE.-VEVDD.AFIEEKMEIDT...IDWKSRYDQLERRFESLKQRV...........NEKYNNWV.....IKARKVNENMNSLQNVISQQQAHINE...LQIYNNKLE-RD..LQSKIGSVISSIEWYLRSMELSDDIKSDIEQQLNSIDHINPVNAFDDFE.............................
A3DSG9_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVARLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMKDKIERGE.-VEVDD.SYIDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-TD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
H6B4F1_9REOV/5-282               .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDFVMDDSGVKNNLMGKAVTIDQALNGKFNSSIRNRNWMTDSKTVARLDEDVNKLRLLLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMKEKIERGE.-VEVDD.AFIEEKMEIDT...IDWKSRYDQLERRFESLKQRV...........NEKYNNWV.....IKARKVNENMSSLQNVISQQQAHINE...LQMYNNKLE-RD..LQSKIGSVISSIEWYLRSMELSDDIKSDIEQQLNSIDHINPVNAFDDFE.............................
D1GGT7_9REOV/2-279               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAMTIDQALNGKFGSVVRNRNWMTDSKTVAKLDEDVNKLRMILSSKGINQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNNWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQQYCSKLE-ND..LQNKISSLVTSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
E5KJH0_9REOV/1-329               .........MATQASVEWIFNVAGSAASSSLDRAIKDAGGSESFSKyVITKFYDNYKDCIDDSGVYNACIGRAKTIDKALNNP-KAAERNEEWYTNVATISRLDLELAELKLMLSNLGIKREERVLNSMFSVVREKGRSSNVImmkqnavkmieegklkikverneTYTESLKNKIEELEcIIDAFE.KGKDITIDLDA...MNGEVKLDGNSCSYNATAAFVstilgtpikmyNESGQPLFdvgnyMNPKTIIEKMTELEIPIFKSDYRNDEspdFDGWNERSNLKI..ISVNDCHAICIFKFENNWWCFDDGRLKKHNGTGYPLIVANSKFQIDKI-lisgdie......................
C3TTS4_9REOV/2-273               .........EATTLSVKSILVAAFDYAFVTTKSFLDDRKIEYDEND.IKIVLKQKMDFILEDSGVKANILGKAATIDQALSGKTASANRNANWMTTQYTVSKLDEDVNRLRMLLSSQNITQETRVLNSCFKVRRDPNKSSSYI.......................TCTKLLKEKLKRGE.VIEVAD.DVEEKVIVTDT...IDWKAKFEKLKTRFQ------...........-EKYDSWV.....VKARKVTSTVRSMQMVIANQQQIINS...FE---EKQIQKEleYKNRIEALISSIKCKIESKQFNTETKNDYIQELDMTTVIDTADGMESIE.............................
H9LGH1_9REOV/1-262               .........----------------AAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSAARNRNWMADTRTTARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYERLEKRFESLKQRV...........NEKYTSWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQHYCNKLE-VD..LQNKISSLVSSVEWYMKSMELPDEVKTDIEQQLNSIDVINPINAIDDFE.............................
D1GG24_9REOV/5-282               .........ESTQQMVNSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAVTIDQALNGKFSSAVRNRNWMTDSKTVAKLDEDVNKLRMMLSSKGIDQRMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........SEKYNNWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-TD..LQNKISLLVSSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
F5C4H6_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
E3UMI1_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D5LG78_9REOV/5-282               .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDLVMDDSGVKNNLMGKAITIDQALNGKFGSAIRNRNWMTDSRTVAKLDEDVNKLRMMLSSKGIDQKIRVLNACFSVKRIPGKSSSIV.......................KCTKLMKDKLERGE.-VEVDD.SFVEEKMEVDT...INWKLRYDQLEKRFESLKHRV...........NEKYNTWV.....VKARKVNENMNSLQNVISQQQAHINE...LQMYNNKLE-RD..LQSKIGSVVSSIEWYLRSMELSDDVKVDIEQQLNSIDQLNPVNAIDDFE.............................
D1GG72_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVVATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKTDIEQQLNSIDLINPINAIDDIE.............................
G1FVT6_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFSSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDERMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQQYCSKLE-AD..LQGKLSSLVSSVEWYLRSMELPNDVKTDIEQQLNSIDLINSINAIDDIE.............................
E3W4T8_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLKSMELPNDVKNDIEQQLNSIDLINPINAIDDIE.............................
Q5Q1N5_9REOV/5-282               .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDFVMDDSGVKNNLMGKAATIDQALNGKFSSSIRNRNWMTDSKTVARLDEDVNKLRLLLSSKGIDQKMRVLNACFSVKRVPGKSSSVI.......................KCTRLMKEKIERGE.-VEVDD.TFIEERMEIDT...IDWKSRYDQLERRFESLKQRV...........NEKYNNWV.....IKARKVNENMNSLQNVISQQQAHINE...LQIYNNKLE-RD..LQSKIGSVISSIEWYLRSMELSDDIKSDIEQQLNSIDHINPVNAFDDFE.............................
C7SYE8_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
E3W4V8_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQVEKRFESLKQRV...........NEKYNTWI.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
H8ZHF1_9REOV/1-273               .........-----MVSSIINTSFEAAVVAATSTIELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIYQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTILMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLLSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C7C0_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTIAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-VD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
E2J2L3_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSETVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYIDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
B6URJ9_9REOV/5-282               .........ESTQQMVSSLINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSTIRNRNWMTDSKTAAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KFTRLMKDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKARYDQLEKRFESLKQRV...........NEKYNSWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKISSLVSSVEWYLRSMELSDDVKTDIEQQLNSIDAINPINAIDDLE.............................
Q9IVH6_9REOV/1-56                .........-------------------------------------.------------------------------------------------------------------------------------------------.......................--------------.------.-----------...---------------------...........--------.....--------------------------...----CNKLE-AD..LQSKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C4R0_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKLRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
E2J367_9REOV/2-279               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAMTIDQALNGKFGSVVRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNNWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQQYCSKLE-TD..LQNKISSLVSSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
F5C5R9_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
E8ZBR3_9REOV/2-279               .........ESTQQMASSIINTSFEAAVVAATSTLEVMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRILNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAVDDIE.............................
B6SAN7_9REOV/5-282               .........ESTQQMAISIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDLIMDDSGVKNNLMGKATTIDQALNGKFNSAIRNRNWMTDSRTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSIV.......................KCTRLMKDKLERGE.-VEVDD.SFVEEKMEIDA...IDWKSRYEQLEKRFESLKHRV...........NEKYNNWV.....IKARKVNENMNSLQNVISQQQAHINE...LQMYNNKLE-RD..LQSKIGSVVSSIEWYLRSMELSDDVKADIEQQLNSIDQLNPVNAMDDFE.............................
E5E7S2_9REOV/2-280               .........ESTQQMVQSVLNSAFDAAVIAATSTLDLMEIKYDHNE.VYSRIKNKFEFVMDDSGVRNNLLGKAATVDQALNGKFGSATRNRDWMTDSRTITKLDEDVNRLRMLLSSKGIDQKMRVLNSCFSVKRIPGKSSSII.......................KCTKLMKDKLERGE.-VEVEDpKDESEEMEVDI...VDWKKKYDQLEDKFIKMKKRV...........DEKYTCWV.....QKAKKVSESVYALQDVISQQQQHITE...LQQYNNKLE-KD..LQNKISTMISSVEWYLKSMELPSEAKEDIEQQLNSIDIINPCTAIDDIE.............................
C3U204_9REOV/1-100               ........a----------------------TSTLELMGIQYDYNG.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACL-------------.......................--------------.------.-----------...---------------------...........--------.....--------------------------...------------..-------------------------------------------------v............................
H9N1B2_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.IYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSVMRNKNWMTDSRTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSVI.......................KCTRLMKDKIERGA.-VEVDD.SFAEEKMEVDT...VDWKSRYDQLERRFESLKQRV...........NEKYTTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQNYCSKLE-AD..LQNKVGSLVSSVEWYLKSMELPDEVKTDIEQQLNSIDTISPINAIDDLE.............................
E2J379_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D1GH45_9REOV/5-282               .........ESTQQMVNSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAVTIDQALNGKFSSAVRNRNWMTDSKTVAKLDEDVNKLRMMLSSKGIDQRMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........SEKYNNWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-TD..LQNKISLLVSSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
Q1L7J7_9REOV/5-282               .........ESTQQMASSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDFVMDDSGVKNNLIGKAATIDQALNGKFSSSIRNRNWMTDSKTVARLDEDVNKLRLLLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMKEKIERGE.-VEVDD.AFIEEKMEIDT...IDWKSRYDQLERRFESLKQRV...........NEKYNNWV.....IKARKVNENMNSLQNVISQQQAHINE...LQIYNNKLE-RD..LQSKIGSVISSIEWYLRSMELSDDIKSDIEQQLNSIDHINPVNAFDDFE.............................
E3W4M8_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDAKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C735_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTIAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F6MF71_9REOV/5-282               .........ESTQQMATSIINSSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDLIMDDSGVRNNLMGKATTIDQALNGKFSSAIRNRNWMTDSRTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSIV.......................KCTRLMKDKLDRGE.-VEVDD.SFVEEKMEIDT...IDWKSRYEQLEKRFESLKHRV...........NEKYNNWV.....IKARKVNENMNSLQNVISQQQAHINE...LQMYNNKLE-RD..LQSKIGSVVSSIEWYLRSMELSDDVKADIEQQLNSIDQLNPVNAIDDFE.............................
F5C6R8_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
F5C714_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTIAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
H9N1A0_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYIMDDSGVKNNLLGKAATIDQALNGRFGSAARNRNWMADTRTTARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKQRV...........NEKYTSWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQHYCNKLE-VD..LQNKISSLVSSVEWYMKSMELPDEIKTDIEQQLNSIDVINPINAIDDFE.............................
Q1WK40_9REOV/5-282               .........ESTQQMANSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSAVRNRNWMTDTRTTTRLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKQRV...........NEKYTSWV.....QKAKKANENMYFLQNVISQQQNQIAD...LQHYCNKLE-VD..LQNKISSLVSSIEWYMKSMELPDEVKTDIEQQLNSIDVINPVNAIDDFE.............................
C5IAV4_9REOV/5-282               .........ESTQQMASSIINSSFEAAVVAATSTLELMGTQYDYNE.VYTRVKSKFDFVMDDSGVKNNLMGKAVTIDQALNGKFGSAIRNRNWMIDSRTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRVPGKSSSIV.......................KCTRLMKDKLERGE.-VEVDD.SFVEEKMEIDT...IDWKSRYEQLEKRFESLKHRV...........NEKYNNWV.....LKARKVNENMNSLQNVISQQQAHIND...LQMYNNKLE-RD..LQSKIGSVVSSIEWYLRSMELSDDVKSDIEQQLNSIDQLNPVNAMDDFE.............................
E3W5D0_9REOV/2-279               .........ESTQQMVRSIINTSFEAAVVAATSTLELMGVQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTKLMKDKIERGE.-VEIDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
Q9IM70_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFEALKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQISD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
D1GGH9_9REOV/5-282               .........ESTQQMVGSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAMTIDQALNGKFGSVVRNRNWMTDSKTVAKLDEDVNKLRMILSSKGINQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNNWV.....QKAKKVNENMYSLQNVISQQQSQIAD...LQQYCSKLE-ND..LQNKISSLVTSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
E9NAZ1_9REOV/5-282               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.IFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKLRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
C7B6T4_9REOV/5-282               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYTTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINSINAIDDIE.............................
I0B173_9REOV/1-248               .........------------------------------IQYDYNE.VYTRVKSKFDFVMDDSGVKNNLMGKAVTIDQALNGKFNSSIRNRNWMTDSKTVARLDEDVNKLRLLLSSKGIDQKMRVLNACFSVKRVPGKSSSII.......................KCTRLMKEKIERGE.-VEVDD.AFIEEKMEIDT...IDWKSRYDQLERRFESLKQRV...........NEKYNNWV.....IKARKVNENMSSLQNVISQQQAHINE...LQMYNNKLE-RD..LQSKIGSVISSIEWYLRSMELSDDIKSDIEQQLNSIDHINPVNAFDDFE.............................
C4MQ12_ROTHU/5-282               .........ESTQQMVGCIINTSFPAAVVAATSTIELMGIQYDYNE.VFTRVKSKFDYIMDDSGVKNNLLGKAVTIDQALNGKFGSVIRNRNWMTDSKTVAKLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMRDKIERGE.-VEVDD.SFVDEKMDIDT...IDWKSRYDQLEKRFESLKQRV...........NDQYNSWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-TD..LQNKISSLVSSVEWYLRSMELSDDIKTDIEQQLNSIDAINPINAIDDLE.............................
D4PBN0_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKATTIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMTLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........TEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQGKFSSLVSSVEWYLRSMELPDDVKNDIEQQLNSIDLINPINAIDDIE.............................
B8Y8B5_9REOV/5-282               .........ESTQQMASSIINTSFEAAVVAATSTLELMGIQYDYNE.VYTRVKSKFDYVMDDSGVKNNLLGKAATIDQALNGKFGSAARNRNWMADTRTTARLDEDVNKLRMMLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SFVEEKMEVDT...IDWKSRYEQLEKRFESLKQRV...........NEKYTSWV.....QKAKKMNENIYSLQNVISQQQNQIAD...LQHYCNKLE-VD..LQNKISSLVSSVEWYMKSMELPDEVKTDIEQQLNSIDVINPINAIDDFE.............................
D1GGK3_9REOV/2-279               .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAITIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMILSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE.-VEVDD.SYVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNTWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE-AD..LQSKFSSLVSSVEWYLRSMELPDDVKTDIEQQLNSIDLINPINAIDDIE.............................
#=GC SS_cons                     .........THHHHHHHHHHHHHHHHHHHHHHHHHHHTT----HHH.HHHHHHHHHHHHHCHTSTTHHHHHHHHHHHHHHTTXTHHHHHHHHHHH-TTHHHHHHHHHHHHHHHHHHTT-HHHHHHHHHHEEEE--TTSSSEEE.......................EE-HHHHHHHTTS-.-EEEEH.HHHHHTXXXXX...XXXXXXXXXXXXXXXXXXXXX...........XXXXXXXX.....XXXXXXXXXXXXHHHHHHHHHHHHHH...HHHHHHHHH-HH..HHHHHHHHHHHHHHHHHTSXXXHHHHHHHHHHHCTSXSSXHHHHHHHHH.............................
#=GC seq_cons                    .........ESTQQMVSSIINTSFEAAVVAATSTLELMGIQYDYNE.VFTRVKSKFDYVMDDSGVKNNLLGKAlTIDQALNGKFGSAIRNRNWMTDSKTVAKLDEDVNKLRMhLSSKGIDQKMRVLNACFSVKRIPGKSSSII.......................KCTRLMKDKIERGE..VEVDD.SaVDEKMEIDT...IDWKSRYDQLEKRFESLKQRV...........NEKYNoWV.....QKAKKVNENMYSLQNVISQQQNQIAD...LQQYCNKLE.sD..LQuKhSSLVSSVEWYLRSMELsDDVKsDIEQQLNSIDlINPINAIDDlE.............................
//
DBGET integrated database retrieval system