GenomeNet

Database: Pfam
Entry: Rota_NSP4
LinkDB: Rota_NSP4
Original site: Rota_NSP4 
#=GF ID   Rota_NSP4
#=GF AC   PF01452.13
#=GF DE   Rotavirus non structural protein
#=GF AU   Bateman A
#=GF SE   Prodom_2202 (release 99.1)
#=GF GA   25.00 25.00;
#=GF TC   399.40 399.30;
#=GF NC   22.90 20.30;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 11927849 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   2548854
#=GF RT   Topology of the non-structural rotavirus receptor glycoprotein
#=GF RT   NS28 in the rough endoplasmic reticulum. 
#=GF RA   Bergmann CC, Maass D, Poruchynsky MS, Atkinson PH, Bellamy AR; 
#=GF RL   EMBO J 1989;8:1695-1703.
#=GF RN   [2]
#=GF RM   8887538
#=GF RT   The cytoplasmic tail of NSP4, the endoplasmic
#=GF RT   reticulum-localized non-structural glycoprotein of rotavirus,
#=GF RT   contains distinct virus binding and coiled coil domains. 
#=GF RA   Taylor JA, O'Brien JA, Yeager M; 
#=GF RL   EMBO J 1996;15:4469-4476.
#=GF DR   INTERPRO; IPR002107;
#=GF DR   SCOP; 1g1i; fa;
#=GF CC   This protein has been called NSP4, NSP5, NS28, and NCVP5. The
#=GF CC   final steps in the assembly of rotavirus occur in the lumen of
#=GF CC   the endoplasmic reticulum (ER). Targeting of the immature inner
#=GF CC   capsid particle (ICP) to this compartment is mediated by the
#=GF CC   cytoplasmic tail of NSP4, located in the ER membrane.
#=GF SQ   1
#=GS NSP4_ROTSH/1-173  AC A2T3Q0.1
NSP4_ROTSH/1-173             MEKLTDLNYTLSVITLMNNTLHTILEDPGMAYFPYIASVLTVLFALHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVQTTGEIDMTKEINQKNVRTLEEWESGKNPYEPREVTA
#=GC seq_cons                MEKLTDLNYTLSVITLMNNTLHTILEDPGMAYFPYIASVLTVLFALHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVQTTGEIDMTKEINQKNVRTLEEWESGKNPYEPREVTA
//
DBGET integrated database retrieval system