GenomeNet

Database: Pfam
Entry: Rota_NSP4
LinkDB: Rota_NSP4
Original site: Rota_NSP4 
#=GF ID   Rota_NSP4
#=GF AC   PF01452.12
#=GF DE   Rotavirus non structural protein
#=GF AU   Bateman A
#=GF SE   Prodom_2202 (release 99.1)
#=GF GA   25.00 25.00;
#=GF TC   81.70 81.40;
#=GF NC   23.70 20.30;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 80369284 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   2548854
#=GF RT   Topology of the non-structural rotavirus receptor glycoprotein
#=GF RT   NS28 in the rough endoplasmic reticulum. 
#=GF RA   Bergmann CC, Maass D, Poruchynsky MS, Atkinson PH, Bellamy AR; 
#=GF RL   EMBO J 1989;8:1695-1703.
#=GF RN   [2]
#=GF RM   8887538
#=GF RT   The cytoplasmic tail of NSP4, the endoplasmic
#=GF RT   reticulum-localized non-structural glycoprotein of rotavirus,
#=GF RT   contains distinct virus binding and coiled coil domains. 
#=GF RA   Taylor JA, O'Brien JA, Yeager M; 
#=GF RL   EMBO J 1996;15:4469-4476.
#=GF DR   INTERPRO; IPR002107;
#=GF DR   SCOP; 1g1i; fa;
#=GF CC   This protein has been called NSP4, NSP5, NS28, and NCVP5. The
#=GF CC   final steps in the assembly of rotavirus occur in the lumen of
#=GF CC   the endoplasmic reticulum (ER). Targeting of the immature inner
#=GF CC   capsid particle (ICP) to this compartment is mediated by the
#=GF CC   cytoplasmic tail of NSP4, located in the ER membrane.
#=GF SQ   2071
#=GS A0A024CF60_9REOV/1-173  AC A0A024CF60.1
#=GS F5C4U5_9REOV/1-173      AC F5C4U5.1
#=GS D7SC37_9REOV/1-170      AC D7SC37.1
#=GS T2CEL3_9REOV/1-173      AC T2CEL3.1
#=GS F5C5M0_9REOV/1-173      AC F5C5M0.1
#=GS B2Z9T8_9REOV/1-124      AC B2Z9T8.1
#=GS C3U216_9REOV/14-186     AC C3U216.1
#=GS B2CQB5_9REOV/1-173      AC B2CQB5.1
#=GS I6YQW8_9REOV/1-157      AC I6YQW8.1
#=GS H9MZM8_9REOV/1-170      AC H9MZM8.1
#=GS I6ZV00_9REOV/1-116      AC I6ZV00.1
#=GS I6YQW0_9REOV/1-157      AC I6YQW0.1
#=GS M1KD72_9REOV/1-173      AC M1KD72.1
#=GS M1NY94_9REOV/14-186     AC M1NY94.1
#=GS Q99IM3_9REOV/1-173      AC Q99IM3.1
#=GS Q8UZN2_9REOV/1-167      AC Q8UZN2.1
#=GS S5U4C4_9REOV/1-173      AC S5U4C4.1
#=GS B2Z9V1_9REOV/1-127      AC B2Z9V1.1
#=GS NSP4_ROTH6/1-173        AC B3SRQ8.1
#=GS L7T8N6_9REOV/1-173      AC L7T8N6.1
#=GS V9VHT1_9REOV/10-182     AC V9VHT1.1
#=GS Q9QGR7_9REOV/1-173      AC Q9QGR7.1
#=GS E7CBF4_9REOV/1-170      AC E7CBF4.1
#=GS Q80DH6_9REOV/1-133      AC Q80DH6.1
#=GS X2G5Z7_9REOV/1-173      AC X2G5Z7.1
#=GS M1HEP8_9REOV/1-173      AC M1HEP8.1
#=GS F5C6P2_9REOV/1-173      AC F5C6P2.1
#=GS D7NN64_9REOV/1-173      AC D7NN64.1
#=GS Q4G637_9REOV/1-173      AC Q4G637.1
#=GS L7SV20_9REOV/5-179      AC L7SV20.2
#=GS G8FNI9_9REOV/1-173      AC G8FNI9.1
#=GS E7CBN1_9REOV/1-170      AC E7CBN1.1
#=GS D0UD04_9REOV/1-173      AC D0UD04.1
#=GS C0JLV0_9REOV/1-173      AC C0JLV0.1
#=GS NSP4_ROTEH/1-173        AC Q9PYD2.1
#=GS M1H985_9REOV/1-173      AC M1H985.1
#=GS H2FJ35_9REOV/1-173      AC H2FJ35.1
#=GS Q4G662_9REOV/1-173      AC Q4G662.1
#=GS C1K3I4_9REOV/1-167      AC C1K3I4.1
#=GS D7SC38_9REOV/1-170      AC D7SC38.1
#=GS S5S0R9_9REOV/1-173      AC S5S0R9.1
#=GS R9QUM8_9REOV/1-173      AC R9QUM8.1
#=GS E2J2Y6_9REOV/1-173      AC E2J2Y6.1
#=GS Q9E3V6_9REOV/1-173      AC Q9E3V6.1
#=GS A9ZP28_9REOV/1-167      AC A9ZP28.1
#=GS S5RGD5_9REOV/1-173      AC S5RGD5.1
#=GS L7NUD3_9REOV/1-173      AC L7NUD3.1
#=GS A3DSL7_9REOV/1-173      AC A3DSL7.1
#=GS E7D6L3_ROTHU/1-173      AC E7D6L3.1
#=GS E7CBH0_9REOV/1-161      AC E7CBH0.1
#=GS J7H3F3_9REOV/3-175      AC J7H3F3.1
#=GS E2J3D0_9REOV/1-173      AC E2J3D0.1
#=GS C7EWT0_9REOV/1-167      AC C7EWT0.1
#=GS F5C5A0_9REOV/1-173      AC F5C5A0.1
#=GS C1K3H4_9REOV/1-166      AC C1K3H4.1
#=GS A8C4Y9_9REOV/1-167      AC A8C4Y9.1
#=GS Q1G1S7_9REOV/1-170      AC Q1G1S7.1
#=GS B0ZSX0_9REOV/4-169      AC B0ZSX0.1
#=GS F5C478_9REOV/1-173      AC F5C478.1
#=GS I7E4A5_9REOV/1-173      AC I7E4A5.1
#=GS S5S0S9_9REOV/1-173      AC S5S0S9.1
#=GS Q1G1T0_9REOV/1-170      AC Q1G1T0.1
#=GS I2E7S0_9REOV/1-173      AC I2E7S0.1
#=GS Q9YKF7_9REOV/1-173      AC Q9YKF7.1
#=GS U3LZX4_9REOV/1-173      AC U3LZX4.1
#=GS D0TZ91_9REOV/1-173      AC D0TZ91.1
#=GS A4ZD96_9REOV/1-173      AC A4ZD96.1
#=GS O90367_9REOV/1-173      AC O90367.1
#=GS Q82031_9REOV/1-173      AC Q82031.1
#=GS I6ZLQ5_9REOV/1-157      AC I6ZLQ5.1
#=GS D1GH24_9REOV/1-173      AC D1GH24.1
#=GS A3DSJ2_9REOV/1-173      AC A3DSJ2.1
#=GS M1KHF4_9REOV/1-173      AC M1KHF4.1
#=GS G1DH81_9REOV/1-169      AC G1DH81.1
#=GS T1RQ43_9REOV/1-165      AC T1RQ43.1
#=GS B6SAI3_9REOV/1-173      AC B6SAI3.1
#=GS M1H868_9REOV/1-173      AC M1H868.1
#=GS F5C624_9REOV/1-173      AC F5C624.1
#=GS K9LHJ1_9REOV/1-173      AC K9LHJ1.1
#=GS B6RGK8_9REOV/1-173      AC B6RGK8.1
#=GS G1FWE3_9REOV/1-173      AC G1FWE3.1
#=GS G3FJ65_9REOV/1-159      AC G3FJ65.1
#=GS F5B3L5_9REOV/8-180      AC F5B3L5.1
#=GS A5HAV1_9REOV/1-158      AC A5HAV1.1
#=GS B2Z9V5_9REOV/1-127      AC B2Z9V5.1
#=GS E7CBN8_9REOV/1-163      AC E7CBN8.1
#=GS D5HMU5_9REOV/1-173      AC D5HMU5.1
#=GS G5CPK5_9REOV/1-173      AC G5CPK5.1
#=GS E9NME6_9REOV/1-170      AC E9NME6.1
#=GS H9MZL5_9REOV/1-170      AC H9MZL5.1
#=GS S5RGE0_9REOV/2-174      AC S5RGE0.1
#=GS G1DH76_9REOV/1-170      AC G1DH76.1
#=GS B2Z9W8_9REOV/1-127      AC B2Z9W8.1
#=GS T1ULL7_9REOV/9-181      AC T1ULL7.1
#=GS I6ZYY8_9REOV/1-157      AC I6ZYY8.1
#=GS P89062_9REOV/1-173      AC P89062.1
#=GS H9MZQ3_9REOV/1-170      AC H9MZQ3.1
#=GS Q4G650_9REOV/1-173      AC Q4G650.1
#=GS E1CJG6_9REOV/1-173      AC E1CJG6.1
#=GS A0A024CEU1_9REOV/1-173  AC A0A024CEU1.1
#=GS Q9ICH0_9REOV/1-173      AC Q9ICH0.1
#=GS Q4G631_9REOV/1-173      AC Q4G631.1
#=GS B0ZSX6_9REOV/5-170      AC B0ZSX6.1
#=GS G0YWF1_9REOV/1-165      AC G0YWF1.1
#=GS A0A023UH75_9REOV/1-139  AC A0A023UH75.1
#=GS M1PSI6_9REOV/14-186     AC M1PSI6.1
#=GS E7CBN4_9REOV/1-170      AC E7CBN4.1
#=GS M1PDX8_9REOV/1-173      AC M1PDX8.1
#=GS D2D989_9REOV/1-173      AC D2D989.1
#=GS F5C5X7_9REOV/1-173      AC F5C5X7.1
#=GS Q4G668_9REOV/1-173      AC Q4G668.1
#=GS A5H1R7_9REOV/1-158      AC A5H1R7.1
#=GS B2Z9W2_9REOV/1-124      AC B2Z9W2.1
#=GS F5C758_9REOV/1-173      AC F5C758.1
#=GS F5B531_9REOV/8-180      AC F5B531.1
#=GS E7CBH6_9REOV/1-173      AC E7CBH6.1
#=GS NSP4_ROTCU/1-173        AC Q9PYC7.1
#=GS B0ZSX3_9REOV/1-163      AC B0ZSX3.1
#=GS Q2PGE5_9REOV/1-173      AC Q2PGE5.1
#=GS C3U211_9REOV/14-186     AC C3U211.1
#=GS Q9WAJ1_9REOV/1-173      AC Q9WAJ1.1
#=GS B8Y639_9REOV/1-101      AC B8Y639.1
#=GS Q99IM4_9REOV/1-173      AC Q99IM4.1
#=GS E7CBM1_9REOV/1-173      AC E7CBM1.1
#=GS D5HMU3_9REOV/1-173      AC D5HMU3.1
#=GS Q1G1S4_9REOV/1-170      AC Q1G1S4.1
#=GS D0QB82_9REOV/1-173      AC D0QB82.1
#=GS C1K3J8_9REOV/1-167      AC C1K3J8.1
#=GS E9KPD8_9REOV/1-173      AC E9KPD8.1
#=GS E7CBI8_9REOV/1-173      AC E7CBI8.1
#=GS B7ZGV6_9REOV/1-155      AC B7ZGV6.1
#=GS I3QDB8_9REOV/1-173      AC I3QDB8.1
#=GS B8Y637_9REOV/1-101      AC B8Y637.1
#=GS E2J358_9REOV/1-173      AC E2J358.1
#=GS D3JPT1_9REOV/1-172      AC D3JPT1.1
#=GS Q4G620_9REOV/1-173      AC Q4G620.1
#=GS H6B4E1_9REOV/1-173      AC H6B4E1.1
#=GS A9ZQ63_9REOV/1-173      AC A9ZQ63.1
#=GS E0YLK8_9REOV/1-173      AC E0YLK8.1
#=GS J9QA87_9REOV/10-182     AC J9QA87.1
#=GS E7CBK8_9REOV/1-173      AC E7CBK8.1
#=GS E0XH99_9REOV/1-162      AC E0XH99.1
#=GS B2Z9W6_9REOV/1-124      AC B2Z9W6.1
#=GS B5ATN1_9REOV/1-167      AC B5ATN1.1
#=GS F5C747_9REOV/1-173      AC F5C747.1
#=GS D0UD23_9REOV/1-173      AC D0UD23.1
#=GS A3DSH0_9REOV/1-173      AC A3DSH0.1
#=GS E3TPX3_9REOV/1-173      AC E3TPX3.1
#=GS M1PE64_9REOV/1-158      AC M1PE64.1
#=GS A9CQ66_9REOV/1-173      AC A9CQ66.1
#=GS M1KJ38_9REOV/1-173      AC M1KJ38.1
#=GS Q4G643_9REOV/1-173      AC Q4G643.1
#=GS V5IX86_9REOV/1-173      AC V5IX86.1
#=GS E0YMX9_9REOV/1-173      AC E0YMX9.1
#=GS Q80FH6_9REOV/1-147      AC Q80FH6.1
#=GS E3W4N4_9REOV/1-173      AC E3W4N4.1
#=GS E7ECR1_9REOV/8-180      AC E7ECR1.1
#=GS H9LH84_9REOV/1-168      AC H9LH84.1
#=GS Q9YIP3_9REOV/1-173      AC Q9YIP3.1
#=GS S5RGJ1_9REOV/14-186     AC S5RGJ1.1
#=GS X2FPQ5_9REOV/1-173      AC X2FPQ5.1
#=GS D7SC41_9REOV/1-170      AC D7SC41.1
#=GS X2G5Y4_9REOV/1-173      AC X2G5Y4.1
#=GS B7ZGW7_9REOV/1-155      AC B7ZGW7.1
#=GS V5IX09_9REOV/1-173      AC V5IX09.1
#=GS G9DDQ3_9REOV/1-165      AC G9DDQ3.1
#=GS D1GH96_9REOV/1-173      AC D1GH96.1
#=GS Q6PV85_9REOV/1-173      AC Q6PV85.1
#=GS NSP4_ROTRF/1-173        AC Q6YLV5.1
#=GS Q9WAJ4_9REOV/1-173      AC Q9WAJ4.1
#=GS B5ATZ9_9REOV/1-173      AC B5ATZ9.1
#=GS B0ZSX2_9REOV/4-169      AC B0ZSX2.1
#=GS M4ZVB6_9REOV/1-173      AC M4ZVB6.1
#=GS C7EWU0_9REOV/3-165      AC C7EWU0.1
#=GS E7CF24_9REOV/1-173      AC E7CF24.1
#=GS S5RGK5_9REOV/2-174      AC S5RGK5.1
#=GS E9NIC3_9REOV/1-173      AC E9NIC3.1
#=GS H9MZQ1_9REOV/1-170      AC H9MZQ1.1
#=GS E7ECQ7_9REOV/8-180      AC E7ECQ7.1
#=GS NSP4_ROTYO/1-173        AC Q9WAI8.1
#=GS E7CBL6_9REOV/1-172      AC E7CBL6.1
#=GS F8U667_9REOV/1-173      AC F8U667.1
#=GS M1KBS7_9REOV/1-173      AC M1KBS7.1
#=GS Q006L2_9REOV/1-173      AC Q006L2.1
#=GS S5RLM9_9REOV/2-174      AC S5RLM9.1
#=GS S5S2Q5_9REOV/1-173      AC S5S2Q5.1
#=GS S5RGF9_9REOV/1-173      AC S5RGF9.1
#=GS Q9Z045_9REOV/1-173      AC Q9Z045.1
#=GS E2J2P0_9REOV/1-173      AC E2J2P0.1
#=GS T2CEG3_9REOV/1-173      AC T2CEG3.1
#=GS B7ZGV0_9REOV/1-154      AC B7ZGV0.1
#=GS B0ZSY1_9REOV/4-170      AC B0ZSY1.1
#=GS K4I4U7_9REOV/1-173      AC K4I4U7.1
#=GS L0CSA0_9REOV/1-167      AC L0CSA0.1
#=GS X5BZZ2_9REOV/1-173      AC X5BZZ2.1
#=GS S5IKK5_9REOV/8-180      AC S5IKK5.1
#=GS Q9WAJ5_9REOV/1-173      AC Q9WAJ5.1
#=GS Q4G659_9REOV/1-173      AC Q4G659.1
#=GS Q9PYD4_9REOV/1-173      AC Q9PYD4.1
#=GS Q8UZ00_9REOV/1-173      AC Q8UZ00.1
#=GS A4L5S2_9REOV/1-171      AC A4L5S2.1
#=GS G5CPJ9_9REOV/1-173      AC G5CPJ9.1
#=GS Q1G1U3_9REOV/1-170      AC Q1G1U3.1
#=GS B5AU00_9REOV/1-173      AC B5AU00.1
#=GS H8ZHZ9_9REOV/1-173      AC H8ZHZ9.1
#=GS H9MZK8_9REOV/1-170      AC H9MZK8.1
#=GS G9DDQ2_9REOV/1-165      AC G9DDQ2.1
#=GS Q9WN93_9REOV/1-173      AC Q9WN93.1
#=GS G3FJ67_9REOV/1-159      AC G3FJ67.1
#=GS NSP4_ROTAM/1-173        AC O92374.1
#=GS D2KQT8_9REOV/1-173      AC D2KQT8.1
#=GS I2CNG1_9REOV/1-173      AC I2CNG1.1
#=GS H9MZL0_9REOV/1-170      AC H9MZL0.1
#=GS Q06DN4_9REOV/1-173      AC Q06DN4.1
#=GS F5B530_9REOV/8-180      AC F5B530.1
#=GS F6MF72_9REOV/1-173      AC F6MF72.1
#=GS M4I1Y8_9REOV/1-173      AC M4I1Y8.1
#=GS X2FPJ5_9REOV/1-173      AC X2FPJ5.1
#=GS X5D183_9REOV/1-173      AC X5D183.1
#=GS G4WMK4_9REOV/1-173      AC G4WMK4.1
#=GS B7UFA5_9REOV/15-187     AC B7UFA5.1
#=GS S5RE12_9REOV/1-173      AC S5RE12.1
#=GS S5R541_9REOV/1-90       AC S5R541.1
#=GS B8Y8B8_9REOV/1-173      AC B8Y8B8.1
#=GS D0UD33_9REOV/1-173      AC D0UD33.1
#=GS C7EWT5_9REOV/1-167      AC C7EWT5.1
#=GS Q9IVG2_9REOV/1-134      AC Q9IVG2.1
#=GS S5K814_9REOV/1-173      AC S5K814.1
#=GS R4X5P4_9REOV/1-166      AC R4X5P4.1
#=GS X2FTF9_9REOV/1-173      AC X2FTF9.1
#=GS Q1G1V1_9REOV/1-170      AC Q1G1V1.1
#=GS Q4G647_9REOV/1-173      AC Q4G647.1
#=GS X5BXU1_9REOV/1-173      AC X5BXU1.1
#=GS F1JZU3_9REOV/2-167      AC F1JZU3.1
#=GS B6SAP9_9REOV/1-173      AC B6SAP9.1
#=GS C1K3K9_9REOV/1-167      AC C1K3K9.1
#=GS V5LF48_9REOV/1-173      AC V5LF48.1
#=GS H9MZN6_9REOV/1-170      AC H9MZN6.1
#=GS E7CBI3_9REOV/1-171      AC E7CBI3.1
#=GS C3U217_9REOV/14-186     AC C3U217.1
#=GS S5RE66_9REOV/2-174      AC S5RE66.1
#=GS G5CPK1_9REOV/1-173      AC G5CPK1.1
#=GS F5C5I5_9REOV/1-173      AC F5C5I5.1
#=GS U3LZX3_9REOV/1-173      AC U3LZX3.1
#=GS U5S8Z9_9REOV/11-183     AC U5S8Z9.1
#=GS U5XLZ0_9REOV/2-164      AC U5XLZ0.1
#=GS H6SWU3_9REOV/2-174      AC H6SWU3.1
#=GS G3FJ66_9REOV/1-159      AC G3FJ66.1
#=GS H9MZM5_9REOV/1-170      AC H9MZM5.1
#=GS Q9PYD5_9REOV/1-173      AC Q9PYD5.1
#=GS V5YW58_9REOV/1-170      AC V5YW58.1
#=GS G3FJ64_9REOV/1-159      AC G3FJ64.1
#=GS Q3LRN7_9REOV/1-170      AC Q3LRN7.1
#=GS F5C724_9REOV/1-173      AC F5C724.1
#=GS M1H3L8_9REOV/1-173      AC M1H3L8.1
#=GS E9KPE2_9REOV/1-173      AC E9KPE2.1
#=GS V9VK10_9REOV/10-182     AC V9VK10.1
#=GS S5S2S0_9REOV/1-173      AC S5S2S0.1
#=GS E7CBJ3_9REOV/1-172      AC E7CBJ3.1
#=GS E2J2G8_9REOV/1-173      AC E2J2G8.1
#=GS F5C4P7_9REOV/1-173      AC F5C4P7.1
#=GS C7EWR7_9REOV/1-166      AC C7EWR7.1
#=GS Q9E165_9REOV/1-173      AC Q9E165.1
#=GS H9MZP4_9REOV/1-170      AC H9MZP4.1
#=GS F5AY54_9REOV/8-180      AC F5AY54.1
#=GS A9ZP32_9REOV/1-173      AC A9ZP32.1
#=GS A0A024CET7_9REOV/1-173  AC A0A024CET7.1
#=GS Q9DSG5_9REOV/1-173      AC Q9DSG5.1
#=GS B8XQX1_9REOV/1-173      AC B8XQX1.1
#=GS E0YLI8_9REOV/1-173      AC E0YLI8.1
#=GS H9MZN3_9REOV/1-170      AC H9MZN3.1
#=GS A8HI53_9REOV/1-109      AC A8HI53.1
#=GS B2Z9T1_9REOV/1-126      AC B2Z9T1.1
#=GS A8HI54_9REOV/1-161      AC A8HI54.1
#=GS A5X363_9REOV/1-173      AC A5X363.1
#=GS G9DDP8_9REOV/1-165      AC G9DDP8.1
#=GS C7SYE9_9REOV/1-173      AC C7SYE9.1
#=GS S5S0Q8_9REOV/2-174      AC S5S0Q8.1
#=GS F5C4Y1_9REOV/1-173      AC F5C4Y1.1
#=GS E7CBP1_9REOV/2-174      AC E7CBP1.1
#=GS G3FJ63_9REOV/1-159      AC G3FJ63.1
#=GS A5X361_9REOV/1-173      AC A5X361.1
#=GS D7F7N3_9REOV/1-173      AC D7F7N3.1
#=GS H9MZP0_9REOV/1-170      AC H9MZP0.1
#=GS F5B545_9REOV/8-180      AC F5B545.1
#=GS F6LP39_9REOV/1-173      AC F6LP39.1
#=GS E7CBH3_9REOV/1-173      AC E7CBH3.1
#=GS A5HV78_9REOV/1-173      AC A5HV78.1
#=GS C5IXN9_9REOV/1-173      AC C5IXN9.1
#=GS A5X362_9REOV/1-173      AC A5X362.1
#=GS F5C5R8_9REOV/1-173      AC F5C5R8.1
#=GS Q1WEV2_ROTHU/1-95       AC Q1WEV2.1
#=GS B7SY75_9REOV/1-173      AC B7SY75.1
#=GS K9ZS46_9REOV/1-169      AC K9ZS46.1
#=GS E0YLJ4_9REOV/1-173      AC E0YLJ4.1
#=GS C7EWU2_9REOV/2-164      AC C7EWU2.1
#=GS NSP4_ROTHS/1-173        AC Q82029.1
#=GS B7ZGW2_9REOV/1-155      AC B7ZGW2.1
#=GS D3JPT5_9REOV/1-145      AC D3JPT5.1
#=GS Q4G623_9REOV/1-173      AC Q4G623.1
#=GS Q9YKF9_9REOV/1-173      AC Q9YKF9.1
#=GS Q2XPN7_9REOV/1-173      AC Q2XPN7.1
#=GS J9QFX2_9REOV/1-173      AC J9QFX2.1
#=GS F5C6A8_9REOV/1-173      AC F5C6A8.1
#=GS Q4G656_9REOV/1-173      AC Q4G656.1
#=GS Q4G632_9REOV/1-173      AC Q4G632.1
#=GS Q86224_9REOV/1-173      AC Q86224.1
#=GS C1K3K8_9REOV/1-166      AC C1K3K8.1
#=GS J9QFX3_9REOV/1-173      AC J9QFX3.1
#=GS E7CBL8_9REOV/1-173      AC E7CBL8.1
#=GS Q9YJC5_9REOV/1-173      AC Q9YJC5.1
#=GS S4U7T2_9REOV/1-173      AC S4U7T2.1
#=GS F5C5N3_9REOV/1-173      AC F5C5N3.1
#=GS B0ZSY6_9REOV/5-171      AC B0ZSY6.1
#=GS NSP4_ROTAD/1-173        AC Q9YJN7.1
#=GS Q1WEH9_ROTHU/1-105      AC Q1WEH9.1
#=GS Q2VC38_9REOV/1-171      AC Q2VC38.1
#=GS M1KDE1_9REOV/1-173      AC M1KDE1.1
#=GS Q4G615_9REOV/1-173      AC Q4G615.1
#=GS Q9DSG9_9REOV/1-173      AC Q9DSG9.1
#=GS F5C642_9REOV/1-173      AC F5C642.1
#=GS F5B2E9_9REOV/8-180      AC F5B2E9.1
#=GS M1HD14_9REOV/1-173      AC M1HD14.1
#=GS G9DDQ1_9REOV/1-165      AC G9DDQ1.1
#=GS Q9WAJ0_9REOV/1-173      AC Q9WAJ0.1
#=GS D3HU64_9REOV/1-173      AC D3HU64.1
#=GS V9VH02_9REOV/10-182     AC V9VH02.1
#=GS P87711_9REOV/1-162      AC P87711.1
#=GS Q1G1T2_9REOV/1-170      AC Q1G1T2.1
#=GS Q4G622_9REOV/1-173      AC Q4G622.1
#=GS X2FTK8_9REOV/1-173      AC X2FTK8.1
#=GS C7EWT6_9REOV/1-166      AC C7EWT6.1
#=GS C4PBK6_9REOV/1-173      AC C4PBK6.1
#=GS D1GHC0_9REOV/1-173      AC D1GHC0.1
#=GS D1GGR6_9REOV/1-173      AC D1GGR6.1
#=GS A9ZQ64_9REOV/1-173      AC A9ZQ64.1
#=GS F5C4W7_9REOV/1-173      AC F5C4W7.1
#=GS Q9PYB1_9REOV/1-173      AC Q9PYB1.1
#=GS J9SQG1_9REOV/1-173      AC J9SQG1.1
#=GS A4ZD83_9REOV/1-173      AC A4ZD83.1
#=GS F4YUX9_9REOV/1-156      AC F4YUX9.1
#=GS E7CBG6_9REOV/1-172      AC E7CBG6.1
#=GS Q2VC35_9REOV/1-173      AC Q2VC35.1
#=GS A0A023NBL9_9REOV/1-173  AC A0A023NBL9.1
#=GS Q599S3_9REOV/1-170      AC Q599S3.1
#=GS E7ECS7_9REOV/8-180      AC E7ECS7.1
#=GS E7CBG5_9REOV/1-171      AC E7CBG5.1
#=GS E0YLH9_9REOV/1-173      AC E0YLH9.1
#=GS G1FVM4_9REOV/1-173      AC G1FVM4.1
#=GS A0A024CFM1_9REOV/1-173  AC A0A024CFM1.1
#=GS J9VAC1_9REOV/1-173      AC J9VAC1.1
#=GS L7NUH2_9REOV/1-173      AC L7NUH2.1
#=GS E7ECR3_9REOV/8-180      AC E7ECR3.1
#=GS NSP4_ROTH5/1-173        AC Q82028.1
#=GS I3RPU6_9REOV/1-173      AC I3RPU6.1
#=GS Q4G633_9REOV/1-173      AC Q4G633.1
#=GS A0A023NBM3_9REOV/1-173  AC A0A023NBM3.1
#=GS C7EWS3_9REOV/1-167      AC C7EWS3.1
#=GS NSP4_ROTME/1-173        AC O11982.1
#=GS H9MZM0_9REOV/1-170      AC H9MZM0.1
#=GS H2DF33_9REOV/1-173      AC H2DF33.1
#=GS M1PCZ1_9REOV/1-173      AC M1PCZ1.1
#=GS NSP4_ROT41/1-173        AC Q3ZK64.1
#=GS Q4G5Z9_9REOV/1-173      AC Q4G5Z9.1
#=GS D1GHI0_9REOV/1-173      AC D1GHI0.1
#=GS U5XJA3_9REOV/2-164      AC U5XJA3.1
#=GS C7EWR4_9REOV/1-167      AC C7EWR4.1
#=GS Q4G630_9REOV/1-173      AC Q4G630.1
#=GS M5AFE5_9REOV/1-173      AC M5AFE5.1
#=GS A4L5S0_9REOV/1-145      AC A4L5S0.1
#=GS A9ZP38_9REOV/1-173      AC A9ZP38.1
#=GS D0UD27_9REOV/1-173      AC D0UD27.1
#=GS B2CQC0_9REOV/1-173      AC B2CQC0.1
#=GS D5HMU9_9REOV/1-173      AC D5HMU9.1
#=GS B2CQB7_9REOV/1-173      AC B2CQB7.1
#=GS R4I3K7_9REOV/1-173      AC R4I3K7.1
#=GS Q2VC43_9REOV/1-169      AC Q2VC43.1
#=GS C7EWS6_9REOV/1-166      AC C7EWS6.1
#=GS E7CBG9_9REOV/1-134      AC E7CBG9.1
#=GS B2BMD9_9REOV/1-173      AC B2BMD9.1
#=GS A9ZQ52_9REOV/1-173      AC A9ZQ52.1
#=GS Q4G606_9REOV/1-173      AC Q4G606.1
#=GS F5C614_9REOV/1-173      AC F5C614.1
#=GS D5J9X2_9REOV/1-173      AC D5J9X2.1
#=GS Q4G657_9REOV/1-173      AC Q4G657.1
#=GS K4I2L1_9REOV/1-173      AC K4I2L1.1
#=GS C1K3H8_9REOV/1-167      AC C1K3H8.1
#=GS Q2VC31_9REOV/1-168      AC Q2VC31.1
#=GS I1SST2_9REOV/1-151      AC I1SST2.1
#=GS U3M0M7_9REOV/1-173      AC U3M0M7.1
#=GS D1GGI2_9REOV/1-173      AC D1GGI2.1
#=GS F6MF83_9REOV/1-173      AC F6MF83.1
#=GS A8C4Z0_9REOV/1-167      AC A8C4Z0.1
#=GS V5QQG6_9REOV/1-173      AC V5QQG6.1
#=GS M1KJA0_9REOV/1-173      AC M1KJA0.1
#=GS F5C4I7_9REOV/1-173      AC F5C4I7.1
#=GS Q9PYD9_9REOV/1-173      AC Q9PYD9.1
#=GS V5LFG4_9REOV/1-173      AC V5LFG4.1
#=GS E2J394_9REOV/1-173      AC E2J394.1
#=GS Q4G605_9REOV/1-173      AC Q4G605.1
#=GS C0JLT9_9REOV/1-173      AC C0JLT9.1
#=GS A2T3P6_9REOV/1-173      AC A2T3P6.1
#=GS S5JLF4_9REOV/1-173      AC S5JLF4.1
#=GS C1K3I6_9REOV/1-167      AC C1K3I6.1
#=GS B0ZSZ2_9REOV/4-170      AC B0ZSZ2.1
#=GS Q4G655_9REOV/1-173      AC Q4G655.1
#=GS X2FPG2_9REOV/1-173      AC X2FPG2.1
#=GS Q9YJ03_9REOV/1-173      AC Q9YJ03.1
#=GS Q2VC37_9REOV/1-173      AC Q2VC37.1
#=GS M1NY97_9REOV/14-186     AC M1NY97.1
#=GS F5C4D9_9REOV/1-173      AC F5C4D9.1
#=GS C7EWS8_9REOV/1-166      AC C7EWS8.1
#=GS Q99IB0_9REOV/1-173      AC Q99IB0.1
#=GS S5I776_9REOV/8-180      AC S5I776.1
#=GS Q9WAI6_9REOV/1-173      AC Q9WAI6.1
#=GS M4ZUB1_9REOV/1-173      AC M4ZUB1.1
#=GS E7CBG8_9REOV/4-176      AC E7CBG8.1
#=GS E2J2V0_9REOV/1-173      AC E2J2V0.1
#=GS H9MZM3_9REOV/1-170      AC H9MZM3.1
#=GS D7SC46_9REOV/1-170      AC D7SC46.1
#=GS F5C517_9REOV/1-173      AC F5C517.1
#=GS Q4G646_9REOV/1-173      AC Q4G646.1
#=GS Q80DH7_9REOV/1-120      AC Q80DH7.1
#=GS H9MZL7_9REOV/1-170      AC H9MZL7.1
#=GS M1KHA7_9REOV/1-173      AC M1KHA7.1
#=GS D1GHM8_9REOV/1-173      AC D1GHM8.1
#=GS D1GGW4_9REOV/1-173      AC D1GGW4.1
#=GS V5IX10_9REOV/1-173      AC V5IX10.1
#=GS G1DH77_9REOV/1-173      AC G1DH77.1
#=GS F5B544_9REOV/8-180      AC F5B544.1
#=GS D7NN68_9REOV/1-173      AC D7NN68.1
#=GS F8SPX3_9REOV/1-173      AC F8SPX3.1
#=GS D0E2W7_9REOV/1-171      AC D0E2W7.1
#=GS F1JZU4_9REOV/2-167      AC F1JZU4.1
#=GS S5RGF3_9REOV/2-174      AC S5RGF3.1
#=GS Q9QPN0_9REOV/1-173      AC Q9QPN0.1
#=GS X2FP65_9REOV/1-173      AC X2FP65.1
#=GS E7ECS6_9REOV/8-180      AC E7ECS6.1
#=GS E7D6L5_ROTHU/1-173      AC E7D6L5.1
#=GS E0YN00_9REOV/1-173      AC E0YN00.1
#=GS Q4G648_9REOV/1-173      AC Q4G648.1
#=GS W0G3V4_9REOV/1-173      AC W0G3V4.1
#=GS E3W5A0_9REOV/1-173      AC E3W5A0.1
#=GS S5RE29_9REOV/2-174      AC S5RE29.1
#=GS M5AFE8_9REOV/1-173      AC M5AFE8.1
#=GS S5JLF7_9REOV/1-165      AC S5JLF7.1
#=GS Q4G636_9REOV/1-173      AC Q4G636.1
#=GS D4P8E9_9REOV/1-170      AC D4P8E9.1
#=GS G1DH74_9REOV/1-173      AC G1DH74.1
#=GS L0N427_9REOV/1-173      AC L0N427.1
#=GS O92323_9REOV/1-173      AC O92323.1
#=GS O92323_9REOV/1-173      DR PDB; 4WBA C; 95-135;
#=GS O92323_9REOV/1-173      DR PDB; 4WBA A; 95-136;
#=GS O92323_9REOV/1-173      DR PDB; 4WBA E; 95-136;
#=GS O92323_9REOV/1-173      DR PDB; 4WBA B; 95-135;
#=GS O92323_9REOV/1-173      DR PDB; 4WBA D; 95-135;
#=GS O92323_9REOV/1-173      DR PDB; 4WB4 A; 96-136;
#=GS O92323_9REOV/1-173      DR PDB; 4WB4 B; 95-135;
#=GS I1YZL1_ROTHU/1-173      AC I1YZL1.1
#=GS S4S3F9_9REOV/1-173      AC S4S3F9.1
#=GS E7CBK3_9REOV/1-172      AC E7CBK3.1
#=GS E7CBP3_9REOV/1-173      AC E7CBP3.1
#=GS D5HMU6_9REOV/1-173      AC D5HMU6.1
#=GS Q2PZB9_9REOV/1-173      AC Q2PZB9.1
#=GS G9G704_9REOV/1-162      AC G9G704.1
#=GS B7ZGV9_9REOV/1-154      AC B7ZGV9.1
#=GS K4IDQ4_9REOV/1-173      AC K4IDQ4.1
#=GS A5X358_9REOV/1-173      AC A5X358.1
#=GS D3JTU1_9REOV/14-186     AC D3JTU1.1
#=GS M1H8C5_9REOV/1-173      AC M1H8C5.1
#=GS D1GG03_9REOV/1-173      AC D1GG03.1
#=GS A3DSI1_9REOV/1-173      AC A3DSI1.1
#=GS B2Z9U6_9REOV/1-127      AC B2Z9U6.1
#=GS D7SC42_9REOV/1-170      AC D7SC42.1
#=GS B0ZSY8_9REOV/4-170      AC B0ZSY8.1
#=GS A9ZQ49_9REOV/7-160      AC A9ZQ49.1
#=GS F5C6S7_9REOV/1-173      AC F5C6S7.1
#=GS A9ZP25_9REOV/1-173      AC A9ZP25.1
#=GS Q9PYD7_9REOV/1-173      AC Q9PYD7.1
#=GS D1GG27_9REOV/1-173      AC D1GG27.1
#=GS Q98VN3_9REOV/1-173      AC Q98VN3.1
#=GS Q4G642_9REOV/1-173      AC Q4G642.1
#=GS F5C4M3_9REOV/1-173      AC F5C4M3.1
#=GS D1GH72_9REOV/1-173      AC D1GH72.1
#=GS Q1G1T6_9REOV/1-170      AC Q1G1T6.1
#=GS C7EWR3_9REOV/1-167      AC C7EWR3.1
#=GS H9MZL6_9REOV/1-170      AC H9MZL6.1
#=GS C9WLT2_9REOV/1-158      AC C9WLT2.1
#=GS B7TAF1_9REOV/1-173      AC B7TAF1.1
#=GS E7CBN9_9REOV/1-173      AC E7CBN9.1
#=GS Q9WAA5_9REOV/1-173      AC Q9WAA5.1
#=GS F5B546_9REOV/8-180      AC F5B546.1
#=GS B7ZGV7_9REOV/1-154      AC B7ZGV7.1
#=GS E5FPY2_9REOV/1-173      AC E5FPY2.1
#=GS H6VLI3_9REOV/1-173      AC H6VLI3.1
#=GS F5C4L1_9REOV/1-173      AC F5C4L1.1
#=GS I0B177_9REOV/1-173      AC I0B177.1
#=GS F5B3L6_9REOV/8-180      AC F5B3L6.1
#=GS C7EWR2_9REOV/1-167      AC C7EWR2.1
#=GS H9N192_9REOV/1-173      AC H9N192.1
#=GS E2J2T8_9REOV/1-173      AC E2J2T8.1
#=GS D3JTU2_9REOV/14-186     AC D3JTU2.1
#=GS J9QLB5_9REOV/1-173      AC J9QLB5.1
#=GS M9Q2S4_ROTHU/1-173      AC M9Q2S4.1
#=GS Q6GWF6_9REOV/1-173      AC Q6GWF6.1
#=GS E7CBF8_9REOV/1-170      AC E7CBF8.1
#=GS B6E4V9_9REOV/1-173      AC B6E4V9.1
#=GS C0JLW1_9REOV/1-173      AC C0JLW1.1
#=GS Q9IV22_9REOV/1-173      AC Q9IV22.1
#=GS Q9WAJ3_9REOV/1-173      AC Q9WAJ3.1
#=GS NSP4_ROTPY/1-173        AC Q06381.1
#=GS H9MZP2_9REOV/1-170      AC H9MZP2.1
#=GS M1KAU9_9REOV/1-173      AC M1KAU9.1
#=GS F5C4V7_9REOV/1-173      AC F5C4V7.1
#=GS H6VLH2_9REOV/1-173      AC H6VLH2.1
#=GS C7EWS9_9REOV/1-166      AC C7EWS9.1
#=GS Q1G1U5_9REOV/1-170      AC Q1G1U5.1
#=GS F5C4T3_9REOV/1-173      AC F5C4T3.1
#=GS F5C6E6_9REOV/1-173      AC F5C6E6.1
#=GS D5HMV0_9REOV/1-173      AC D5HMV0.1
#=GS Q808S7_9REOV/1-137      AC Q808S7.1
#=GS E7CBG3_9REOV/1-171      AC E7CBG3.1
#=GS E9KPE1_9REOV/1-172      AC E9KPE1.1
#=GS Q4G5Z8_9REOV/1-173      AC Q4G5Z8.1
#=GS E3W4Z2_9REOV/1-173      AC E3W4Z2.1
#=GS D7SC43_9REOV/1-170      AC D7SC43.1
#=GS F4YUY7_9REOV/1-172      AC F4YUY7.1
#=GS G4WMH1_9REOV/1-173      AC G4WMH1.1
#=GS E7CBJ7_9REOV/1-173      AC E7CBJ7.1
#=GS A9ZP33_9REOV/1-173      AC A9ZP33.1
#=GS C1K3J9_9REOV/1-167      AC C1K3J9.1
#=GS Q9QGR6_9REOV/1-173      AC Q9QGR6.1
#=GS E3W405_9REOV/1-173      AC E3W405.1
#=GS A0A024CFV6_9REOV/1-173  AC A0A024CFV6.1
#=GS D2D988_9REOV/1-173      AC D2D988.1
#=GS P87719_9REOV/1-162      AC P87719.1
#=GS A0A024CG14_9REOV/1-173  AC A0A024CG14.1
#=GS A0A023UIG9_9REOV/1-139  AC A0A023UIG9.1
#=GS C7EWS0_9REOV/1-166      AC C7EWS0.1
#=GS I3RPT4_9REOV/1-173      AC I3RPT4.1
#=GS S5RGI7_9REOV/2-174      AC S5RGI7.1
#=GS E5L0B9_9REOV/1-173      AC E5L0B9.1
#=GS D1GGF8_9REOV/1-173      AC D1GGF8.1
#=GS Q5KR60_9REOV/1-173      AC Q5KR60.1
#=GS D5G325_9REOV/1-173      AC D5G325.1
#=GS D4P8E8_9REOV/1-169      AC D4P8E8.1
#=GS W0G3U9_9REOV/1-173      AC W0G3U9.1
#=GS A9CQ68_9REOV/1-173      AC A9CQ68.1
#=GS E7CBM2_9REOV/1-171      AC E7CBM2.1
#=GS G0YWE8_9REOV/1-170      AC G0YWE8.1
#=GS B7ZGW6_9REOV/1-155      AC B7ZGW6.1
#=GS NSP4_ROTBB/1-173        AC Q9PYC8.1
#=GS S5S2T6_9REOV/1-173      AC S5S2T6.1
#=GS Q4G602_9REOV/1-173      AC Q4G602.1
#=GS C7EWR0_9REOV/1-167      AC C7EWR0.1
#=GS H9MZM7_9REOV/1-170      AC H9MZM7.1
#=GS NSP4_ROTF6/1-173        AC P89063.1
#=GS D3JPT6_9REOV/1-173      AC D3JPT6.1
#=GS M1PLT5_9REOV/14-186     AC M1PLT5.1
#=GS Q719L4_9REOV/1-173      AC Q719L4.1
#=GS G0YZK8_9REOV/1-173      AC G0YZK8.1
#=GS K4I0B1_9REOV/1-173      AC K4I0B1.1
#=GS D1GH84_9REOV/1-173      AC D1GH84.1
#=GS T1RQF3_9REOV/1-166      AC T1RQF3.1
#=GS I1E4B1_9REOV/1-173      AC I1E4B1.1
#=GS Q2PGE4_9REOV/1-173      AC Q2PGE4.1
#=GS D1GG99_9REOV/1-173      AC D1GG99.1
#=GS D1GH12_9REOV/1-173      AC D1GH12.1
#=GS M1HD12_9REOV/1-173      AC M1HD12.1
#=GS Q77P43_9REOV/1-173      AC Q77P43.1
#=GS K9L5A9_9REOV/1-173      AC K9L5A9.1
#=GS E7ECT0_9REOV/8-180      AC E7ECT0.1
#=GS D1GGP2_9REOV/1-173      AC D1GGP2.1
#=GS Q9IVG0_9REOV/1-134      AC Q9IVG0.1
#=GS B8Y640_9REOV/1-101      AC B8Y640.1
#=GS Q0PCH1_9REOV/1-173      AC Q0PCH1.1
#=GS B2Z9U1_9REOV/1-127      AC B2Z9U1.1
#=GS Q4G651_9REOV/1-173      AC Q4G651.1
#=GS G9DDQ0_9REOV/1-165      AC G9DDQ0.1
#=GS D1GGB1_9REOV/1-173      AC D1GGB1.1
#=GS E7CBN3_9REOV/1-170      AC E7CBN3.1
#=GS Q9PX23_9REOV/1-173      AC Q9PX23.1
#=GS R4I3L4_9REOV/1-173      AC R4I3L4.1
#=GS Q1G1U2_9REOV/1-170      AC Q1G1U2.1
#=GS A0A023UGL4_9REOV/1-139  AC A0A023UGL4.1
#=GS A0SXM4_9REOV/1-173      AC A0SXM4.1
#=GS E7ECR0_9REOV/8-180      AC E7ECR0.1
#=GS F5B3L8_9REOV/8-180      AC F5B3L8.1
#=GS H9MZL1_9REOV/1-170      AC H9MZL1.1
#=GS E0YLJ3_9REOV/1-173      AC E0YLJ3.1
#=GS Q3LRN5_9REOV/1-173      AC Q3LRN5.1
#=GS C7EWU1_9REOV/1-166      AC C7EWU1.1
#=GS C7EWS4_9REOV/1-167      AC C7EWS4.1
#=GS A3EZQ9_9REOV/1-167      AC A3EZQ9.1
#=GS S5I773_9REOV/7-179      AC S5I773.1
#=GS V5IX03_9REOV/1-173      AC V5IX03.1
#=GS F5C5D7_9REOV/1-173      AC F5C5D7.1
#=GS X4YPG6_9REOV/1-173      AC X4YPG6.1
#=GS B0ZSY2_9REOV/4-170      AC B0ZSY2.1
#=GS A7VJD6_9REOV/1-173      AC A7VJD6.1
#=GS F5C6C1_9REOV/1-173      AC F5C6C1.1
#=GS A3DSF9_9REOV/1-173      AC A3DSF9.1
#=GS W0G0H1_9REOV/1-173      AC W0G0H1.1
#=GS L7Z3B6_9REOV/1-173      AC L7Z3B6.1
#=GS NSP4_ROTH2/1-173        AC P30030.1
#=GS E7ECT9_9REOV/6-180      AC E7ECT9.1
#=GS K7QGX9_9REOV/1-173      AC K7QGX9.1
#=GS L8AXT4_9REOV/1-173      AC L8AXT4.1
#=GS J7GXY2_9REOV/14-186     AC J7GXY2.1
#=GS Q2PGE6_9REOV/1-173      AC Q2PGE6.1
#=GS A9ZP42_9REOV/1-173      AC A9ZP42.1
#=GS X4YPA5_9REOV/1-173      AC X4YPA5.1
#=GS C7EWS1_9REOV/1-167      AC C7EWS1.1
#=GS I3RPU3_9REOV/1-173      AC I3RPU3.1
#=GS M1NQP5_9REOV/1-132      AC M1NQP5.1
#=GS T2CE70_9REOV/1-173      AC T2CE70.1
#=GS A0A024CDB7_9REOV/1-173  AC A0A024CDB7.1
#=GS Q9DSH0_9REOV/1-173      AC Q9DSH0.1
#=GS H9MZL3_9REOV/1-170      AC H9MZL3.1
#=GS B2Z9V8_9REOV/1-127      AC B2Z9V8.1
#=GS L8AX65_9REOV/1-173      AC L8AX65.1
#=GS F5C6D4_9REOV/1-173      AC F5C6D4.1
#=GS E7CBJ1_9REOV/1-171      AC E7CBJ1.1
#=GS E2J3B8_9REOV/1-173      AC E2J3B8.1
#=GS H6B4F2_9REOV/1-173      AC H6B4F2.1
#=GS I6ZLQ9_9REOV/1-157      AC I6ZLQ9.1
#=GS D3G8F2_9REOV/1-173      AC D3G8F2.1
#=GS I6Z1B8_9REOV/1-157      AC I6Z1B8.1
#=GS G1FW91_9REOV/1-173      AC G1FW91.1
#=GS F5B3L7_9REOV/8-180      AC F5B3L7.1
#=GS F5C648_9REOV/1-173      AC F5C648.1
#=GS M1PE32_9REOV/1-144      AC M1PE32.1
#=GS B2Z9V2_9REOV/1-127      AC B2Z9V2.1
#=GS Q82032_9REOV/1-173      AC Q82032.1
#=GS Q06DN3_9REOV/1-173      AC Q06DN3.1
#=GS W8Q983_9REOV/1-173      AC W8Q983.1
#=GS F5C771_9REOV/1-173      AC F5C771.1
#=GS M9V587_9REOV/1-173      AC M9V587.1
#=GS E7CF33_9REOV/1-173      AC E7CF33.1
#=GS W0G546_9REOV/1-173      AC W0G546.1
#=GS B6E4X0_9REOV/1-173      AC B6E4X0.1
#=GS T2CES3_9REOV/1-173      AC T2CES3.1
#=GS NSP4_ROTH7/1-173        AC P30031.1
#=GS C1K3I9_9REOV/1-167      AC C1K3I9.1
#=GS X2FPY2_9REOV/1-173      AC X2FPY2.1
#=GS A9CQ71_9REOV/1-173      AC A9CQ71.1
#=GS D2K889_9REOV/1-173      AC D2K889.1
#=GS X2FUS2_9REOV/1-173      AC X2FUS2.1
#=GS Q5KR59_9REOV/1-173      AC Q5KR59.1
#=GS S5S0W0_9REOV/14-186     AC S5S0W0.1
#=GS U3MGV6_9REOV/9-181      AC U3MGV6.1
#=GS Q4G641_9REOV/1-173      AC Q4G641.1
#=GS NSP4_ROTBU/1-173        AC P04513.2
#=GS G1FW70_9REOV/1-173      AC G1FW70.1
#=GS M1PQJ5_9REOV/1-166      AC M1PQJ5.1
#=GS T1UL23_9REOV/9-181      AC T1UL23.1
#=GS G9DDQ7_9REOV/1-165      AC G9DDQ7.1
#=GS R9T9Z5_9REOV/1-173      AC R9T9Z5.1
#=GS G1DH75_9REOV/1-173      AC G1DH75.1
#=GS F5C734_9REOV/1-173      AC F5C734.1
#=GS Q1G1V2_9REOV/1-170      AC Q1G1V2.1
#=GS U5S8Z1_9REOV/11-183     AC U5S8Z1.1
#=GS S5IKL1_9REOV/1-130      AC S5IKL1.1
#=GS Q1L7K9_9REOV/1-173      AC Q1L7K9.1
#=GS Q9PYC1_9REOV/1-173      AC Q9PYC1.1
#=GS Q9PYC1_9REOV/1-173      DR PDB; 2O1J D; 95-137;
#=GS Q9PYC1_9REOV/1-173      DR PDB; 2O1J B; 95-137;
#=GS Q9PYC1_9REOV/1-173      DR PDB; 2O1J A; 95-138;
#=GS Q9PYC1_9REOV/1-173      DR PDB; 2O1J C; 95-138;
#=GS Q8AYX9_9REOV/1-173      AC Q8AYX9.1
#=GS E0XH86_9REOV/9-181      AC E0XH86.1
#=GS M1H7G0_9REOV/1-173      AC M1H7G0.1
#=GS Q1G1T9_9REOV/1-170      AC Q1G1T9.1
#=GS C1K3H9_9REOV/1-166      AC C1K3H9.1
#=GS C4PBK7_9REOV/1-173      AC C4PBK7.1
#=GS D5G327_9REOV/1-173      AC D5G327.1
#=GS Q2VC32_9REOV/1-173      AC Q2VC32.1
#=GS G3FJ69_9REOV/1-159      AC G3FJ69.1
#=GS M4Q5A0_9REOV/1-173      AC M4Q5A0.1
#=GS Q4G653_9REOV/1-173      AC Q4G653.1
#=GS G8H3U8_9REOV/1-173      AC G8H3U8.1
#=GS S5RLJ6_9REOV/1-173      AC S5RLJ6.1
#=GS Q6QT01_9REOV/1-173      AC Q6QT01.1
#=GS I6ZLR7_9REOV/1-157      AC I6ZLR7.1
#=GS C7EWR6_9REOV/1-167      AC C7EWR6.1
#=GS S5RE05_9REOV/2-174      AC S5RE05.1
#=GS G9DDQ9_9REOV/1-165      AC G9DDQ9.1
#=GS D7SC39_9REOV/1-170      AC D7SC39.1
#=GS V9VK12_9REOV/10-182     AC V9VK12.1
#=GS Q19A90_9REOV/1-173      AC Q19A90.1
#=GS E7CBI0_9REOV/1-173      AC E7CBI0.1
#=GS A9ZP35_9REOV/1-173      AC A9ZP35.1
#=GS A9CQ81_9REOV/1-158      AC A9CQ81.1
#=GS G9DDQ4_9REOV/1-165      AC G9DDQ4.1
#=GS I2CN77_9REOV/1-173      AC I2CN77.1
#=GS Q1G1U4_9REOV/1-170      AC Q1G1U4.1
#=GS Q8B4J1_9REOV/1-173      AC Q8B4J1.1
#=GS S5S2S3_9REOV/1-173      AC S5S2S3.1
#=GS X4YLH5_9REOV/1-173      AC X4YLH5.1
#=GS K9LHJ8_9REOV/1-173      AC K9LHJ8.1
#=GS F5C5C5_9REOV/1-173      AC F5C5C5.1
#=GS Q9WAJ8_9REOV/1-173      AC Q9WAJ8.1
#=GS D1GGQ4_9REOV/1-173      AC D1GGQ4.1
#=GS Q9W8B5_9REOV/1-173      AC Q9W8B5.1
#=GS Q9DSG8_9REOV/1-173      AC Q9DSG8.1
#=GS E2J2L6_9REOV/1-173      AC E2J2L6.1
#=GS Q9YKF8_9REOV/1-173      AC Q9YKF8.1
#=GS I6ZV05_9REOV/1-115      AC I6ZV05.1
#=GS S5S0U5_9REOV/1-173      AC S5S0U5.1
#=GS D1GHG8_9REOV/1-173      AC D1GHG8.1
#=GS X2FR49_9REOV/1-173      AC X2FR49.1
#=GS Q9YKF5_9REOV/1-173      AC Q9YKF5.1
#=GS E0XH89_9REOV/1-167      AC E0XH89.1
#=GS H9MZP9_9REOV/1-170      AC H9MZP9.1
#=GS A5X360_9REOV/1-173      AC A5X360.1
#=GS S5RMT5_9REOV/1-124      AC S5RMT5.1
#=GS K4IDQ2_9REOV/1-173      AC K4IDQ2.1
#=GS NSP4_ROTHL/1-173        AC Q91E93.1
#=GS E7CBM7_9REOV/1-172      AC E7CBM7.1
#=GS E7CF42_9REOV/1-173      AC E7CF42.1
#=GS M4VRW1_9REOV/1-168      AC M4VRW1.1
#=GS NSP4_ROTW3/1-173        AC Q8JNB2.1
#=GS X2FPN5_9REOV/1-173      AC X2FPN5.1
#=GS T1RQ47_9REOV/1-166      AC T1RQ47.1
#=GS F6JTH8_9REOV/1-173      AC F6JTH8.1
#=GS Q71MF0_9REOV/1-173      AC Q71MF0.1
#=GS D1GGX6_9REOV/1-173      AC D1GGX6.1
#=GS G0YY27_9REOV/1-173      AC G0YY27.1
#=GS Q4G628_9REOV/1-173      AC Q4G628.1
#=GS A9ZP30_9REOV/1-173      AC A9ZP30.1
#=GS B7ZGV5_9REOV/1-154      AC B7ZGV5.1
#=GS H9MZM9_9REOV/1-170      AC H9MZM9.1
#=GS E7ECT3_9REOV/8-180      AC E7ECT3.1
#=GS I2CNB4_9REOV/1-173      AC I2CNB4.1
#=GS Q98VJ5_9REOV/1-173      AC Q98VJ5.1
#=GS Q8B4J3_9REOV/1-173      AC Q8B4J3.1
#=GS X4XXA8_9REOV/1-173      AC X4XXA8.1
#=GS A0A024CE09_9REOV/1-173  AC A0A024CE09.1
#=GS B2BMF0_9REOV/1-173      AC B2BMF0.1
#=GS C4MQ11_ROTHU/1-173      AC C4MQ11.1
#=GS A9ZQ57_9REOV/1-173      AC A9ZQ57.1
#=GS C1K3I8_9REOV/1-167      AC C1K3I8.1
#=GS Q9WAJ2_9REOV/1-173      AC Q9WAJ2.1
#=GS Q80AQ0_9REOV/1-173      AC Q80AQ0.1
#=GS R4I379_9REOV/1-173      AC R4I379.1
#=GS A0A024CDK6_9REOV/1-173  AC A0A024CDK6.1
#=GS NSP4_ROTSH/1-173        AC A2T3Q0.1
#=GS S5S2N6_9REOV/1-173      AC S5S2N6.1
#=GS C3U215_9REOV/14-186     AC C3U215.1
#=GS E7ECS2_9REOV/8-180      AC E7ECS2.1
#=GS I0B176_9REOV/1-170      AC I0B176.1
#=GS D5HMU4_9REOV/1-173      AC D5HMU4.1
#=GS L0L0Y2_9REOV/1-173      AC L0L0Y2.1
#=GS A5HAV0_9REOV/1-158      AC A5HAV0.1
#=GS E7CBI4_9REOV/1-173      AC E7CBI4.1
#=GS M1GT65_9REOV/1-173      AC M1GT65.1
#=GS Q4G616_9REOV/1-173      AC Q4G616.1
#=GS F5AXY5_9REOV/8-180      AC F5AXY5.1
#=GS M9Q2R8_ROTHU/1-173      AC M9Q2R8.1
#=GS C1K3H3_9REOV/1-167      AC C1K3H3.1
#=GS NSP4_ROTA1/1-167        AC Q8V790.1
#=GS Q8B4J5_9REOV/1-173      AC Q8B4J5.1
#=GS M9Q2Q2_ROTHU/1-173      AC M9Q2Q2.1
#=GS D5J9V6_9REOV/1-137      AC D5J9V6.1
#=GS A0A024CDV4_9REOV/1-173  AC A0A024CDV4.1
#=GS I6ZUZ6_9REOV/1-157      AC I6ZUZ6.1
#=GS I3RPT9_9REOV/1-173      AC I3RPT9.1
#=GS S5S0S4_9REOV/2-174      AC S5S0S4.1
#=GS D1GHD2_9REOV/1-173      AC D1GHD2.1
#=GS F5C5Y9_9REOV/1-173      AC F5C5Y9.1
#=GS F6LP50_9REOV/1-173      AC F6LP50.1
#=GS I6ZYZ3_9REOV/1-132      AC I6ZYZ3.1
#=GS E2J2D2_9REOV/1-173      AC E2J2D2.1
#=GS Q9DSH1_9REOV/1-173      AC Q9DSH1.1
#=GS I6YQX3_9REOV/1-157      AC I6YQX3.1
#=GS E7CBH5_9REOV/1-170      AC E7CBH5.1
#=GS Q98VN4_9REOV/1-173      AC Q98VN4.1
#=GS F1JZU1_9REOV/2-167      AC F1JZU1.1
#=GS X4YNG0_9REOV/1-173      AC X4YNG0.1
#=GS W0G4X6_9REOV/1-173      AC W0G4X6.1
#=GS I2CMM7_9REOV/1-173      AC I2CMM7.1
#=GS A0A024CD73_9REOV/1-173  AC A0A024CD73.1
#=GS D9D7M1_9REOV/1-173      AC D9D7M1.1
#=GS M1KHT9_9REOV/1-173      AC M1KHT9.1
#=GS B8Y638_9REOV/1-101      AC B8Y638.1
#=GS E7CBI5_9REOV/1-170      AC E7CBI5.1
#=GS B2ZPL1_9REOV/1-173      AC B2ZPL1.1
#=GS A4ZD73_9REOV/1-173      AC A4ZD73.1
#=GS G0YWE6_9REOV/1-166      AC G0YWE6.1
#=GS E7CBF0_9REOV/1-171      AC E7CBF0.1
#=GS F5C5P4_9REOV/1-173      AC F5C5P4.1
#=GS E5E7S3_9REOV/1-173      AC E5E7S3.1
#=GS E7CBF3_9REOV/1-170      AC E7CBF3.1
#=GS Q9DSG4_9REOV/1-173      AC Q9DSG4.1
#=GS A0A024CEA0_9REOV/1-173  AC A0A024CEA0.1
#=GS E7CBL4_9REOV/1-171      AC E7CBL4.1
#=GS H9MZQ2_9REOV/1-170      AC H9MZQ2.1
#=GS U3M0G2_9REOV/1-173      AC U3M0G2.1
#=GS C1K3H2_9REOV/1-167      AC C1K3H2.1
#=GS B2Z9W0_9REOV/1-127      AC B2Z9W0.1
#=GS M4I1I2_9REOV/1-173      AC M4I1I2.1
#=GS A0A024CGE6_9REOV/1-173  AC A0A024CGE6.1
#=GS U5XJC7_9REOV/2-164      AC U5XJC7.1
#=GS B0LWB5_9REOV/3-175      AC B0LWB5.1
#=GS Q4G612_9REOV/1-173      AC Q4G612.1
#=GS F8UF72_9REOV/1-173      AC F8UF72.1
#=GS Q9WAI5_9REOV/1-173      AC Q9WAI5.1
#=GS A9CQ78_9REOV/1-173      AC A9CQ78.1
#=GS H2DF31_9REOV/1-173      AC H2DF31.1
#=GS Q2N3R9_9REOV/1-173      AC Q2N3R9.1
#=GS D1GG51_9REOV/1-173      AC D1GG51.1
#=GS NSP4_ROT18/1-173        AC Q6QT02.1
#=GS Q9WAJ9_9REOV/1-173      AC Q9WAJ9.1
#=GS A5X365_9REOV/1-173      AC A5X365.1
#=GS G9DDQ8_9REOV/1-165      AC G9DDQ8.1
#=GS E3W441_9REOV/1-173      AC E3W441.1
#=GS E2J2Q2_9REOV/1-173      AC E2J2Q2.1
#=GS F5B2E8_9REOV/8-180      AC F5B2E8.1
#=GS P87720_9REOV/1-162      AC P87720.1
#=GS M1PYH0_9REOV/14-186     AC M1PYH0.1
#=GS D1GHQ2_9REOV/1-173      AC D1GHQ2.1
#=GS F5C674_9REOV/1-173      AC F5C674.1
#=GS E3W4M0_9REOV/1-173      AC E3W4M0.1
#=GS V9VHT5_9REOV/10-182     AC V9VHT5.1
#=GS C7EWT4_9REOV/1-166      AC C7EWT4.1
#=GS Q4G664_9REOV/1-173      AC Q4G664.1
#=GS E3W580_9REOV/1-173      AC E3W580.1
#=GS Q9DSH2_9REOV/1-173      AC Q9DSH2.1
#=GS F5C4B5_9REOV/1-173      AC F5C4B5.1
#=GS F5B2F0_9REOV/8-180      AC F5B2F0.1
#=GS D0UD06_9REOV/1-173      AC D0UD06.1
#=GS Q1WEV3_ROTHU/1-173      AC Q1WEV3.1
#=GS I6Z1C1_9REOV/1-136      AC I6Z1C1.1
#=GS C7EWS2_9REOV/1-167      AC C7EWS2.1
#=GS F5C6K5_9REOV/1-173      AC F5C6K5.1
#=GS E7CBN2_9REOV/1-147      AC E7CBN2.1
#=GS E7ECT1_9REOV/8-180      AC E7ECT1.1
#=GS B0ZSY0_9REOV/1-167      AC B0ZSY0.1
#=GS E7CBN7_9REOV/1-150      AC E7CBN7.1
#=GS Q1G1T8_9REOV/1-170      AC Q1G1T8.1
#=GS F4YUY6_9REOV/1-156      AC F4YUY6.1
#=GS G3FJ71_9REOV/1-159      AC G3FJ71.1
#=GS X2FWQ0_9REOV/1-173      AC X2FWQ0.1
#=GS Q2VC30_9REOV/1-168      AC Q2VC30.1
#=GS B2WWU9_9REOV/1-173      AC B2WWU9.1
#=GS T2DPM5_9REOV/1-173      AC T2DPM5.1
#=GS Q9WAJ6_9REOV/1-173      AC Q9WAJ6.1
#=GS NSP4_ROTHP/1-173        AC B3SRV6.1
#=GS E9NIB4_9REOV/1-173      AC E9NIB4.1
#=GS G3FJ62_9REOV/1-159      AC G3FJ62.1
#=GS E2J272_ROTHU/1-173      AC E2J272.1
#=GS E7CBL5_9REOV/1-170      AC E7CBL5.1
#=GS A0A024CFE4_9REOV/1-173  AC A0A024CFE4.1
#=GS S5GGA0_9REOV/1-173      AC S5GGA0.1
#=GS M1PZ10_9REOV/1-173      AC M1PZ10.1
#=GS V5M0F0_9REOV/1-173      AC V5M0F0.1
#=GS Q2N3S3_9REOV/1-173      AC Q2N3S3.1
#=GS A9ZP29_9REOV/1-173      AC A9ZP29.1
#=GS Q9PYD3_9REOV/1-173      AC Q9PYD3.1
#=GS D5LG79_9REOV/1-173      AC D5LG79.1
#=GS H9MZM2_9REOV/1-170      AC H9MZM2.1
#=GS G1DH80_9REOV/1-173      AC G1DH80.1
#=GS A0A024CG93_9REOV/1-173  AC A0A024CG93.1
#=GS G5CPK2_9REOV/1-168      AC G5CPK2.1
#=GS C3U214_9REOV/14-186     AC C3U214.1
#=GS Q6QT00_9REOV/1-173      AC Q6QT00.1
#=GS F5CRH9_9REOV/1-173      AC F5CRH9.1
#=GS S5S2S7_9REOV/1-173      AC S5S2S7.1
#=GS C7EWT7_9REOV/1-167      AC C7EWT7.1
#=GS E7ECR6_9REOV/8-180      AC E7ECR6.1
#=GS F6MF93_9REOV/1-173      AC F6MF93.1
#=GS S5RLK5_9REOV/14-186     AC S5RLK5.1
#=GS B6E4V7_9REOV/1-173      AC B6E4V7.1
#=GS Q4G608_9REOV/1-173      AC Q4G608.1
#=GS E2J3A6_9REOV/1-173      AC E2J3A6.1
#=GS Q910Q6_9REOV/1-173      AC Q910Q6.1
#=GS D7SC34_9REOV/1-170      AC D7SC34.1
#=GS I1TJT7_9REOV/1-173      AC I1TJT7.1
#=GS D1GHE4_9REOV/1-173      AC D1GHE4.1
#=GS A5H1R5_9REOV/1-158      AC A5H1R5.1
#=GS H6SWT8_9REOV/1-156      AC H6SWT8.1
#=GS E7CBK4_9REOV/1-171      AC E7CBK4.1
#=GS F5C6N0_9REOV/1-173      AC F5C6N0.1
#=GS T2CD90_9REOV/1-173      AC T2CD90.1
#=GS B6E4W1_9REOV/1-173      AC B6E4W1.1
#=GS A9ZP31_9REOV/1-173      AC A9ZP31.1
#=GS V5IX05_9REOV/1-173      AC V5IX05.1
#=GS E7ECT2_9REOV/8-180      AC E7ECT2.1
#=GS Q8V789_9REOV/1-167      AC Q8V789.1
#=GS E3W515_9REOV/1-173      AC E3W515.1
#=GS I6U0S7_9REOV/3-144      AC I6U0S7.1
#=GS F5C4Z3_9REOV/1-173      AC F5C4Z3.1
#=GS H9BPQ3_9REOV/1-157      AC H9BPQ3.1
#=GS B0ZSX5_9REOV/1-166      AC B0ZSX5.1
#=GS E7D6L2_ROTHU/1-173      AC E7D6L2.1
#=GS D2KQT7_9REOV/1-173      AC D2KQT7.1
#=GS E0XH97_9REOV/8-105      AC E0XH97.1
#=GS D3JPS9_9REOV/1-172      AC D3JPS9.1
#=GS A0A024CFR7_9REOV/1-173  AC A0A024CFR7.1
#=GS Q4G640_9REOV/1-173      AC Q4G640.1
#=GS V9VGZ6_9REOV/10-182     AC V9VGZ6.1
#=GS H2DF34_ROTHU/1-173      AC H2DF34.1
#=GS M4ZVL9_9REOV/1-173      AC M4ZVL9.1
#=GS Q1G1V3_9REOV/1-170      AC Q1G1V3.1
#=GS F6JTH7_9REOV/1-173      AC F6JTH7.1
#=GS L7WQ36_9REOV/1-173      AC L7WQ36.1
#=GS NSP4_ROTBN/1-173        AC P08434.1
#=GS Q9Z038_9REOV/1-173      AC Q9Z038.1
#=GS A0MD51_9REOV/1-173      AC A0MD51.1
#=GS A8C503_9REOV/1-167      AC A8C503.1
#=GS M1KJM2_9REOV/1-173      AC M1KJM2.1
#=GS F5C5G4_9REOV/1-173      AC F5C5G4.1
#=GS Q9DHA4_9REOV/1-173      AC Q9DHA4.1
#=GS H6UJ58_9REOV/1-173      AC H6UJ58.1
#=GS F5C6Y8_9REOV/1-173      AC F5C6Y8.1
#=GS E7CBF2_9REOV/1-173      AC E7CBF2.1
#=GS B0ZSY7_9REOV/4-170      AC B0ZSY7.1
#=GS X4Y0W3_9REOV/1-173      AC X4Y0W3.1
#=GS B2Z9W1_9REOV/1-124      AC B2Z9W1.1
#=GS D1GG63_9REOV/1-173      AC D1GG63.1
#=GS F5C5J7_9REOV/1-173      AC F5C5J7.1
#=GS H9MZN8_9REOV/1-170      AC H9MZN8.1
#=GS I6SYA2_9REOV/1-166      AC I6SYA2.1
#=GS S4UCF1_9REOV/1-173      AC S4UCF1.1
#=GS E7CBL9_9REOV/1-173      AC E7CBL9.1
#=GS G9DDQ5_9REOV/1-165      AC G9DDQ5.1
#=GS E0YLK0_9REOV/1-173      AC E0YLK0.1
#=GS S5S2R0_9REOV/1-173      AC S5S2R0.1
#=GS E7ECR4_9REOV/8-180      AC E7ECR4.1
#=GS C1K3K2_9REOV/1-166      AC C1K3K2.1
#=GS F5CRG7_9REOV/1-173      AC F5CRG7.1
#=GS J9QFX0_9REOV/1-173      AC J9QFX0.1
#=GS D7SC31_9REOV/1-130      AC D7SC31.1
#=GS D7SC44_9REOV/1-170      AC D7SC44.1
#=GS M4YFT7_9REOV/1-173      AC M4YFT7.1
#=GS A9CQ75_9REOV/7-160      AC A9CQ75.1
#=GS D7NN67_9REOV/1-173      AC D7NN67.1
#=GS A0SXM5_9REOV/1-173      AC A0SXM5.1
#=GS E3TPX4_9REOV/1-173      AC E3TPX4.1
#=GS W0G4Y1_9REOV/1-173      AC W0G4Y1.1
#=GS G8DPJ5_9REOV/1-131      AC G8DPJ5.1
#=GS V5IX12_9REOV/1-173      AC V5IX12.1
#=GS Q1G1V0_9REOV/1-170      AC Q1G1V0.1
#=GS T1UNG2_9REOV/9-181      AC T1UNG2.1
#=GS E2ICS8_9REOV/7-179      AC E2ICS8.1
#=GS T1RPC9_9REOV/1-166      AC T1RPC9.1
#=GS H9MZP7_9REOV/1-170      AC H9MZP7.1
#=GS S5RQX2_9REOV/8-180      AC S5RQX2.1
#=GS G1FVW1_9REOV/1-173      AC G1FVW1.1
#=GS F5C529_9REOV/1-173      AC F5C529.1
#=GS E7ECU0_9REOV/8-180      AC E7ECU0.1
#=GS R4I3N9_9REOV/1-173      AC R4I3N9.1
#=GS Q1G1U9_9REOV/1-170      AC Q1G1U9.1
#=GS E7CBI9_9REOV/1-171      AC E7CBI9.1
#=GS X2FJE4_9REOV/1-173      AC X2FJE4.1
#=GS A5HJT3_9REOV/1-167      AC A5HJT3.1
#=GS E7ECU1_9REOV/8-180      AC E7ECU1.1
#=GS F5C6L8_9REOV/1-173      AC F5C6L8.1
#=GS Q4G607_9REOV/1-173      AC Q4G607.1
#=GS M1HCH4_9REOV/1-173      AC M1HCH4.1
#=GS V9TG12_9REOV/10-182     AC V9TG12.1
#=GS S5RGD0_9REOV/1-173      AC S5RGD0.1
#=GS Q4G625_9REOV/1-173      AC Q4G625.1
#=GS Q4G667_9REOV/1-173      AC Q4G667.1
#=GS H9MZK7_9REOV/1-170      AC H9MZK7.1
#=GS Q1WK51_9REOV/1-173      AC Q1WK51.1
#=GS Q4G649_9REOV/1-173      AC Q4G649.1
#=GS Q3LRX7_9REOV/1-168      AC Q3LRX7.1
#=GS M1JST4_9REOV/1-173      AC M1JST4.1
#=GS D1GG87_9REOV/1-173      AC D1GG87.1
#=GS NSP4_ROTH4/1-173        AC Q82033.1
#=GS R4V160_9REOV/1-173      AC R4V160.1
#=GS Q805Q5_9REOV/1-173      AC Q805Q5.1
#=GS G5CPK3_9REOV/1-170      AC G5CPK3.1
#=GS E5FPY1_9REOV/1-173      AC E5FPY1.1
#=GS Q45GC2_9REOV/1-163      AC Q45GC2.1
#=GS I3RPT8_9REOV/1-173      AC I3RPT8.1
#=GS C7EWR5_9REOV/1-167      AC C7EWR5.1
#=GS C7FFR8_9REOV/1-167      AC C7FFR8.1
#=GS D1GGL8_9REOV/1-173      AC D1GGL8.1
#=GS E0YLI6_9REOV/1-173      AC E0YLI6.1
#=GS Q53AU0_9REOV/1-173      AC Q53AU0.1
#=GS Q9DSG6_9REOV/1-173      AC Q9DSG6.1
#=GS NSP4_ROTHM/1-173        AC Q82034.1
#=GS NSP4_ROTHO/1-173        AC Q9WAI7.1
#=GS B2Z9U9_9REOV/1-127      AC B2Z9U9.1
#=GS E2J2R4_9REOV/1-173      AC E2J2R4.1
#=GS Q778G0_9REOV/1-173      AC Q778G0.1
#=GS U3M0M6_9REOV/1-173      AC U3M0M6.1
#=GS V5IX77_9REOV/1-173      AC V5IX77.1
#=GS K4IDQ8_9REOV/1-173      AC K4IDQ8.1
#=GS Q9IVG4_9REOV/1-134      AC Q9IVG4.1
#=GS Q9WAJ7_9REOV/1-173      AC Q9WAJ7.1
#=GS Q77P38_9REOV/1-173      AC Q77P38.1
#=GS M1GTR0_9REOV/1-173      AC M1GTR0.1
#=GS R9QU95_9REOV/1-173      AC R9QU95.1
#=GS Q4G673_9REOV/1-173      AC Q4G673.1
#=GS Q4G658_9REOV/1-173      AC Q4G658.1
#=GS Q3LRN8_9REOV/1-168      AC Q3LRN8.1
#=GS L7ZB07_9REOV/1-173      AC L7ZB07.1
#=GS J9QBW5_9REOV/10-182     AC J9QBW5.1
#=GS E2GK17_9REOV/1-173      AC E2GK17.1
#=GS F5C5E9_9REOV/1-173      AC F5C5E9.1
#=GS P87714_9REOV/1-162      AC P87714.1
#=GS G4XR49_9REOV/1-173      AC G4XR49.1
#=GS P87721_9REOV/1-162      AC P87721.1
#=GS D0UD35_9REOV/1-173      AC D0UD35.1
#=GS A0A024FBC2_9REOV/1-173  AC A0A024FBC2.1
#=GS I6XSU6_9REOV/1-173      AC I6XSU6.1
#=GS E3W540_9REOV/1-173      AC E3W540.1
#=GS D5LN54_ROTHU/1-173      AC D5LN54.1
#=GS E7CBK7_9REOV/1-171      AC E7CBK7.1
#=GS Q808T0_9REOV/1-114      AC Q808T0.1
#=GS F8U689_9REOV/1-173      AC F8U689.1
#=GS Q4G600_9REOV/1-173      AC Q4G600.1
#=GS G8FNI8_9REOV/1-173      AC G8FNI8.1
#=GS C1K3L0_9REOV/1-167      AC C1K3L0.1
#=GS F5C4H5_9REOV/1-173      AC F5C4H5.1
#=GS Q1G1T5_9REOV/1-170      AC Q1G1T5.1
#=GS C1K3K7_9REOV/1-166      AC C1K3K7.1
#=GS E7CBF5_9REOV/1-170      AC E7CBF5.1
#=GS Q4G627_9REOV/1-173      AC Q4G627.1
#=GS V9VH00_9REOV/10-182     AC V9VH00.1
#=GS E7CF15_9REOV/1-173      AC E7CF15.1
#=GS A0FJ13_ROTHU/1-170      AC A0FJ13.1
#=GS K4I115_9REOV/1-173      AC K4I115.1
#=GS D5HMU8_9REOV/1-173      AC D5HMU8.1
#=GS H6SWU2_9REOV/1-162      AC H6SWU2.1
#=GS M1PD69_9REOV/1-173      AC M1PD69.1
#=GS Q4G614_9REOV/1-173      AC Q4G614.1
#=GS G0YWF0_9REOV/1-167      AC G0YWF0.1
#=GS G0YWE9_9REOV/1-169      AC G0YWE9.1
#=GS S5RE36_9REOV/1-173      AC S5RE36.1
#=GS C7EWT2_9REOV/1-166      AC C7EWT2.1
#=GS Q4G618_9REOV/1-173      AC Q4G618.1
#=GS Q8QY58_9REOV/1-173      AC Q8QY58.1
#=GS E0XH90_9REOV/1-163      AC E0XH90.1
#=GS Q1G1S5_9REOV/1-170      AC Q1G1S5.1
#=GS C3RY81_9REOV/1-173      AC C3RY81.1
#=GS M1PYH5_9REOV/14-186     AC M1PYH5.1
#=GS T1SQZ2_9REOV/4-176      AC T1SQZ2.1
#=GS S5RE25_9REOV/2-174      AC S5RE25.1
#=GS X2FR19_9REOV/1-173      AC X2FR19.1
#=GS B6SAK5_ROTCU/1-173      AC B6SAK5.1
#=GS F6LR30_9REOV/1-173      AC F6LR30.1
#=GS B2BMC8_9REOV/1-173      AC B2BMC8.1
#=GS NSP4_ROTH3/1-173        AC O56850.1
#=GS F5C5H3_9REOV/1-173      AC F5C5H3.1
#=GS E7CBH7_9REOV/1-171      AC E7CBH7.1
#=GS A9ZQ59_9REOV/1-173      AC A9ZQ59.1
#=GS M4Q1S3_9REOV/1-173      AC M4Q1S3.1
#=GS C7EWQ9_9REOV/1-166      AC C7EWQ9.1
#=GS Q9DSG3_9REOV/1-173      AC Q9DSG3.1
#=GS B6SAN8_9REOV/1-173      AC B6SAN8.1
#=GS H9MZQ0_9REOV/1-170      AC H9MZQ0.1
#=GS S5S2R5_9REOV/1-173      AC S5S2R5.1
#=GS B2BRH3_9REOV/1-173      AC B2BRH3.1
#=GS E7BKX3_9REOV/1-173      AC E7BKX3.1
#=GS D1GHP0_9REOV/1-173      AC D1GHP0.1
#=GS K9ZU11_9REOV/1-173      AC K9ZU11.1
#=GS A0SXN0_ROTHU/1-173      AC A0SXN0.1
#=GS Q2PGE7_9REOV/1-173      AC Q2PGE7.1
#=GS Q8AZ11_9REOV/1-173      AC Q8AZ11.1
#=GS A0A023UIG2_9REOV/1-139  AC A0A023UIG2.1
#=GS H2DLV3_9REOV/1-139      AC H2DLV3.1
#=GS A9ZP16_9REOV/1-173      AC A9ZP16.1
#=GS F5C6V2_9REOV/1-173      AC F5C6V2.1
#=GS E7ECT6_9REOV/8-180      AC E7ECT6.1
#=GS X4YQR4_9REOV/1-173      AC X4YQR4.1
#=GS X2FJ00_9REOV/1-173      AC X2FJ00.1
#=GS H9MZM1_9REOV/1-170      AC H9MZM1.1
#=GS Q9YIH2_9REOV/1-173      AC Q9YIH2.1
#=GS F5C685_9REOV/1-173      AC F5C685.1
#=GS A0A024CGL3_9REOV/1-173  AC A0A024CGL3.1
#=GS S5RE18_9REOV/12-184     AC S5RE18.1
#=GS S5I901_9REOV/8-180      AC S5I901.1
#=GS D3JPT2_9REOV/1-173      AC D3JPT2.1
#=GS C1K3J0_9REOV/1-167      AC C1K3J0.1
#=GS B2Z9T3_9REOV/1-127      AC B2Z9T3.1
#=GS B6SAM7_9REOV/1-173      AC B6SAM7.1
#=GS E0YLK3_9REOV/1-173      AC E0YLK3.1
#=GS S5RLI9_9REOV/2-174      AC S5RLI9.1
#=GS Q1G1T4_9REOV/1-170      AC Q1G1T4.1
#=GS A9ZQ51_9REOV/1-173      AC A9ZQ51.1
#=GS M1PQN4_9REOV/1-95       AC M1PQN4.1
#=GS C4PBK4_9REOV/1-173      AC C4PBK4.1
#=GS E7CBJ6_9REOV/1-171      AC E7CBJ6.1
#=GS Q1G1U6_9REOV/1-170      AC Q1G1U6.1
#=GS I1E473_9REOV/1-171      AC I1E473.1
#=GS F5C577_9REOV/1-173      AC F5C577.1
#=GS D1GGV2_9REOV/1-173      AC D1GGV2.1
#=GS B5ATN2_9REOV/1-165      AC B5ATN2.1
#=GS C3U212_9REOV/14-186     AC C3U212.1
#=GS E3W565_9REOV/1-173      AC E3W565.1
#=GS Q6QSZ9_9REOV/1-173      AC Q6QSZ9.1
#=GS E0YLI5_9REOV/1-173      AC E0YLI5.1
#=GS E2J2Z8_9REOV/1-173      AC E2J2Z8.1
#=GS F5CRK3_9REOV/1-173      AC F5CRK3.1
#=GS A0A024CF32_9REOV/1-173  AC A0A024CF32.1
#=GS A0A024CG74_9REOV/1-173  AC A0A024CG74.1
#=GS S4U8X2_9REOV/1-173      AC S4U8X2.1
#=GS L7NV19_9REOV/1-173      AC L7NV19.1
#=GS D1GGD5_9REOV/1-173      AC D1GGD5.1
#=GS M1HMU1_9REOV/1-173      AC M1HMU1.1
#=GS E7CBJ2_9REOV/1-171      AC E7CBJ2.1
#=GS B2BMB7_9REOV/1-173      AC B2BMB7.1
#=GS Q4G626_9REOV/1-173      AC Q4G626.1
#=GS A5H1R8_9REOV/1-158      AC A5H1R8.1
#=GS E0YLJ7_9REOV/1-173      AC E0YLJ7.1
#=GS X2G8X7_9REOV/1-173      AC X2G8X7.1
#=GS B8LFN5_9REOV/1-158      AC B8LFN5.1
#=GS V5IX07_9REOV/1-173      AC V5IX07.1
#=GS L8AVA0_9REOV/1-173      AC L8AVA0.1
#=GS L7NUW7_9REOV/1-173      AC L7NUW7.1
#=GS E7CBK9_9REOV/1-173      AC E7CBK9.1
#=GS S5S2Q1_9REOV/3-175      AC S5S2Q1.1
#=GS T2HS61_9REOV/1-173      AC T2HS61.1
#=GS E5L0C1_9REOV/1-173      AC E5L0C1.1
#=GS E7CBK6_9REOV/1-170      AC E7CBK6.1
#=GS B2Z9T5_9REOV/1-124      AC B2Z9T5.1
#=GS E7CUG7_9REOV/1-173      AC E7CUG7.1
#=GS F5C6Q4_9REOV/1-173      AC F5C6Q4.1
#=GS Q9W9Y0_9REOV/1-173      AC Q9W9Y0.1
#=GS Q5KR57_9REOV/1-173      AC Q5KR57.1
#=GS Q9YKF6_9REOV/1-173      AC Q9YKF6.1
#=GS K4HLU7_9REOV/1-173      AC K4HLU7.1
#=GS E7CBM5_9REOV/1-162      AC E7CBM5.1
#=GS E3W4A0_9REOV/1-173      AC E3W4A0.1
#=GS B5ATN4_9REOV/1-170      AC B5ATN4.1
#=GS F5C5V5_9REOV/1-173      AC F5C5V5.1
#=GS E7ECR2_9REOV/8-180      AC E7ECR2.1
#=GS E7CBK2_9REOV/1-166      AC E7CBK2.1
#=GS Q1G1U8_9REOV/1-170      AC Q1G1U8.1
#=GS G3G3W5_9REOV/1-173      AC G3G3W5.1
#=GS I6YQW5_9REOV/1-157      AC I6YQW5.1
#=GS E7CBP2_9REOV/1-163      AC E7CBP2.1
#=GS Q80AP8_9REOV/1-173      AC Q80AP8.1
#=GS F1JZU5_9REOV/2-167      AC F1JZU5.1
#=GS E0XH96_9REOV/1-121      AC E0XH96.1
#=GS Q1WEV6_ROTHU/1-173      AC Q1WEV6.1
#=GS M1HM54_9REOV/1-173      AC M1HM54.1
#=GS F5C6W2_9REOV/1-173      AC F5C6W2.1
#=GS F5C6J4_9REOV/1-173      AC F5C6J4.1
#=GS F5C504_9REOV/1-173      AC F5C504.1
#=GS A0A024CFA4_9REOV/1-173  AC A0A024CFA4.1
#=GS B2ZPK8_9REOV/1-173      AC B2ZPK8.1
#=GS F5AXY4_9REOV/8-180      AC F5AXY4.1
#=GS B6D406_9REOV/1-173      AC B6D406.1
#=GS T2CEK6_9REOV/1-173      AC T2CEK6.1
#=GS F5C6I2_9REOV/1-173      AC F5C6I2.1
#=GS A9ZP23_9REOV/1-173      AC A9ZP23.1
#=GS Q1G1T7_9REOV/1-170      AC Q1G1T7.1
#=GS Q2VC36_9REOV/1-173      AC Q2VC36.1
#=GS E0YN02_9REOV/1-173      AC E0YN02.1
#=GS I6T9U5_9REOV/1-164      AC I6T9U5.1
#=GS F5C4A3_9REOV/1-173      AC F5C4A3.1
#=GS Q1WK38_9REOV/1-173      AC Q1WK38.1
#=GS F5C588_9REOV/1-173      AC F5C588.1
#=GS A5X359_9REOV/1-173      AC A5X359.1
#=GS B0ZSW9_9REOV/4-169      AC B0ZSW9.1
#=GS I2CMQ1_9REOV/1-173      AC I2CMQ1.1
#=GS R4I447_9REOV/1-155      AC R4I447.1
#=GS D7NN66_9REOV/1-173      AC D7NN66.1
#=GS G3BFZ0_9REOV/1-173      AC G3BFZ0.1
#=GS D1GGC3_9REOV/1-173      AC D1GGC3.1
#=GS E7ECQ6_9REOV/8-180      AC E7ECQ6.1
#=GS C9WLT4_9REOV/1-158      AC C9WLT4.1
#=GS T2CEU3_9REOV/1-173      AC T2CEU3.1
#=GS C9WLT3_9REOV/1-158      AC C9WLT3.1
#=GS P90508_9REOV/1-162      AC P90508.1
#=GS E7CBG0_9REOV/1-173      AC E7CBG0.1
#=GS A5HAV3_9REOV/1-158      AC A5HAV3.1
#=GS S5RGE8_9REOV/2-174      AC S5RGE8.1
#=GS Q4G675_9REOV/1-173      AC Q4G675.1
#=GS S5RGH2_9REOV/1-173      AC S5RGH2.1
#=GS A0MM87_9REOV/1-170      AC A0MM87.1
#=GS H9LJ12_9REOV/1-171      AC H9LJ12.1
#=GS Q4G652_9REOV/1-173      AC Q4G652.1
#=GS H6SWT9_9REOV/1-92       AC H6SWT9.1
#=GS B3VQM0_9REOV/1-173      AC B3VQM0.1
#=GS B2Z9W9_9REOV/1-124      AC B2Z9W9.1
#=GS H8ZHF6_9REOV/1-164      AC H8ZHF6.1
#=GS E0XH87_9REOV/9-181      AC E0XH87.1
#=GS G3FJ61_9REOV/1-159      AC G3FJ61.1
#=GS NSP4_ROTHT/1-173        AC Q82035.1
#=GS NSP4_ROTHT/1-173        DR PDB; 3MIW A; 95-136;
#=GS NSP4_ROTHT/1-173        DR PDB; 3MIW C; 95-139;
#=GS NSP4_ROTHT/1-173        DR PDB; 3MIW D; 95-138;
#=GS NSP4_ROTHT/1-173        DR PDB; 3MIW H; 95-134;
#=GS NSP4_ROTHT/1-173        DR PDB; 3MIW J; 95-135;
#=GS NSP4_ROTHT/1-173        DR PDB; 3MIW G; 95-134;
#=GS NSP4_ROTHT/1-173        DR PDB; 3MIW I; 95-136;
#=GS NSP4_ROTHT/1-173        DR PDB; 3MIW F; 95-137;
#=GS NSP4_ROTHT/1-173        DR PDB; 3MIW E; 95-137;
#=GS NSP4_ROTHT/1-173        DR PDB; 3MIW B; 95-137;
#=GS D1GGY8_9REOV/1-173      AC D1GGY8.1
#=GS C1K3H5_9REOV/1-167      AC C1K3H5.1
#=GS T1RQA0_9REOV/1-164      AC T1RQA0.1
#=GS S5U498_9REOV/1-173      AC S5U498.1
#=GS Q77P45_9REOV/1-173      AC Q77P45.1
#=GS L0CBA1_9REOV/1-173      AC L0CBA1.1
#=GS F5C5T0_9REOV/1-173      AC F5C5T0.1
#=GS H9MZQ4_9REOV/1-170      AC H9MZQ4.1
#=GS D1GHK4_9REOV/1-173      AC D1GHK4.1
#=GS Q9IVG3_9REOV/1-134      AC Q9IVG3.1
#=GS X2FWL9_9REOV/1-173      AC X2FWL9.1
#=GS T2HR40_9REOV/1-173      AC T2HR40.1
#=GS D1MEZ8_9REOV/1-173      AC D1MEZ8.1
#=GS E7CBM3_9REOV/1-170      AC E7CBM3.1
#=GS F5C553_9REOV/1-173      AC F5C553.1
#=GS E7CBK0_9REOV/1-171      AC E7CBK0.1
#=GS B8Y642_9REOV/1-101      AC B8Y642.1
#=GS U3M051_9REOV/1-173      AC U3M051.1
#=GS B7ZGV8_9REOV/1-154      AC B7ZGV8.1
#=GS G3FJ70_9REOV/1-159      AC G3FJ70.1
#=GS F5C7B9_9REOV/1-173      AC F5C7B9.1
#=GS Q1L7J8_9REOV/1-173      AC Q1L7J8.1
#=GS NSP4_ROTP5/1-173        AC P89061.1
#=GS F4YUY3_9REOV/1-161      AC F4YUY3.1
#=GS H2DF35_9REOV/1-173      AC H2DF35.1
#=GS E7CBI2_9REOV/1-173      AC E7CBI2.1
#=GS E7CBP4_9REOV/1-173      AC E7CBP4.1
#=GS E0XH92_9REOV/1-99       AC E0XH92.1
#=GS B7ZGW3_9REOV/1-155      AC B7ZGW3.1
#=GS D1L624_9REOV/1-173      AC D1L624.1
#=GS S5I2Y8_9REOV/1-126      AC S5I2Y8.1
#=GS K4I2L8_9REOV/1-173      AC K4I2L8.1
#=GS F5C4Q8_9REOV/1-173      AC F5C4Q8.1
#=GS D1GGU0_9REOV/1-173      AC D1GGU0.1
#=GS A0A023UIZ7_9REOV/1-139  AC A0A023UIZ7.1
#=GS T1RQ45_9REOV/1-164      AC T1RQ45.1
#=GS C7SAQ4_9REOV/1-173      AC C7SAQ4.1
#=GS E7CBF9_9REOV/1-173      AC E7CBF9.1
#=GS F8SPZ5_9REOV/2-174      AC F8SPZ5.1
#=GS H9MZL8_9REOV/1-170      AC H9MZL8.1
#=GS E7CBI6_9REOV/1-173      AC E7CBI6.1
#=GS E7CBP5_9REOV/1-173      AC E7CBP5.1
#=GS Q5G536_9REOV/1-144      AC Q5G536.1
#=GS I6U4M3_9REOV/1-163      AC I6U4M3.1
#=GS Q2VC42_9REOV/1-168      AC Q2VC42.1
#=GS E7CF51_9REOV/1-173      AC E7CF51.1
#=GS B3SRU0_9REOV/1-176      AC B3SRU0.1
#=GS B7ZGV4_9REOV/1-154      AC B7ZGV4.1
#=GS B2Z9U3_9REOV/1-121      AC B2Z9U3.1
#=GS E7CBL2_9REOV/1-172      AC E7CBL2.1
#=GS D1GGK6_9REOV/1-173      AC D1GGK6.1
#=GS B2CQB9_9REOV/1-173      AC B2CQB9.1
#=GS Q4G663_9REOV/1-173      AC Q4G663.1
#=GS V9VIJ8_9REOV/10-182     AC V9VIJ8.1
#=GS A9ZP19_9REOV/1-173      AC A9ZP19.1
#=GS D0UD08_9REOV/1-173      AC D0UD08.1
#=GS S5S0V4_9REOV/14-186     AC S5S0V4.1
#=GS P87712_9REOV/1-162      AC P87712.1
#=GS E7CBH2_9REOV/1-173      AC E7CBH2.1
#=GS F5C7D1_9REOV/1-173      AC F5C7D1.1
#=GS S5K2A5_9REOV/1-156      AC S5K2A5.1
#=GS M1HCU5_9REOV/1-173      AC M1HCU5.1
#=GS S5RLG7_9REOV/1-173      AC S5RLG7.1
#=GS G0YWF3_9REOV/1-167      AC G0YWF3.1
#=GS S5IGJ5_9REOV/1-125      AC S5IGJ5.1
#=GS A0A024CEI5_9REOV/1-173  AC A0A024CEI5.1
#=GS S5RLI4_9REOV/1-173      AC S5RLI4.1
#=GS G1CDA7_9REOV/1-173      AC G1CDA7.1
#=GS Q9QPN1_9REOV/1-173      AC Q9QPN1.1
#=GS Q99IA9_9REOV/1-173      AC Q99IA9.1
#=GS A7VJD5_9REOV/1-173      AC A7VJD5.1
#=GS A8C4Z7_9REOV/1-167      AC A8C4Z7.1
#=GS Q8B4J4_9REOV/1-173      AC Q8B4J4.1
#=GS Q808S9_9REOV/1-116      AC Q808S9.1
#=GS G0YWE7_9REOV/1-169      AC G0YWE7.1
#=GS B5ATN3_9REOV/1-170      AC B5ATN3.1
#=GS Q3LRN4_9REOV/1-173      AC Q3LRN4.1
#=GS W0G0Q4_9REOV/1-173      AC W0G0Q4.1
#=GS B2BM95_9REOV/1-173      AC B2BM95.1
#=GS E7CBH4_9REOV/1-173      AC E7CBH4.1
#=GS F5C4J9_9REOV/1-173      AC F5C4J9.1
#=GS Q4G603_9REOV/1-173      AC Q4G603.1
#=GS U5XMF7_9REOV/2-164      AC U5XMF7.1
#=GS C1K3K6_9REOV/1-167      AC C1K3K6.1
#=GS A0FL80_ROTHU/1-173      AC A0FL80.1
#=GS B0ZSY3_9REOV/2-168      AC B0ZSY3.1
#=GS Q53AU1_9REOV/1-173      AC Q53AU1.1
#=GS C1K3K3_9REOV/1-167      AC C1K3K3.1
#=GS NSP4_ROTMB/1-173        AC Q7TDX0.1
#=GS Q9E166_9REOV/1-173      AC Q9E166.1
#=GS C7EWT8_9REOV/1-167      AC C7EWT8.1
#=GS Q8B4J0_9REOV/1-173      AC Q8B4J0.1
#=GS G3CEQ3_9REOV/1-173      AC G3CEQ3.1
#=GS V9VFF4_9REOV/10-182     AC V9VFF4.1
#=GS Q9IV25_9REOV/1-173      AC Q9IV25.1
#=GS A5H1R3_9REOV/1-120      AC A5H1R3.1
#=GS D0QB94_9REOV/1-173      AC D0QB94.1
#=GS A3E0Y0_9REOV/1-173      AC A3E0Y0.1
#=GS C8C1J8_9REOV/1-167      AC C8C1J8.1
#=GS B8Y641_9REOV/1-101      AC B8Y641.1
#=GS NSP4_ROTHV/1-173        AC O12674.1
#=GS H9MZN5_9REOV/1-170      AC H9MZN5.1
#=GS D1GG39_9REOV/1-173      AC D1GG39.1
#=GS P87717_9REOV/1-162      AC P87717.1
#=GS J9QK91_9REOV/1-173      AC J9QK91.1
#=GS I3RPU2_9REOV/1-173      AC I3RPU2.1
#=GS Q77P70_9REOV/1-173      AC Q77P70.1
#=GS B2Z9T0_9REOV/1-127      AC B2Z9T0.1
#=GS K4HLB5_9REOV/1-173      AC K4HLB5.1
#=GS V9VFF8_9REOV/10-182     AC V9VFF8.1
#=GS H9MZN9_9REOV/1-170      AC H9MZN9.1
#=GS M1H3Q8_9REOV/1-173      AC M1H3Q8.1
#=GS D4P8F1_9REOV/1-170      AC D4P8F1.1
#=GS T2CE92_9REOV/1-173      AC T2CE92.1
#=GS E7CBF6_9REOV/1-170      AC E7CBF6.1
#=GS B2Z9U7_9REOV/1-127      AC B2Z9U7.1
#=GS B0ZSX1_9REOV/2-167      AC B0ZSX1.1
#=GS S5G3A8_9REOV/1-173      AC S5G3A8.1
#=GS H9MZN1_9REOV/1-170      AC H9MZN1.1
#=GS E7CBM6_9REOV/1-172      AC E7CBM6.1
#=GS Q5Q1N4_9REOV/1-173      AC Q5Q1N4.1
#=GS S5RGJ8_9REOV/2-174      AC S5RGJ8.1
#=GS B2Z9W4_9REOV/1-124      AC B2Z9W4.1
#=GS D1GGS8_9REOV/1-173      AC D1GGS8.1
#=GS F4YUY0_9REOV/1-157      AC F4YUY0.1
#=GS S5RE41_9REOV/1-173      AC S5RE41.1
#=GS M1PJJ2_9REOV/1-173      AC M1PJJ2.1
#=GS G0YWF6_9REOV/1-173      AC G0YWF6.1
#=GS B6E4W7_9REOV/1-173      AC B6E4W7.1
#=GS D2DXN3_9REOV/1-169      AC D2DXN3.1
#=GS D7NN69_9REOV/1-173      AC D7NN69.1
#=GS Q91E94_9REOV/1-173      AC Q91E94.1
#=GS D2CSV0_ROTHU/1-173      AC D2CSV0.1
#=GS B0ZSW8_9REOV/4-169      AC B0ZSW8.1
#=GS E3W552_9REOV/1-173      AC E3W552.1
#=GS Q8B4J2_9REOV/1-173      AC Q8B4J2.1
#=GS C1K3J4_9REOV/1-167      AC C1K3J4.1
#=GS A0A024CFI7_9REOV/1-173  AC A0A024CFI7.1
#=GS B7ZGW8_9REOV/1-155      AC B7ZGW8.1
#=GS C1K3J7_9REOV/1-167      AC C1K3J7.1
#=GS F4YUY5_9REOV/1-158      AC F4YUY5.1
#=GS B2Z9U2_9REOV/1-127      AC B2Z9U2.1
#=GS G0YY15_9REOV/1-173      AC G0YY15.1
#=GS I3RPU5_9REOV/1-173      AC I3RPU5.1
#=GS D7SC47_9REOV/1-170      AC D7SC47.1
#=GS D0UD24_9REOV/1-173      AC D0UD24.1
#=GS I6Z1D2_9REOV/1-157      AC I6Z1D2.1
#=GS Q4G669_9REOV/1-173      AC Q4G669.1
#=GS D1GHA8_9REOV/1-173      AC D1GHA8.1
#=GS G1CD95_9REOV/1-173      AC G1CD95.1
#=GS D1GGH0_9REOV/1-173      AC D1GGH0.1
#=GS F5C5B3_9REOV/1-173      AC F5C5B3.1
#=GS E7CBF1_9REOV/1-171      AC E7CBF1.1
#=GS A2I7V8_9REOV/1-173      AC A2I7V8.1
#=GS F8SYY1_9REOV/1-173      AC F8SYY1.1
#=GS B2BM84_9REOV/1-173      AC B2BM84.1
#=GS M1PQR0_9REOV/1-168      AC M1PQR0.1
#=GS Q9WAI9_9REOV/1-173      AC Q9WAI9.1
#=GS H6SWT7_9REOV/1-162      AC H6SWT7.1
#=GS G0ZS21_9REOV/1-173      AC G0ZS21.1
#=GS Q4G611_9REOV/1-173      AC Q4G611.1
#=GS Q7TDX1_9REOV/1-173      AC Q7TDX1.1
#=GS E0XH91_9REOV/1-170      AC E0XH91.1
#=GS X2FP91_9REOV/1-173      AC X2FP91.1
#=GS NSP4_ROTH1/1-173        AC Q82030.1
#=GS C5IAV7_9REOV/1-173      AC C5IAV7.1
#=GS G3FZG4_9REOV/1-173      AC G3FZG4.1
#=GS Q2PF44_9REOV/1-173      AC Q2PF44.1
#=GS Q91E92_9REOV/1-173      AC Q91E92.1
#=GS B0LWB3_9REOV/1-163      AC B0LWB3.1
#=GS A0A024CGP4_9REOV/1-173  AC A0A024CGP4.1
#=GS F5C5Q6_9REOV/1-173      AC F5C5Q6.1
#=GS E7ECS5_9REOV/8-180      AC E7ECS5.1
#=GS I6ZZ03_9REOV/1-135      AC I6ZZ03.1
#=GS Q1G1S9_9REOV/1-170      AC Q1G1S9.1
#=GS L7T8T1_9REOV/1-173      AC L7T8T1.1
#=GS M1KCN5_9REOV/1-173      AC M1KCN5.1
#=GS Q99IB1_9REOV/2-174      AC Q99IB1.1
#=GS K9ZUH3_9REOV/1-173      AC K9ZUH3.1
#=GS NSP4_ROTS1/1-173        AC P04512.1
#=GS NSP4_ROTS1/1-173        DR PDB; 1G1J B; 95-137;
#=GS NSP4_ROTS1/1-173        DR PDB; 1G1J A; 95-137;
#=GS NSP4_ROTS1/1-173        DR PDB; 2O1K A; 95-137;
#=GS NSP4_ROTS1/1-173        DR PDB; 1G1I B; 95-137;
#=GS NSP4_ROTS1/1-173        DR PDB; 2O1K B; 95-137;
#=GS NSP4_ROTS1/1-173        DR PDB; 1G1I A; 95-137;
#=GS M1PIA2_9REOV/1-173      AC M1PIA2.1
#=GS Q1G1U7_9REOV/1-170      AC Q1G1U7.1
#=GS I6Z1C9_9REOV/1-157      AC I6Z1C9.1
#=GS Q4G645_9REOV/1-173      AC Q4G645.1
#=GS E7CBM0_9REOV/1-173      AC E7CBM0.1
#=GS G9DDQ6_9REOV/1-165      AC G9DDQ6.1
#=GS S5I907_9REOV/1-123      AC S5I907.1
#=GS M1PSI1_9REOV/14-186     AC M1PSI1.1
#=GS C7EWR9_9REOV/1-167      AC C7EWR9.1
#=GS A0EXC3_9REOV/1-164      AC A0EXC3.1
#=GS M1KHS4_9REOV/1-173      AC M1KHS4.1
#=GS A8JYK2_9REOV/1-162      AC A8JYK2.1
#=GS S5IGI9_9REOV/7-179      AC S5IGI9.1
#=GS C1K3K1_9REOV/1-166      AC C1K3K1.1
#=GS Q4G654_9REOV/1-173      AC Q4G654.1
#=GS E7ECQ5_9REOV/8-180      AC E7ECQ5.1
#=GS V9VIK1_9REOV/10-182     AC V9VIK1.1
#=GS A9ZQ54_9REOV/1-173      AC A9ZQ54.1
#=GS H6VV39_9REOV/1-173      AC H6VV39.1
#=GS S5R9Q0_9REOV/1-125      AC S5R9Q0.1
#=GS M1QWC6_9REOV/1-173      AC M1QWC6.1
#=GS D1GG15_9REOV/1-173      AC D1GG15.1
#=GS M1HHC5_9REOV/1-173      AC M1HHC5.1
#=GS M4VN72_9REOV/1-168      AC M4VN72.1
#=GS Q4G666_9REOV/1-173      AC Q4G666.1
#=GS E7CBK5_9REOV/1-173      AC E7CBK5.1
#=GS S5I2Z3_9REOV/1-128      AC S5I2Z3.1
#=GS C8C1J9_9REOV/1-167      AC C8C1J9.1
#=GS Q9WN92_9REOV/1-173      AC Q9WN92.1
#=GS E5LLE5_9REOV/8-180      AC E5LLE5.1
#=GS D1GHL6_9REOV/1-173      AC D1GHL6.1
#=GS B0ZSY5_9REOV/3-169      AC B0ZSY5.1
#=GS E7CBK1_9REOV/1-171      AC E7CBK1.1
#=GS G0YVY3_9REOV/1-173      AC G0YVY3.1
#=GS E5L0C0_9REOV/1-173      AC E5L0C0.1
#=GS S5IGI2_9REOV/1-124      AC S5IGI2.1
#=GS E7ECS8_9REOV/8-180      AC E7ECS8.1
#=GS K4I0B8_9REOV/1-173      AC K4I0B8.1
#=GS Q1KZY6_9REOV/1-173      AC Q1KZY6.1
#=GS B7ZGV1_9REOV/1-154      AC B7ZGV1.1
#=GS Q8V788_9REOV/1-166      AC Q8V788.1
#=GS A5H1R4_9REOV/1-158      AC A5H1R4.1
#=GS Q3LRN2_9REOV/1-173      AC Q3LRN2.1
#=GS S5RE52_9REOV/1-173      AC S5RE52.1
#=GS B0ZSX9_9REOV/1-167      AC B0ZSX9.1
#=GS F5C602_9REOV/1-173      AC F5C602.1
#=GS B2Z9T2_9REOV/1-126      AC B2Z9T2.1
#=GS Q9Z043_9REOV/1-173      AC Q9Z043.1
#=GS B3SRW4_9REOV/1-173      AC B3SRW4.1
#=GS C7EWR8_9REOV/1-166      AC C7EWR8.1
#=GS D7SC36_9REOV/1-170      AC D7SC36.1
#=GS B0LWB0_9REOV/1-170      AC B0LWB0.1
#=GS M1PZR0_9REOV/1-160      AC M1PZR0.1
#=GS H9MZN4_9REOV/1-170      AC H9MZN4.1
#=GS S5RE72_9REOV/1-173      AC S5RE72.1
#=GS C7SB29_9REOV/1-173      AC C7SB29.1
#=GS S5RGH9_9REOV/1-173      AC S5RGH9.1
#=GS I6Z1C5_9REOV/1-115      AC I6Z1C5.1
#=GS U5XK68_9REOV/2-164      AC U5XK68.1
#=GS A9ZP21_9REOV/1-153      AC A9ZP21.1
#=GS S5K2A1_9REOV/1-173      AC S5K2A1.1
#=GS Q2VC39_9REOV/1-173      AC Q2VC39.1
#=GS S5U3H0_9REOV/1-173      AC S5U3H0.1
#=GS Q9WAI4_9REOV/1-173      AC Q9WAI4.1
#=GS B0ZSX4_9REOV/1-162      AC B0ZSX4.1
#=GS H9MZP5_9REOV/1-170      AC H9MZP5.1
#=GS B2Z9V9_9REOV/1-127      AC B2Z9V9.1
#=GS H9MZQ7_9REOV/1-170      AC H9MZQ7.1
#=GS S4S3F5_9REOV/1-173      AC S4S3F5.1
#=GS I3RPU1_9REOV/1-173      AC I3RPU1.1
#=GS Q4G613_9REOV/1-173      AC Q4G613.1
#=GS E7CBM8_9REOV/1-165      AC E7CBM8.1
#=GS X4Y0J6_9REOV/1-173      AC X4Y0J6.1
#=GS D1G6C1_9REOV/1-173      AC D1G6C1.1
#=GS B6SAL6_ROTD9/1-173      AC B6SAL6.1
#=GS D0UD29_9REOV/1-173      AC D0UD29.1
#=GS O55588_9REOV/1-167      AC O55588.1
#=GS H2EUN3_9REOV/1-166      AC H2EUN3.1
#=GS D1GGN0_9REOV/1-173      AC D1GGN0.1
#=GS Q9Z042_9REOV/1-173      AC Q9Z042.1
#=GS E7CBL7_9REOV/1-173      AC E7CBL7.1
#=GS M9Q2Q7_ROTHU/1-173      AC M9Q2Q7.1
#=GS U5XK61_9REOV/2-164      AC U5XK61.1
#=GS E7ECQ8_9REOV/8-180      AC E7ECQ8.1
#=GS G1FWB6_9REOV/1-173      AC G1FWB6.1
#=GS J9QLB0_9REOV/1-173      AC J9QLB0.1
#=GS Q9W927_9REOV/1-173      AC Q9W927.1
#=GS Q808S8_9REOV/1-137      AC Q808S8.1
#=GS G1FVZ9_9REOV/1-173      AC G1FVZ9.1
#=GS S5RGG7_9REOV/1-173      AC S5RGG7.1
#=GS Q3LRN9_9REOV/1-166      AC Q3LRN9.1
#=GS X2G3U1_9REOV/1-173      AC X2G3U1.1
#=GS D7SC40_9REOV/1-170      AC D7SC40.1
#=GS E2ICT2_9REOV/7-179      AC E2ICT2.1
#=GS B0ZSW7_9REOV/2-153      AC B0ZSW7.1
#=GS NSP4_ROTE2/1-173        AC Q9PYD1.1
#=GS M1HMG5_9REOV/1-173      AC M1HMG5.1
#=GS Q4G661_9REOV/1-173      AC Q4G661.1
#=GS M4ZUT3_9REOV/1-173      AC M4ZUT3.1
#=GS Q3LRN6_9REOV/1-173      AC Q3LRN6.1
#=GS Q4G619_9REOV/1-173      AC Q4G619.1
#=GS Q1G1S8_9REOV/1-170      AC Q1G1S8.1
#=GS D1GGJ4_9REOV/1-173      AC D1GGJ4.1
#=GS S5S0Q4_9REOV/2-174      AC S5S0Q4.1
#=GS Q6L5Y0_9REOV/1-173      AC Q6L5Y0.1
#=GS Q4G639_9REOV/1-173      AC Q4G639.1
#=GS E2ICT3_9REOV/7-179      AC E2ICT3.1
#=GS J9QLA5_9REOV/1-173      AC J9QLA5.1
#=GS E7ECS4_9REOV/8-180      AC E7ECS4.1
#=GS E7ECS1_9REOV/8-180      AC E7ECS1.1
#=GS H9N1A3_9REOV/1-173      AC H9N1A3.1
#=GS M1JRV8_9REOV/1-173      AC M1JRV8.1
#=GS C1K3I3_9REOV/1-167      AC C1K3I3.1
#=GS U5XJD3_9REOV/2-164      AC U5XJD3.1
#=GS E7CBH1_9REOV/1-172      AC E7CBH1.1
#=GS D7SC48_9REOV/1-170      AC D7SC48.1
#=GS L0HST5_9REOV/1-173      AC L0HST5.1
#=GS B5KFX3_9REOV/1-173      AC B5KFX3.1
#=GS B7ZGW4_9REOV/1-154      AC B7ZGW4.1
#=GS A9ZP20_9REOV/1-173      AC A9ZP20.1
#=GS H6UJ57_9REOV/1-172      AC H6UJ57.1
#=GS C1K3L1_9REOV/1-167      AC C1K3L1.1
#=GS E7CBN5_9REOV/1-171      AC E7CBN5.1
#=GS F5C6A3_9REOV/1-173      AC F5C6A3.1
#=GS T2HRC9_9REOV/1-173      AC T2HRC9.1
#=GS Q2VC33_9REOV/1-173      AC Q2VC33.1
#=GS B2Z9V3_9REOV/1-127      AC B2Z9V3.1
#=GS M1Q7V2_9REOV/14-186     AC M1Q7V2.1
#=GS L7ZAY3_9REOV/1-173      AC L7ZAY3.1
#=GS I3RPU0_9REOV/1-173      AC I3RPU0.1
#=GS S5R273_9REOV/1-156      AC S5R273.1
#=GS B0ZSZ1_9REOV/2-154      AC B0ZSZ1.1
#=GS E7ECR8_9REOV/8-180      AC E7ECR8.1
#=GS B2Z9T9_9REOV/1-127      AC B2Z9T9.1
#=GS W0I9V3_9REOV/1-173      AC W0I9V3.1
#=GS I1TJT6_9REOV/1-173      AC I1TJT6.1
#=GS E7CBJ0_9REOV/1-173      AC E7CBJ0.1
#=GS B7ZGW5_9REOV/1-154      AC B7ZGW5.1
#=GS U5XJA8_9REOV/2-164      AC U5XJA8.1
#=GS S5R268_9REOV/1-131      AC S5R268.1
#=GS E3W4V6_9REOV/1-173      AC E3W4V6.1
#=GS V5IX06_9REOV/1-173      AC V5IX06.1
#=GS B2Z9U8_9REOV/1-127      AC B2Z9U8.1
#=GS E7ECQ9_9REOV/8-180      AC E7ECQ9.1
#=GS D2KQT2_9REOV/1-173      AC D2KQT2.1
#=GS G9DDP9_9REOV/1-165      AC G9DDP9.1
#=GS A0A024FCJ0_9REOV/1-173  AC A0A024FCJ0.1
#=GS O11981_9REOV/1-173      AC O11981.1
#=GS C1K3J6_9REOV/1-167      AC C1K3J6.1
#=GS H9BPG1_9REOV/1-173      AC H9BPG1.1
#=GS S5R536_9REOV/1-120      AC S5R536.1
#=GS Q8VA30_9REOV/1-173      AC Q8VA30.1
#=GS E3W5C4_9REOV/1-173      AC E3W5C4.1
#=GS I6VGG2_9REOV/1-173      AC I6VGG2.1
#=GS S5RLK9_9REOV/2-174      AC S5RLK9.1
#=GS A8JNY6_9REOV/1-173      AC A8JNY6.1
#=GS S5RE46_9REOV/2-174      AC S5RE46.1
#=GS B2Z9U4_9REOV/1-121      AC B2Z9U4.1
#=GS F5AY55_9REOV/8-180      AC F5AY55.1
#=GS S5RDZ8_9REOV/1-173      AC S5RDZ8.1
#=GS Q98VJ6_9REOV/1-173      AC Q98VJ6.1
#=GS E7CBJ8_9REOV/1-152      AC E7CBJ8.1
#=GS A0A023NBK3_9REOV/1-173  AC A0A023NBK3.1
#=GS Q4G624_9REOV/1-173      AC Q4G624.1
#=GS A0A024CDT5_9REOV/1-173  AC A0A024CDT5.1
#=GS H9MZQ5_9REOV/1-170      AC H9MZQ5.1
#=GS Q8UYH4_9REOV/1-173      AC Q8UYH4.1
#=GS A5X357_9REOV/1-173      AC A5X357.1
#=GS D0QB70_9REOV/1-173      AC D0QB70.1
#=GS K4HLK7_9REOV/1-173      AC K4HLK7.1
#=GS A9ZP26_9REOV/1-124      AC A9ZP26.1
#=GS C1K3K0_9REOV/1-167      AC C1K3K0.1
#=GS D0E2W6_9REOV/1-171      AC D0E2W6.1
#=GS D9HP94_9REOV/1-146      AC D9HP94.1
#=GS M4ZQX3_9REOV/1-173      AC M4ZQX3.1
#=GS B2Z9W7_9REOV/1-124      AC B2Z9W7.1
#=GS E7CBN6_9REOV/1-170      AC E7CBN6.1
#=GS Q4G665_9REOV/1-173      AC Q4G665.1
#=GS B0ZSX8_9REOV/3-169      AC B0ZSX8.1
#=GS Q9IVG1_9REOV/1-134      AC Q9IVG1.1
#=GS M4Q592_9REOV/1-173      AC M4Q592.1
#=GS A9ZP24_9REOV/1-173      AC A9ZP24.1
#=GS S5R9P6_9REOV/9-181      AC S5R9P6.1
#=GS Q2VC40_9REOV/1-173      AC Q2VC40.1
#=GS A9ZP39_9REOV/1-173      AC A9ZP39.1
#=GS E7ECT7_9REOV/8-180      AC E7ECT7.1
#=GS Q80FH4_9REOV/1-125      AC Q80FH4.1
#=GS S5RLH9_9REOV/1-173      AC S5RLH9.1
#=GS M1KIN9_9REOV/1-173      AC M1KIN9.1
#=GS H9MZL9_9REOV/1-170      AC H9MZL9.1
#=GS P87713_9REOV/1-162      AC P87713.1
#=GS B2Z9V4_9REOV/1-127      AC B2Z9V4.1
#=GS B2Z9T6_9REOV/1-127      AC B2Z9T6.1
#=GS B6SAJ4_9REOV/1-173      AC B6SAJ4.1
#=GS H9MZP8_9REOV/1-170      AC H9MZP8.1
#=GS B5KFX7_9REOV/1-173      AC B5KFX7.1
#=GS T2HRR4_9REOV/1-173      AC T2HRR4.1
#=GS S5S2T2_9REOV/2-174      AC S5S2T2.1
#=GS Q4G610_9REOV/1-173      AC Q4G610.1
#=GS V5IX72_9REOV/1-173      AC V5IX72.1
#=GS D1GH00_9REOV/1-173      AC D1GH00.1
#=GS E0XH94_9REOV/1-163      AC E0XH94.1
#=GS C3TTS7_9REOV/1-166      AC C3TTS7.1
#=GS Q3LRN0_9REOV/1-164      AC Q3LRN0.1
#=GS S5RE61_9REOV/2-174      AC S5RE61.1
#=GS Q4G609_9REOV/1-173      AC Q4G609.1
#=GS E7ECS3_9REOV/8-180      AC E7ECS3.1
#=GS M1H617_9REOV/1-173      AC M1H617.1
#=GS C9DQ52_9REOV/1-173      AC C9DQ52.1
#=GS D5G326_9REOV/1-173      AC D5G326.1
#=GS Q9PX30_9REOV/1-173      AC Q9PX30.1
#=GS S5GG98_9REOV/1-173      AC S5GG98.1
#=GS D4P8F2_9REOV/1-171      AC D4P8F2.1
#=GS D0UD16_9REOV/1-173      AC D0UD16.1
#=GS Q4G674_9REOV/1-173      AC Q4G674.1
#=GS B5ATM5_9REOV/1-173      AC B5ATM5.1
#=GS A0A023UHV9_9REOV/1-128  AC A0A023UHV9.1
#=GS S5GIX1_9REOV/1-173      AC S5GIX1.1
#=GS F5AXY3_9REOV/8-180      AC F5AXY3.1
#=GS B7ZGV2_9REOV/1-155      AC B7ZGV2.1
#=GS S5RLM4_9REOV/1-173      AC S5RLM4.1
#=GS F5C491_9REOV/1-173      AC F5C491.1
#=GS P87718_9REOV/1-162      AC P87718.1
#=GS B5ATN0_9REOV/1-173      AC B5ATN0.1
#=GS Q7TDP2_9REOV/1-173      AC Q7TDP2.1
#=GS M1Q7U8_9REOV/14-186     AC M1Q7U8.1
#=GS T2CCQ8_9REOV/1-173      AC T2CCQ8.1
#=GS Q1WEV4_ROTHU/1-173      AC Q1WEV4.1
#=GS F5C4G3_9REOV/1-173      AC F5C4G3.1
#=GS H6SWU0_9REOV/1-166      AC H6SWU0.1
#=GS Q9PYD6_9REOV/1-173      AC Q9PYD6.1
#=GS F5C4C7_9REOV/1-173      AC F5C4C7.1
#=GS Q2PGE3_9REOV/1-173      AC Q2PGE3.1
#=GS D1GHJ2_9REOV/1-173      AC D1GHJ2.1
#=GS A3EZQ7_9REOV/1-168      AC A3EZQ7.1
#=GS H9MZP1_9REOV/1-170      AC H9MZP1.1
#=GS S5RLH3_9REOV/2-174      AC S5RLH3.1
#=GS C1K3J3_9REOV/1-167      AC C1K3J3.1
#=GS A9CQ83_9REOV/1-173      AC A9CQ83.1
#=GS E2J334_9REOV/1-173      AC E2J334.1
#=GS D7SC49_9REOV/1-170      AC D7SC49.1
#=GS Q80FH3_9REOV/1-142      AC Q80FH3.1
#=GS E7CBL0_9REOV/1-173      AC E7CBL0.1
#=GS B5KFX6_9REOV/1-173      AC B5KFX6.1
#=GS A9ZP40_9REOV/1-173      AC A9ZP40.1
#=GS F5C7A8_9REOV/1-173      AC F5C7A8.1
#=GS E0XH88_9REOV/1-156      AC E0XH88.1
#=GS M1KH37_9REOV/1-173      AC M1KH37.1
#=GS Q80FH5_9REOV/1-125      AC Q80FH5.1
#=GS E7D6L4_ROTHU/1-173      AC E7D6L4.1
#=GS I2CN89_9REOV/1-173      AC I2CN89.1
#=GS M1PYM5_9REOV/1-173      AC M1PYM5.1
#=GS B7SY70_9REOV/1-173      AC B7SY70.1
#=GS I1SST1_9REOV/1-173      AC I1SST1.1
#=GS D9MX00_9REOV/1-173      AC D9MX00.1
#=GS G5CPK4_9REOV/1-170      AC G5CPK4.1
#=GS U5KM56_9REOV/1-173      AC U5KM56.1
#=GS V9TKF0_9REOV/10-182     AC V9TKF0.1
#=GS E2J382_9REOV/1-173      AC E2J382.1
#=GS C7SAQ7_9REOV/1-173      AC C7SAQ7.1
#=GS C3RX26_9REOV/1-173      AC C3RX26.1
#=GS I3QD96_9REOV/1-173      AC I3QD96.1
#=GS E9NAZ4_9REOV/1-173      AC E9NAZ4.1
#=GS S4SB62_9REOV/1-171      AC S4SB62.1
#=GS X4Y7W2_9REOV/1-173      AC X4Y7W2.1
#=GS M1H7X4_9REOV/1-173      AC M1H7X4.1
#=GS A8HI55_9REOV/1-168      AC A8HI55.1
#=GS E0YLJ0_9REOV/1-173      AC E0YLJ0.1
#=GS H2EHT4_9REOV/1-173      AC H2EHT4.1
#=GS S4VFZ8_ROTHU/1-171      AC S4VFZ8.1
#=GS G3FZF3_9REOV/1-173      AC G3FZF3.1
#=GS E2ICT1_9REOV/7-179      AC E2ICT1.1
#=GS T1RQ01_9REOV/1-166      AC T1RQ01.1
#=GS F5B529_9REOV/8-180      AC F5B529.1
#=GS L7V334_9REOV/1-173      AC L7V334.1
#=GS E7ECR7_9REOV/8-180      AC E7ECR7.1
#=GS I3QDA7_9REOV/1-173      AC I3QDA7.1
#=GS S5S0U8_9REOV/1-173      AC S5S0U8.1
#=GS Q9Z041_9REOV/1-173      AC Q9Z041.1
#=GS D1GGE7_9REOV/1-173      AC D1GGE7.1
#=GS Q6WEB4_9REOV/1-173      AC Q6WEB4.1
#=GS G5CPK0_9REOV/1-173      AC G5CPK0.1
#=GS L0GCX5_9REOV/1-173      AC L0GCX5.1
#=GS F5C541_9REOV/1-173      AC F5C541.1
#=GS V5LGP1_9REOV/1-173      AC V5LGP1.1
#=GS B0LWB4_9REOV/1-170      AC B0LWB4.1
#=GS A9ZP18_9REOV/1-173      AC A9ZP18.1
#=GS F5C6X6_9REOV/1-173      AC F5C6X6.1
#=GS Q2N3R8_9REOV/1-173      AC Q2N3R8.1
#=GS Q80AP9_9REOV/1-173      AC Q80AP9.1
#=GS B2Z9U0_9REOV/1-127      AC B2Z9U0.1
#=GS V5IX74_9REOV/1-173      AC V5IX74.1
#=GS Q1G1S6_9REOV/1-170      AC Q1G1S6.1
#=GS F5C6G9_9REOV/1-173      AC F5C6G9.1
#=GS C1K3I5_9REOV/1-167      AC C1K3I5.1
#=GS H2DLU8_9REOV/14-186     AC H2DLU8.1
#=GS M4VQM9_9REOV/1-168      AC M4VQM9.1
#=GS B2Z9V6_9REOV/1-127      AC B2Z9V6.1
#=GS M9PLK0_9REOV/1-156      AC M9PLK0.1
#=GS I6ZYZ8_9REOV/1-157      AC I6ZYZ8.1
#=GS D1GH60_9REOV/1-173      AC D1GH60.1
#=GS E0XH98_ROTHU/1-161      AC E0XH98.1
#=GS H6VLJ4_9REOV/1-173      AC H6VLJ4.1
#=GS F6JTI4_9REOV/1-173      AC F6JTI4.1
#=GS F5C783_9REOV/1-173      AC F5C783.1
#=GS B0ZSX7_9REOV/4-170      AC B0ZSX7.1
#=GS Q4G634_9REOV/1-173      AC Q4G634.1
#=GS X4Y3Y4_9REOV/1-173      AC X4Y3Y4.1
#=GS S5S2N1_9REOV/1-173      AC S5S2N1.1
#=GS Q2PF43_9REOV/1-173      AC Q2PF43.1
#=GS Q9E162_9REOV/1-173      AC Q9E162.1
#=GS Q4G672_9REOV/1-173      AC Q4G672.1
#=GS L0CRY7_9REOV/1-167      AC L0CRY7.1
#=GS Q4G604_9REOV/1-173      AC Q4G604.1
#=GS C1K3H7_9REOV/1-167      AC C1K3H7.1
#=GS B7ZGW0_9REOV/1-154      AC B7ZGW0.1
#=GS C1K3J1_9REOV/1-167      AC C1K3J1.1
#=GS A5HAV2_9REOV/1-158      AC A5HAV2.1
#=GS F5C7E4_9REOV/1-173      AC F5C7E4.1
#=GS T2HTS1_9REOV/1-173      AC T2HTS1.1
#=GS G1FWC7_9REOV/1-173      AC G1FWC7.1
#=GS E7CBG7_9REOV/1-173      AC E7CBG7.1
#=GS D9HP95_9REOV/1-146      AC D9HP95.1
#=GS A3DSK3_9REOV/1-173      AC A3DSK3.1
#=GS A0MM86_9REOV/1-164      AC A0MM86.1
#=GS E7D6L0_ROTHU/1-173      AC E7D6L0.1
#=GS H9BPF3_9REOV/1-173      AC H9BPF3.1
#=GS Q2VC44_9REOV/1-168      AC Q2VC44.1
#=GS M1KBD2_9REOV/1-173      AC M1KBD2.1
#=GS E2EA88_9REOV/1-173      AC E2EA88.1
#=GS Q4G617_9REOV/1-173      AC Q4G617.1
#=GS U3M0G4_9REOV/1-173      AC U3M0G4.1
#=GS T1RPE2_9REOV/1-164      AC T1RPE2.1
#=GS X4Y203_9REOV/1-173      AC X4Y203.1
#=GS B7TAC9_9REOV/1-173      AC B7TAC9.1
#=GS F5C6U0_9REOV/1-173      AC F5C6U0.1
#=GS S5RLL5_9REOV/2-174      AC S5RLL5.1
#=GS R4I445_9REOV/1-173      AC R4I445.1
#=GS D5HMU2_9REOV/1-173      AC D5HMU2.1
#=GS NSP4_ROTKU/1-173        AC P89059.1
#=GS A9ZP36_9REOV/1-71       AC A9ZP36.1
#=GS W6CN59_9REOV/1-173      AC W6CN59.1
#=GS I3RPU7_9REOV/1-173      AC I3RPU7.1
#=GS B2ZPL0_9REOV/1-173      AC B2ZPL0.1
#=GS S5RMU0_9REOV/8-180      AC S5RMU0.1
#=GS V5IX88_9REOV/1-173      AC V5IX88.1
#=GS E7ECT8_9REOV/8-180      AC E7ECT8.1
#=GS S5G915_9REOV/1-173      AC S5G915.1
#=GS X4Y6S7_9REOV/1-173      AC X4Y6S7.1
#=GS NSP4_ROTHW/1-173        AC P03535.1
#=GS Q4G621_9REOV/1-173      AC Q4G621.1
#=GS K4HL13_9REOV/1-173      AC K4HL13.1
#=GS U5XLZ4_9REOV/2-164      AC U5XLZ4.1
#=GS E3W472_9REOV/1-173      AC E3W472.1
#=GS V5IX08_9REOV/1-173      AC V5IX08.1
#=GS F5C4F1_9REOV/1-173      AC F5C4F1.1
#=GS I2FFT2_9REOV/1-173      AC I2FFT2.1
#=GS F1JZT7_9REOV/2-167      AC F1JZT7.1
#=GS I6TST8_9REOV/1-166      AC I6TST8.1
#=GS M1HHG0_9REOV/1-173      AC M1HHG0.1
#=GS D7NN65_9REOV/1-173      AC D7NN65.1
#=GS H9MZK9_9REOV/1-170      AC H9MZK9.1
#=GS J9QFX5_9REOV/1-173      AC J9QFX5.1
#=GS E9KPE0_9REOV/1-100      AC E9KPE0.1
#=GS A8C4Z4_9REOV/1-167      AC A8C4Z4.1
#=GS D1GHR4_9REOV/1-173      AC D1GHR4.1
#=GS D7SC32_9REOV/1-142      AC D7SC32.1
#=GS X2FYG2_9REOV/1-173      AC X2FYG2.1
#=GS C1K3I2_9REOV/1-166      AC C1K3I2.1
#=GS D3JPT3_9REOV/1-172      AC D3JPT3.1
#=GS D1M901_9REOV/1-173      AC D1M901.1
#=GS A0A023UH66_9REOV/1-139  AC A0A023UH66.1
#=GS S5TDL6_9REOV/1-173      AC S5TDL6.1
#=GS D5J9Y3_9REOV/1-173      AC D5J9Y3.1
#=GS E7ECT5_9REOV/8-180      AC E7ECT5.1
#=GS R4JKL9_9REOV/1-162      AC R4JKL9.1
#=GS G0YWF2_9REOV/1-166      AC G0YWF2.1
#=GS V5IX87_9REOV/1-173      AC V5IX87.1
#=GS A5H1R6_9REOV/1-158      AC A5H1R6.1
#=GS I3RPT5_9REOV/1-173      AC I3RPT5.1
#=GS C3U210_9REOV/14-186     AC C3U210.1
#=GS G3FJ68_9REOV/1-159      AC G3FJ68.1
#=GS U5XMG3_9REOV/2-164      AC U5XMG3.1
#=GS P87715_9REOV/1-162      AC P87715.1
#=GS Q9E164_9REOV/1-173      AC Q9E164.1
#=GS A2I7V9_9REOV/1-173      AC A2I7V9.1
#=GS Q1G1T1_9REOV/1-170      AC Q1G1T1.1
#=GS Q8AYX5_9REOV/1-173      AC Q8AYX5.1
#=GS A8C4Z9_9REOV/1-167      AC A8C4Z9.1
#=GS T1RQ95_9REOV/1-166      AC T1RQ95.1
#=GS E2ICS9_9REOV/7-179      AC E2ICS9.1
#=GS E3W4B3_9REOV/1-173      AC E3W4B3.1
#=GS B5AAV3_9REOV/1-173      AC B5AAV3.1
#=GS C3TUN3_ROTHU/1-173      AC C3TUN3.1
#=GS K4GF53_9REOV/1-173      AC K4GF53.1
#=GS S5S0W4_9REOV/1-173      AC S5S0W4.1
#=GS T2CE26_9REOV/1-173      AC T2CE26.1
#=GS B2Z9U5_9REOV/1-127      AC B2Z9U5.1
#=GS Q4G629_9REOV/1-173      AC Q4G629.1
#=GS T2HS67_9REOV/1-173      AC T2HS67.1
#=GS Q8QY57_9REOV/1-173      AC Q8QY57.1
#=GS B2Z9V0_9REOV/1-127      AC B2Z9V0.1
#=GS P89060_9REOV/1-173      AC P89060.1
#=GS Q9IVG5_9REOV/1-134      AC Q9IVG5.1
#=GS E7CBJ9_9REOV/1-170      AC E7CBJ9.1
#=GS Q80AQ1_9REOV/1-173      AC Q80AQ1.1
#=GS E0XH93_9REOV/1-169      AC E0XH93.1
#=GS B0LWB1_9REOV/1-170      AC B0LWB1.1
#=GS R9QU53_9REOV/1-173      AC R9QU53.1
#=GS F5C700_9REOV/1-173      AC F5C700.1
#=GS B5KFX4_9REOV/1-173      AC B5KFX4.1
#=GS Q91HS4_9REOV/1-173      AC Q91HS4.1
#=GS M4Q432_9REOV/1-173      AC M4Q432.1
#=GS D1GH48_9REOV/1-173      AC D1GH48.1
#=GS D0UD19_9REOV/1-173      AC D0UD19.1
#=GS D1GH36_9REOV/1-173      AC D1GH36.1
#=GS M1NPF8_9REOV/1-173      AC M1NPF8.1
#=GS F5B543_9REOV/8-180      AC F5B543.1
#=GS E5FXI5_9REOV/1-173      AC E5FXI5.1
#=GS Q9IVG7_9REOV/1-134      AC Q9IVG7.1
#=GS NSP4_ROTHK/1-173        AC Q9QNA6.1
#=GS Q3LRN1_9REOV/1-168      AC Q3LRN1.1
#=GS H2EHT5_9REOV/1-173      AC H2EHT5.1
#=GS E7ECT4_9REOV/8-180      AC E7ECT4.1
#=GS E7ECS9_9REOV/8-180      AC E7ECS9.1
#=GS E7CBI1_9REOV/1-173      AC E7CBI1.1
#=GS X4Y7A6_9REOV/1-173      AC X4Y7A6.1
#=GS Q9DSG2_9REOV/1-173      AC Q9DSG2.1
#=GS I0B178_9REOV/1-173      AC I0B178.1
#=GS H8ZHZ1_9REOV/1-173      AC H8ZHZ1.1
#=GS D0UD05_9REOV/1-173      AC D0UD05.1
#=GS Q9W9K6_9REOV/1-173      AC Q9W9K6.1
#=GS R9TE54_9REOV/1-173      AC R9TE54.1
#=GS E7ECS0_9REOV/8-180      AC E7ECS0.1
#=GS E1CJH4_9REOV/1-173      AC E1CJH4.1
#=GS E7CBL1_9REOV/1-171      AC E7CBL1.1
#=GS Q1G1U0_9REOV/1-170      AC Q1G1U0.1
#=GS S5RLK1_9REOV/2-174      AC S5RLK1.1
#=GS S5S0R4_9REOV/1-173      AC S5S0R4.1
#=GS X2GA26_9REOV/1-173      AC X2GA26.1
#=GS A0A024CFV1_9REOV/1-173  AC A0A024CFV1.1
#=GS B0ZSY4_9REOV/5-171      AC B0ZSY4.1
#=GS D0UD25_9REOV/1-173      AC D0UD25.1
#=GS G0YWF4_9REOV/1-71       AC G0YWF4.1
#=GS A9CQ79_9REOV/1-173      AC A9CQ79.1
#=GS E7CBN0_9REOV/1-173      AC E7CBN0.1
#=GS E7D6L1_ROTHU/1-173      AC E7D6L1.1
#=GS K0I9A0_9REOV/1-173      AC K0I9A0.1
#=GS Q1WEV7_ROTHU/1-173      AC Q1WEV7.1
#=GS M1KJI1_9REOV/1-173      AC M1KJI1.1
#=GS S5RLM0_9REOV/1-173      AC S5RLM0.1
#=GS K7S1R0_9REOV/1-173      AC K7S1R0.1
#=GS Q1G1U1_9REOV/1-170      AC Q1G1U1.1
#=GS M1HE13_9REOV/1-173      AC M1HE13.1
#=GS H6B4D0_9REOV/1-173      AC H6B4D0.1
#=GS A2SUF9_9REOV/1-173      AC A2SUF9.1
#=GS S5JQA1_9REOV/1-173      AC S5JQA1.1
#=GS E3W4G1_9REOV/1-173      AC E3W4G1.1
#=GS F4YUY4_9REOV/1-159      AC F4YUY4.1
#=GS A0A024FRX5_9REOV/1-173  AC A0A024FRX5.1
#=GS E7CBF7_9REOV/1-166      AC E7CBF7.1
#=GS D7SC45_9REOV/1-170      AC D7SC45.1
#=GS H9MZN0_9REOV/1-170      AC H9MZN0.1
#=GS F5C6F6_9REOV/1-173      AC F5C6F6.1
#=GS R9TAP4_9REOV/1-173      AC R9TAP4.1
#=GS O56851_9REOV/1-173      AC O56851.1
#=GS D3JPT4_9REOV/1-172      AC D3JPT4.1
#=GS G1DH78_9REOV/1-173      AC G1DH78.1
#=GS D4P8F0_9REOV/1-170      AC D4P8F0.1
#=GS M1NQL2_9REOV/1-166      AC M1NQL2.1
#=GS E9KPE4_9REOV/1-172      AC E9KPE4.1
#=GS I2CMV8_9REOV/1-173      AC I2CMV8.1
#=GS NSP4_ROTWI/1-173        AC B3SRY0.1
#=GS F5B547_9REOV/8-180      AC F5B547.1
#=GS Q4G678_9REOV/1-64       AC Q4G678.1
#=GS F5C795_9REOV/1-173      AC F5C795.1
#=GS X4Y112_9REOV/1-173      AC X4Y112.1
#=GS F5C564_9REOV/1-173      AC F5C564.1
#=GS E0YLI0_9REOV/1-173      AC E0YLI0.1
#=GS F4YUY1_9REOV/1-94       AC F4YUY1.1
#=GS J9QLB2_9REOV/1-173      AC J9QLB2.1
#=GS B2Z9W3_9REOV/1-124      AC B2Z9W3.1
#=GS F4YUY2_9REOV/1-156      AC F4YUY2.1
#=GS J9QNI2_9REOV/1-173      AC J9QNI2.1
#=GS Q9PYD8_9REOV/1-173      AC Q9PYD8.1
#=GS A0MM90_9REOV/1-170      AC A0MM90.1
#=GS H9BPF8_9REOV/1-173      AC H9BPF8.1
#=GS S5S2P0_9REOV/2-174      AC S5S2P0.1
#=GS C1K3I0_9REOV/1-166      AC C1K3I0.1
#=GS E7CBJ5_9REOV/1-171      AC E7CBJ5.1
#=GS Q4G644_9REOV/1-173      AC Q4G644.1
#=GS D2K6F5_9REOV/1-173      AC D2K6F5.1
#=GS I6ZV08_9REOV/1-157      AC I6ZV08.1
#=GS NSP4_ROTE1/1-173        AC Q9PYD0.1
#=GS F6KWD6_9REOV/1-173      AC F6KWD6.1
#=GS G8FNI7_9REOV/1-173      AC G8FNI7.1
#=GS A0FJ14_9REOV/1-173      AC A0FJ14.1
#=GS Q9DSG7_9REOV/1-173      AC Q9DSG7.1
#=GS H6SWU1_9REOV/1-155      AC H6SWU1.1
#=GS E7CBM4_9REOV/1-173      AC E7CBM4.1
#=GS E7ECR5_9REOV/8-180      AC E7ECR5.1
#=GS C7EWT1_9REOV/1-166      AC C7EWT1.1
#=GS F5AY56_9REOV/8-180      AC F5AY56.1
#=GS N0ABM0_9REOV/1-165      AC N0ABM0.1
#=GS B5KFX5_9REOV/1-173      AC B5KFX5.1
#=GS R4I385_9REOV/1-173      AC R4I385.1
#=GS NSP4_ROTHD/1-173        AC B3SRT2.1
#=GS Q8JXI2_9REOV/1-173      AC Q8JXI2.1
#=GS J7HUM4_9REOV/1-173      AC J7HUM4.1
#=GS G1FVL7_9REOV/1-173      AC G1FVL7.1
#=GS I2CMS0_9REOV/1-173      AC I2CMS0.1
#=GS E7CBP0_9REOV/1-173      AC E7CBP0.1
#=GS H9MZM6_9REOV/1-170      AC H9MZM6.1
#=GS L0C9B4_9REOV/1-173      AC L0C9B4.1
#=GS H9MZN7_9REOV/1-170      AC H9MZN7.1
#=GS E3W588_9REOV/1-173      AC E3W588.1
#=GS B2Z9T7_9REOV/1-124      AC B2Z9T7.1
#=GS G1CDD1_9REOV/1-173      AC G1CDD1.1
#=GS E9KPE3_9REOV/1-172      AC E9KPE3.1
#=GS F5CRE4_9REOV/1-173      AC F5CRE4.1
#=GS H9ZIN2_9REOV/1-173      AC H9ZIN2.1
#=GS B5ATM4_9REOV/1-173      AC B5ATM4.1
#=GS B0ZSY9_9REOV/3-155      AC B0ZSY9.1
#=GS E7ECR9_9REOV/8-180      AC E7ECR9.1
#=GS G9DAQ1_9REOV/1-173      AC G9DAQ1.1
#=GS M1KAX8_9REOV/1-173      AC M1KAX8.1
#=GS B7TAE0_9REOV/1-173      AC B7TAE0.1
#=GS A0A023T4J6_9REOV/1-173  AC A0A023T4J6.1
#=GS F5C6R6_9REOV/1-173      AC F5C6R6.1
#=GS M1PQS5_9REOV/1-138      AC M1PQS5.1
#=GS S5S0T9_9REOV/1-173      AC S5S0T9.1
#=GS A0A024CG54_9REOV/1-173  AC A0A024CG54.1
#=GS P87709_9REOV/1-173      AC P87709.2
#=GS M1JSR5_9REOV/1-173      AC M1JSR5.1
#=GS Q3LRM9_9REOV/1-173      AC Q3LRM9.1
#=GS K0II81_9REOV/1-173      AC K0II81.1
#=GS E7CBG4_9REOV/1-165      AC E7CBG4.1
#=GS I3QD95_9REOV/1-173      AC I3QD95.1
#=GS A0A023UIZ0_9REOV/1-129  AC A0A023UIZ0.1
#=GS E7CBH9_9REOV/1-173      AC E7CBH9.1
#=GS F1JZT9_9REOV/2-167      AC F1JZT9.1
#=GS A9CQ69_9REOV/1-165      AC A9CQ69.1
#=GS A0A023UGM0_9REOV/1-139  AC A0A023UGM0.1
#=GS Q8QY59_9REOV/1-173      AC Q8QY59.1
#=GS P87722_9REOV/1-162      AC P87722.1
#=GS B2Z9T4_9REOV/1-127      AC B2Z9T4.1
#=GS Q4G5Z7_9REOV/1-173      AC Q4G5Z7.1
#=GS Q4G677_9REOV/1-173      AC Q4G677.1
#=GS Q77P48_9REOV/1-173      AC Q77P48.1
#=GS D5J9W1_9REOV/1-173      AC D5J9W1.1
#=GS D7SC33_9REOV/1-133      AC D7SC33.1
#=GS E2J370_9REOV/1-173      AC E2J370.1
#=GS P87716_9REOV/1-162      AC P87716.1
#=GS C1K3I1_9REOV/1-167      AC C1K3I1.1
#=GS F6JTI2_9REOV/1-173      AC F6JTI2.1
#=GS C1K3H6_9REOV/1-167      AC C1K3H6.1
#=GS C1K3J5_9REOV/1-166      AC C1K3J5.1
#=GS A0A024CFR4_9REOV/1-173  AC A0A024CFR4.1
#=GS L7UZX4_9REOV/1-173      AC L7UZX4.1
#=GS Q9IU44_9REOV/1-173      AC Q9IU44.1
#=GS Q9IVG6_9REOV/1-134      AC Q9IVG6.1
#=GS M4ZVL4_9REOV/1-173      AC M4ZVL4.1
#=GS D1GHF6_9REOV/1-173      AC D1GHF6.1
#=GS B6E4V8_9REOV/1-173      AC B6E4V8.1
#=GS E0YLJ1_9REOV/1-173      AC E0YLJ1.1
#=GS E7CBJ4_9REOV/4-176      AC E7CBJ4.1
#=GS Q9PYC9_9REOV/1-173      AC Q9PYC9.1
#=GS G0YWF7_9REOV/1-173      AC G0YWF7.1
#=GS L0CAR1_9REOV/1-173      AC L0CAR1.1
#=GS C1K3K4_9REOV/1-167      AC C1K3K4.1
#=GS B2Z9V7_9REOV/1-127      AC B2Z9V7.1
#=GS E2J322_9REOV/1-173      AC E2J322.1
#=GS E0YLI1_9REOV/1-173      AC E0YLI1.1
#=GS S5S2P5_9REOV/1-173      AC S5S2P5.1
#=GS G1FW19_9REOV/1-173      AC G1FW19.1
#=GS B2BMA6_9REOV/1-173      AC B2BMA6.1
#=GS F5C662_9REOV/1-173      AC F5C662.1
#=GS C7EWT3_9REOV/1-167      AC C7EWT3.1
#=GS A9ZP22_9REOV/1-173      AC A9ZP22.1
#=GS S5S0T4_9REOV/1-173      AC S5S0T4.1
#=GS E2G6L3_9REOV/1-173      AC E2G6L3.1
#=GS F5C4S1_9REOV/1-173      AC F5C4S1.1
#=GS F5C712_9REOV/1-173      AC F5C712.1
#=GS NSP4_ROTRA/1-173        AC Q77Q91.1
#=GS A0A024CFK3_9REOV/1-173  AC A0A024CFK3.1
#=GS Q2XPN6_9REOV/1-173      AC Q2XPN6.1
#=GS E0XH95_9REOV/1-160      AC E0XH95.1
#=GS E7CBL3_9REOV/1-170      AC E7CBL3.1
#=GS Q8QY56_9REOV/1-173      AC Q8QY56.1
#=GS E7CBI7_9REOV/1-173      AC E7CBI7.1
#=GS C1K3I7_9REOV/1-167      AC C1K3I7.1
#=GS G0YWF5_9REOV/1-173      AC G0YWF5.1
#=GS V5LFP9_9REOV/1-173      AC V5LFP9.1
#=GS V9VK07_9REOV/10-182     AC V9VK07.1
#=GS E7CBG2_9REOV/1-171      AC E7CBG2.1
#=GS F5C5K9_9REOV/1-173      AC F5C5K9.1
#=GS C7EWT9_9REOV/1-166      AC C7EWT9.1
#=GS S5RLJ3_9REOV/1-173      AC S5RLJ3.1
#=GS E3W527_9REOV/1-173      AC E3W527.1
#=GS E2J2S6_9REOV/1-173      AC E2J2S6.1
#=GS D3JIR1_9REOV/1-173      AC D3JIR1.1
#=GS A0A024CG50_9REOV/1-173  AC A0A024CG50.1
#=GS C7EWR1_9REOV/1-167      AC C7EWR1.1
#=GS H9MZM4_9REOV/1-170      AC H9MZM4.1
#=GS M5AFF2_9REOV/1-173      AC M5AFF2.1
#=GS M4ZUC3_9REOV/1-173      AC M4ZUC3.1
#=GS R9ZPQ0_9REOV/1-129      AC R9ZPQ0.1
#=GS B0ZSW6_9REOV/2-153      AC B0ZSW6.1
#=GS A0A024CI44_9REOV/1-173  AC A0A024CI44.1
#=GS Q2VC45_9REOV/1-173      AC Q2VC45.1
#=GS C1K3K5_9REOV/1-167      AC C1K3K5.1
#=GS A0FL79_ROTHU/1-173      AC A0FL79.1
#=GS E7CBG1_9REOV/1-170      AC E7CBG1.1
#=GS M1KIS3_9REOV/1-173      AC M1KIS3.1
#=GS E7CBH8_9REOV/1-171      AC E7CBH8.1
#=GS E3W453_9REOV/1-173      AC E3W453.1
#=GS K4N0J0_9REOV/6-178      AC K4N0J0.1
#=GS E9KPD9_9REOV/1-172      AC E9KPD9.1
#=GS F5C5U1_9REOV/1-173      AC F5C5U1.1
#=GS G1DH79_9REOV/1-173      AC G1DH79.1
#=GS C7EWS7_9REOV/5-162      AC C7EWS7.1
#=GS Q4G679_9REOV/1-125      AC Q4G679.1
#=GS H9N1C5_9REOV/1-173      AC H9N1C5.1
#=GS G1FVY2_9REOV/1-173      AC G1FVY2.1
#=GS I3RPT6_9REOV/1-173      AC I3RPT6.1
#=GS M1PD00_9REOV/1-173      AC M1PD00.1
#=GS Q98VJ9_9REOV/2-174      AC Q98VJ9.1
#=GS H9MZN2_9REOV/1-170      AC H9MZN2.1
#=GS B2CQB6_9REOV/1-173      AC B2CQB6.1
#=GS Q4G670_9REOV/1-173      AC Q4G670.1
#=GS M1GTB4_9REOV/1-173      AC M1GTB4.1
#=GS E0YLK1_9REOV/1-173      AC E0YLK1.1
#=GS Q4G676_9REOV/1-173      AC Q4G676.1
#=GS X4XXI1_9REOV/1-173      AC X4XXI1.1
#=GS B7ZGV3_9REOV/1-155      AC B7ZGV3.1
#=GS B7ZGW1_9REOV/1-154      AC B7ZGW1.1
#=GS F5C467_9REOV/1-173      AC F5C467.1
#=GS M1KIY0_9REOV/1-173      AC M1KIY0.1
#=GS F1JZU0_9REOV/2-167      AC F1JZU0.1
#=GS K9ZTF0_9REOV/1-173      AC K9ZTF0.1
#=GS H2DF32_9REOV/1-173      AC H2DF32.1
#=GS F5C4N5_9REOV/1-173      AC F5C4N5.1
#=GS Q6L5X9_9REOV/1-173      AC Q6L5X9.1
#=GS Q2VC34_9REOV/1-173      AC Q2VC34.1
#=GS A8JYK3_9REOV/1-154      AC A8JYK3.1
#=GS P87710_9REOV/1-162      AC P87710.1
#=GS H9MZL4_9REOV/1-170      AC H9MZL4.1
#=GS E9NME5_9REOV/1-171      AC E9NME5.1
#=GS I6ZLR3_9REOV/1-115      AC I6ZLR3.1
#=GS D0UD32_9REOV/1-173      AC D0UD32.1
#=GS A0FJ12_9REOV/1-163      AC A0FJ12.1
#=GS B0ZSZ3_9REOV/4-170      AC B0ZSZ3.1
#=GS R9QVA9_9REOV/1-173      AC R9QVA9.1
#=GS C0J9W5_9REOV/1-173      AC C0J9W5.1
#=GS A4L5S1_9REOV/1-171      AC A4L5S1.1
#=GS E2J346_9REOV/1-173      AC E2J346.1
#=GS I3RPU4_9REOV/1-173      AC I3RPU4.1
#=GS A0A024CFG2_9REOV/1-173  AC A0A024CFG2.1
#=GS B0LWB6_9REOV/1-170      AC B0LWB6.1
#=GS A7VJE9_9REOV/1-173      AC A7VJE9.1
#=GS Q4G660_9REOV/1-173      AC Q4G660.1
#=GS F1JZT8_9REOV/2-167      AC F1JZT8.1
#=GS D5HMU0_9REOV/1-173      AC D5HMU0.1
#=GS F5C5W7_9REOV/1-173      AC F5C5W7.1
#=GS J9QAW7_9REOV/8-180      AC J9QAW7.1
#=GS H9MZQ6_9REOV/1-170      AC H9MZQ6.1
#=GS Q86353_9REOV/1-173      AC Q86353.1
#=GS Q4G638_9REOV/1-173      AC Q4G638.1
#=GS M1KGW3_9REOV/1-173      AC M1KGW3.1
#=GS E2ICT0_9REOV/7-179      AC E2ICT0.1
#=GS M1PYQ7_9REOV/1-173      AC M1PYQ7.1
#=GS A4KAG9_9REOV/1-173      AC A4KAG9.1
#=GS Q006K8_9REOV/1-173      AC Q006K8.1
#=GS K0I7R4_9REOV/1-173      AC K0I7R4.1
#=GS X2FR92_9REOV/1-173      AC X2FR92.1
#=GS U3Q5E8_9REOV/1-173      AC U3Q5E8.1
#=GS U3M047_9REOV/1-173      AC U3M047.1
#=GS D7SC35_9REOV/1-170      AC D7SC35.1
#=GS C7EWS5_9REOV/1-166      AC C7EWS5.1
#=GS X2FQU0_9REOV/1-173      AC X2FQU0.1
#=GS Q1G1T3_9REOV/1-170      AC Q1G1T3.1
#=GS H9MZP6_9REOV/1-170      AC H9MZP6.1
#=GS E7CBM9_9REOV/1-165      AC E7CBM9.1
#=GS D7SC50_9REOV/1-170      AC D7SC50.1
#=GS G3BFZ1_9REOV/1-173      AC G3BFZ1.1
#=GS B0ZSZ0_9REOV/2-154      AC B0ZSZ0.1
#=GS U3GRA7_9REOV/1-173      AC U3GRA7.1
#=GS C1K3J2_9REOV/1-166      AC C1K3J2.1
#=GS Q77M68_9REOV/1-173      AC Q77M68.1
#=GS C3U213_9REOV/14-186     AC C3U213.1
#=GS D1GG75_9REOV/1-173      AC D1GG75.1
#=GS X2G3K7_9REOV/1-173      AC X2G3K7.1
#=GS I3RPT7_9REOV/1-173      AC I3RPT7.1
#=GS D3JPT0_9REOV/1-172      AC D3JPT0.1
#=GS B0LWB2_9REOV/1-172      AC B0LWB2.1
#=GS H9MZL2_9REOV/1-170      AC H9MZL2.1
#=GS E5FPY0_9REOV/1-173      AC E5FPY0.1
#=GS T1RPZ0_9REOV/1-166      AC T1RPZ0.1
#=GS Q9E3V7_9REOV/1-173      AC Q9E3V7.1
#=GS Q9IU43_9REOV/1-173      AC Q9IU43.1
#=GS Q4G635_9REOV/1-173      AC Q4G635.1
#=GS V5W9D2_9REOV/1-173      AC V5W9D2.1
#=GS V5IX13_9REOV/1-173      AC V5IX13.1
#=GS X2G3E4_9REOV/1-173      AC X2G3E4.1
#=GS F5CRF6_9REOV/1-173      AC F5CRF6.1
#=GS Q4G601_9REOV/1-173      AC Q4G601.1
#=GS Q5KR58_9REOV/1-173      AC Q5KR58.1
#=GS Q76SA7_9REOV/1-162      AC Q76SA7.1
#=GS R4I446_9REOV/1-162      AC R4I446.1
#=GS Q98VL4_9REOV/1-173      AC Q98VL4.1
#=GS R4I3P2_9REOV/1-164      AC R4I3P2.1
#=GS O11983_9REOV/1-173      AC O11983.1
#=GS Q4G671_9REOV/1-173      AC Q4G671.1
#=GS R9ZR89_9REOV/1-129      AC R9ZR89.1
#=GS F5CRJ7_9REOV/1-173      AC F5CRJ7.1
#=GS F1JZU2_9REOV/2-167      AC F1JZU2.1
#=GS H9MZP3_9REOV/1-170      AC H9MZP3.1
A0A024CF60_9REOV/1-173             ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRTTNEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
F5C4U5_9REOV/1-173                 ...........................MDKLADLNY...TLRVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
D7SC37_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDSLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
T2CEL3_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLRRIYDRLVIRPTDGVDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
F5C5M0_9REOV/1-173                 ...........................MDKLADLNY...TLRVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDVTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
B2Z9T8_9REOV/1-124                 ...........................---------...------------------.-.-----...--..--------------SIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPGDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
C3U216_9REOV/14-186                ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
B2CQB5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRCQLEMIDKLTTREIEQVELLKRIHDKLVVRPVDAIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
I6YQW8_9REOV/1-157                 ...........................---------...-------MNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQWEMIDKLTTREIEQVELLKRNYDKLVVRTTDEIELAKEINQKNVRGLKEW.ENGKNPYEPKKVTA.....
H9MZM8_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
I6ZV00_9REOV/1-116                 ...........................---------...-------MNSTLHTILED.P.GMAYF...SY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYRIVTIFNTLFKLAGYKEQITTKDEIEKQMDRVVKEMRRQLKMIDKLTTREIEQVELLRRIYD---------------------------.--------------.....
I6YQW0_9REOV/1-157                 ...........................---------...-------MNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQWEMIDKLTTREIEQVELLKRIYDKLVVRTTDEIRFAKGINQKNVEALKEW.GKEKNPLEPKKVTA.....
M1KD72_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
M1NY94_9REOV/14-186                ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
Q99IM3_9REOV/1-173                 ...........................MDKLADLNY...TLSVLTLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q8UZN2_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.IMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVAGSGYKVVRVVVITTFNCVMRLFGSKTEVVSDDRLDALASKIVAQIADQVKVIEQLTKRELEQVKLLADIYEMLKMKK-NEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
S5U4C4_9REOV/1-173                 ...........................MEKLTDLNY...TLNVITLLNSTLHTILED.P.GMAYF...PY..IASVLTVLFALHKASIPTMKIALRTSKCSYKVIKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIRPTDEIDMTKEINQKNVKTLEEW.ENGKNPYESKEVTA.....
B2Z9V1_9REOV/1-127                 ..........................t---------...------------------.-.-----...--..----------LHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEV--.....
NSP4_ROTH6/1-173                   ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLIVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDRLMARSTDGIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
L7T8N6_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSICEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
V9VHT1_9REOV/10-182                ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
Q9QGR7_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTILFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLITRSADVIDMSKEFNQKNIRTLDEW.ENGRNPYEPSEVTA.....
E7CBF4_9REOV/1-170                 ..........................f----TDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
Q80DH6_9REOV/1-133                 ...........................---------...------------------.-.-----...--..-----TVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
X2G5Z7_9REOV/1-173                 ...........................MDKLADLNY...TLSVIALMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
M1HEP8_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMMKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
F5C6P2_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
D7NN64_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLTVLFALHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTGEIDMTKEINQKNVRTLEEW.ESGRNPYEPKEVTA.....
Q4G637_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
L7SV20_9REOV/5-179                 ...........................MAKLTDLNY...TSNVITIVNDTIYSMFVD.S.ELTYF...PWihIASGLSILFALHKVIVPVTKVTLKTSKCSYKIVKYCVITIFNIIMKLAGYKERLTVESEIEKQIDRIMKEMTRQVEMIDKLTTREIEQVELLRNIYNKLMAKSIDDMEIMERTKHKNMEILEMK.KDRESINEMRKVTA.....
G8FNI9_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCYYKVVKYCIVTILNTFLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNVKTLDEW.ENGKNPYEPIEVTA.....
E7CBN1_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
D0UD04_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITKPVDVIDMSKEFNQKNIKTLDEW.ESGRNPYEPSEVTA.....
C0JLV0_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLVVRPIDSVDMTKEINQKNVRTLEEW.ENGKNPYEPKEVTA.....
NSP4_ROTEH/1-173                   ...........................MDKLTDLNY...TLNVITLLNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRHLEMIDKLTTREIEQVELLKRIYDKLMIRATDEIDMTKEINQKNVKTLEEW.ENGKNPYESKEVTA.....
M1H985_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKDQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTNEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
H2FJ35_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASLPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMAQPTDNIDMTKEINQKNVKTLAEW.ENGKNPYEPKEVTA.....
Q4G662_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
C1K3I4_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
D7SC38_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDSLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
S5S0R9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNVKTLDEW.ENGKNPYEPIEVTA.....
R9QUM8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTINMTKEFNQKNIRTLDEW.ENGKNPYEPIEVTA.....
E2J2Y6_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDSVDMMKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
Q9E3V6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLTTRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
A9ZP28_9REOV/1-167                 ...........................------LNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLADYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
S5RGD5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPADIIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
L7NUD3_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGRNPYEPIEVTA.....
A3DSL7_9REOV/1-173                 ...........................MEKLADLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVIKYCIVSVFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLIVKPVNKIDMSQEFNQKHFKTLNEW.AEGENPYESREVTA.....
E7D6L3_ROTHU/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNFKTLDDW.ESGKNPYEPIEVTA.....
E7CBH0_9REOV/1-161                 ...........................---------...---VITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
J7H3F3_9REOV/3-175                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCTVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRTTDEIDMTKEINQKNVRTLKEW.ENGKNPYEPKEVTA.....
E2J3D0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLYSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKCCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
C7EWT0_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKAVTGSGYKVVRVVVITMFNCVMRLFGSKAEMVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
F5C5A0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIITIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
C1K3H4_9REOV/1-166                 .enatsinetfveevynmtlsyfehnv---------...------------------.I.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVTQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
A8C4Y9_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEQNvI.IMKYF...PF..LASILTIMFTAWKMGKSTLKVTTTVAGSGYKVVRVVVITVSNCIMRLFGSKTEIVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKM-TKNDVDMSFETNKKE---YEKW.I--KDPYQPT----ravs.
Q1G1S7_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKCCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
B0ZSX0_9REOV/4-169                 ...........................MENVTTINE...TL-VEEVYNMTLGYFEHNvI.IMKYF...PF..LASILTIIFTAWKMGRSTLKVTKTVAGSGYKVIKVVIVTIFNCVLRMFGSKAEIVPEDKMDIMASKILKQIDEQVKVIEQLTKRELEQVKLLADIYELLKYKNEGSIS--SETNRKA---YETW.--SKDPYQPT----ravs.
F5C478_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
I7E4A5_9REOV/1-173                 ...........................MEQLTDLNN...TSNVITIINDTLHAILDN.T.GTVCF...PY..IAYIFTVLFTLYKASIPAVKIAFKTSKRSYKVIRYCVVSFFNILLKLAGYKERITNKDEIEKQMDRVVEEMKRQLDMINKLTTREMEQVELLKRIHDMLTIKPIGKIDMTQEFNQRHFKTLNEW.TEGENPYESGEVTA.....
S5S0S9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
Q1G1T0_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGCKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
I2E7S0_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFALHKASVPTMKIALKTSKCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLIIKPVDKIDMSQEFNQKHFKTLNEW.AEGENPYEPKKVTA.....
Q9YKF7_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVNVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
U3LZX4_9REOV/1-173                 ...........................MEKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...SY..IASVLTVLFILHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
D0TZ91_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTVINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLAVRPVDAIDMSKEINQKNIRTLDEW.ESGKNPYEPSEVTA.....
A4ZD96_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..VASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
O90367_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMKRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
Q82031_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALTTSKCSYKVVKYCFVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRMYDKLIVRSTDEIDMTKEINQNNVRTLEEW.ESGKNPYEPKEVTA.....
I6ZLQ5_9REOV/1-157                 ...........................---------...-------MNSTLHTILED.P.GMAYF...PY..IASVLTILFTMHKASIPTRKIALKTSKCSYKVVKYCMVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYEKTVVRSTDKIDMTKEINQGNVEALEEW.KSGKNPYKPKNVTA.....
D1GH24_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
A3DSJ2_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNVKTLDEW.ENGKNPYEPIEVTA.....
M1KHF4_9REOV/1-173                 ...........................MDKFADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNVKTLDEW.ESGKNPYKPSEVTA.....
G1DH81_9REOV/1-169                 ..........................a-----DLNY...TLSVITLMNETLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPANIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
T1RQ43_9REOV/1-165                 ........................env----TTINE...TL-VEEVYNITLGYFEHNvI.IMKYF...PF..MASILTILFTAWKMGSSTLKVTKTVAGSGYKVIKIVIITIFNCVLKIFGSKTEIVPEDKMDMMASKILKQIDEQVKVIEQLTKRELEQVKLLADIYELLKYKS--EETVSSGINKKAYDT---W.N--KDPYQP-----travs
B6SAI3_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IAFVLTVLFTLHKASLPTMKIALKTSRCSYKVIKYCIVSIFNTLLKLAGYKEQLTTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDMLITTSVDKIDMTQEFNQKHFKTLNEW.AEGENPYKSREVTA.....
M1H868_9REOV/1-173                 ...........................MEKLTDLNY...TLSLITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLVVRSTDEIDMTKEINQKNVKTLEEW.ESGKNPYEPKEVTA.....
F5C624_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPIDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
K9LHJ1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMINKLTTREIEQVELLRRIYDKLVTRPIDVIDMSKEFNQKNVRTLDEW.ESGKNPYEPSEVTA.....
B6RGK8_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTILED.S.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIRTADEMDMTKEINQKNVRTLKEW.ENGKNPYEPKEVTA.....
G1FWE3_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPVDVIDMSKEFNQKNIKTLDEW.NSGKNPYEPTEVTA.....
G3FJ65_9REOV/1-159                 ...........................---------...-----TLMNSTLYTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
F5B3L5_9REOV/8-180                 ........................iym---LADLNY...TLSVITLMNDTLYSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
A5HAV1_9REOV/1-158                 ...........................---------...------LMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
B2Z9V5_9REOV/1-127                 ..........................t---------...------------------.-.-----...--..----------LHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIELQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEV--.....
E7CBN8_9REOV/1-163                 ...........................---------...-LSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDSLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
D5HMU5_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PH..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
G5CPK5_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIITIFNTLLKLAGYKEQIATKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRTTDEIDMTKEINQKNVRTLKEW.ENGKNPYEPKEVTA.....
E9NME6_9REOV/1-170                 ...........................---LTDLNY...TLSVITLMNDTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEMEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSNSEIDMTKEINQKNVRTLEEW.ESGKNPYEPREVTA.....
H9MZL5_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKNEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
S5RGE0_9REOV/2-174                 ...........................MDKLADLNY...TLSVITLMNETLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPANIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
G1DH76_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.EDGKNPYEPIEVTA.....
B2Z9W8_9REOV/1-127                 ..........................t---------...------------------.-.-----...--..----------LHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEV--.....
T1ULL7_9REOV/9-181                 ...........................LEKLTDLNY...TLSVIXLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHQASIPTMKIALKTSKCSYKVVNYCIVTIFNTLLKLAGYKEQITTKDEIGKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIXMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
I6ZYY8_9REOV/1-157                 ...........................---------...-------MNNTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQWEMIDKLTTREIEQVELLKRNYDKLVVRTTDEIELAKEINQKNVRAQKEW.ENGKNPYEPKKVTA.....
P89062_9REOV/1-173                 ...........................MEKLADLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFILHKASIPTLKIALKTSRCSYKVIKYCIVSVFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMINKLTTREIEQVELLKRIHDMLIIKPVDKIDMSQEFNQKHFKTLNEW.AEGENPYESREVTA.....
H9MZQ3_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q4G650_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLTLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTGEIDMTKEINQKNVRTLEEW.EDGKNPYEPKEVTA.....
E1CJG6_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.T.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRTVDEIDMTKEINQKNVRTLEEW.ENGKNPYEPKEVTA.....
A0A024CEU1_9REOV/1-173             ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKHCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTDEIDMTKEINQKNIRTLEEW.ESGKNPYEPKEVTA.....
Q9ICH0_9REOV/1-173                 ...........................MDKFADLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLITLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEMEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLTRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
Q4G631_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTLKIALKTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVTRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
B0ZSX6_9REOV/5-170                 ...........................MENVTTINE...TL-VEEVYNMTLGYFEHNvI.IMKYF...PF..IASILTIIFTAWKMGRSTLKVTKTVAGSGYKVIKVVIVTIFNCVLRIFGSKAEIVPEDKMDVMASKILKQIDEQVKVIEQLTKRELEQVKLLADIYELLKYKSEGNIS--SETNKKA---YETW.--GKDPYQPT----ravs.
G0YWF1_9REOV/1-165                 ...........................--------Y...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLAARPVDAIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
A0A023UH75_9REOV/1-139             ...........................---------...------------------.-.-----...-Y..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIYDNLIAKPVDVIDMSKEFNQKNINTLDEW.ESGKNPYESSEVTA.....
M1PSI6_9REOV/14-186                ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLVVRSTDEIDMTKEINQKNVKTLEEW.ESGKNPYEPKEVTA.....
E7CBN4_9REOV/1-170                 ..........................f----TDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
M1PDX8_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTILED.S.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIRTADEMDMTKEINQKNVRMLKEW.ENGKNPYEPKEVTA.....
D2D989_9REOV/1-173                 ...........................MDKLADLNS...TLSMITLVNETLYSIIPS.S.GMAYF...PY..IASVLTIIFTLHKASIPTIKIALKTSKCSYKVIKYCIVTIINALLKLAGFKGQVTTNDEIEKQMDRVVKEMQRQLEMIDKLTTREIEQVELLKRIYDKLVAKNVDAIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
F5C5X7_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPIDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q4G668_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTVINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITKPVDVIDMSKEFNQKNIKTLDEW.ESGTNPYEPLEVTA.....
A5H1R7_9REOV/1-158                 ...........................---------...------LMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGCKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRILDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
B2Z9W2_9REOV/1-124                 ...........................---------...------------------.-.-----...--..--------------SIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
F5C758_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLNEW.ENGKNPYEPIEVTA.....
F5B531_9REOV/8-180                 .........................ik--VLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E7CBH6_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEMDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
NSP4_ROTCU/1-173                   ...........................MEKLADLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVIKYCIVSVFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLIAKPVDKIDMSQEFNQKHFKTLNEW.AEGENPYEPREVTA.....
B0ZSX3_9REOV/1-163                 ..vttinetlveevynmtlgyfehnvi---------...------------------.-.IMKYF...PF..LASILTIIFTAWKMGRSTLKVTKTVAGSGYKAVKVVIVTIFNCVLRMFGSKAEIVPEDKMDIMASKILKQIDEQVKVIEQLTKRELEQVKLLADIYELLKYKSEGNIS--SETNRKA---YETW.--SKDPYQPT----ravs.
Q2PGE5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
C3U211_9REOV/14-186                ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.NSGKNPYEPSEVTA.....
Q9WAJ1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQITAKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKSIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.DSGKNPYEPSEVTA.....
B8Y639_9REOV/1-101                 ...........................---------...------------------.-.-----...--..-------------------------------------VTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIRTADEMDMTKEINQKNVRTLEEW.ENGKNPYEPKEVTA.....
Q99IM4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVITYCIVTIINTLLKLAGYQEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
E7CBM1_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCVVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVQSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
D5HMU3_9REOV/1-173                 ...........................MDKLADLNY...TLSVVPLMNDTLHSLIQD.P.GMAYF...PY..IASFLTVLFTLHKASIPTMTIALKTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRPLEMIDKLTTREIEQVELLKRIHDNLITRPVDVKDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
Q1G1S4_9REOV/1-170                 ...........................---LADFNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKCCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKSIHDNLITKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
D0QB82_9REOV/1-173                 ...........................MDKLADLNY...TLSVITSMNDTLHSIIQD.P.GMAYF...LY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
C1K3J8_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITMFNCVMRLFGSKTEMVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
E9KPD8_9REOV/1-173                 ...........................MEKLADLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDMMITKPVDKIDMSQEFNQKHFKTLNEW.AEGENPYESKEVTA.....
E7CBI8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
B7ZGV6_9REOV/1-155                 ...........................-----DLNY...TLSVITLLTDTLRTIVED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSRCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLIIKPVDKIDMSQEINQRQFKTLTEW.--------------v....
I3QDB8_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFMLHKASIPTMKIALKTSKCSYKMVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRTVDEIDMTKEINQKNVRTLEEW.ENGRNPYEPKEVTA.....
B8Y637_9REOV/1-101                 ...........................---------...------------------.-.-----...--..-------------------------------------VTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKETRRQLEMIDKLTTREIEQVELLKRIHDMLIIKPVDKIDMSQEFNQKYFKTLNEW.AEGENPYEPKEVTA.....
E2J358_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
D3JPT1_9REOV/1-172                 ...........................-EKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIRTTDEIDMTKEINQKNVRTLKEW.ENGKNPYEPKEVTA.....
Q4G620_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQENIKTLDEW.ESGKNPYGPLEVTA.....
H6B4E1_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLKEW.ESGKNPYEPKEVTA.....
A9ZQ63_9REOV/1-173                 ...........................MEKFTDLNY...SLSVITLMNSTLHTILQD.P.GMALV...PH..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDELTTREIEQVELLKCIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
E0YLK8_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVIKEMRRQLEMIDKLTTREIEQVELLKCIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
J9QA87_9REOV/10-182                ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSADGIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
E7CBK8_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
E0XH99_9REOV/1-162                 ...........................---------...--SVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLAIRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
B2Z9W6_9REOV/1-124                 ...........................---------...------------------.-.-----...--..--------------SIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
B5ATN1_9REOV/1-167                 ...........................------LNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
F5C747_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
D0UD23_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKLALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIIKPVDVIDMSKEFNQKNIRTLDEW.ESGRNPYEPSEVTA.....
A3DSH0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
E3TPX3_9REOV/1-173                 ...........................MEKLTDLNY...TLGVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLIVQSTGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
M1PE64_9REOV/1-158                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..ITSVLTVLFMLHKASIPTMKIALKTSKCSYKMVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRTVDEIDMTKEINQKNVRTLEE-.--------------.....
A9CQ66_9REOV/1-173                 ...........................MDKLADLNY...TLDQVSFMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
M1KJ38_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ENGKNPYEPSEVTA.....
Q4G643_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTVINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLIPRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
V5IX86_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...SY..IASVLTVLFILHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E0YMX9_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMMRSIGEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
Q80FH6_9REOV/1-147                 ...........................---------...-----------------D.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLSGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRMLEEW.ESGKNPYEPKEVTA.....
E3W4N4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYL...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E7ECR1_9REOV/8-180                 ...........................MDRERTLNY...TLSVITLMNDILHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKNEIEQQMDRIVKVNKRQLDMIDKLTTREIEQVELLKRIHDNLIVKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
H9LH84_9REOV/1-168                 ...........................-----DLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRTTDEIDMTKEINQKNVKTLKEW.ESGKNPYEPKEVTA.....
Q9YIP3_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLTLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTGEIDMTKEINQKNVRTLEEW.EDGKNPYEPKEVTA.....
S5RGJ1_9REOV/14-186                ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
X2FPQ5_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVREMRRQLEIIDKLTTREIEQVELLKRVHDMLIIKPVDKIDMSQEINQKHFKTLNEW.AEGENPYEPKEVTA.....
D7SC41_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDSLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
X2G5Y4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
B7ZGW7_9REOV/1-155                 ...........................-----DLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSRCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDVLIIKPVDKIDMSQEFNQRQFKTLTEW.--------------v....
V5IX09_9REOV/1-173                 ...........................MEKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
G9DDQ3_9REOV/1-165                 ...........................--------Y...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITKPVNVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
D1GH96_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q6PV85_9REOV/1-173                 ...........................MDKLTDLNY...TLSVITLMNSTLHKILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVIKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVREMRRQLEMIDKLTTREIEQVELLRRIYDRLTVQKTDEIDMSKEINQKNVRTLDEW.ENGKNPYEPSEVTA.....
NSP4_ROTRF/1-173                   ...........................MEKLTDLNY...TSSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRAVDEIDMTKEINQKNVRTLEEW.ENGKNPYEPKEVTA.....
Q9WAJ4_9REOV/1-173                 ...........................MDKLADLNY...TLSVIRLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTIREIEQVELLKRIHDNLITKPANALDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
B5ATZ9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRCQLEMIDKLTTREIEQVELLKRIHDKLVVRPVDAIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
B0ZSX2_9REOV/4-169                 ...........................MENVTTINE...TL-VEEVYNMTLGYFEHNvI.IMKYF...PF..LASILTIIFTAWKMGRSTLKATKTVAGSGYKAVKVVIVTIFNCVLRMFGSKAEIVPEDKMDIMASKILKQIDEQVKVIEQLTKRELEQVKLLADIYELLKYKSEGNIS--SETNRKA---YETW.--SKDPYQPT----ravs.
M4ZVB6_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDELIARSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
C7EWU0_9REOV/3-165                 ...tsinetfveevynmtlsyfehnvi---------...------------------.-.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVVTAFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMKKDG-VDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
E7CF24_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIIREMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDDW.ESGKNPYEPTEVTA.....
S5RGK5_9REOV/2-174                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PI..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
E9NIC3_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEMEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
H9MZQ1_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
E7ECQ7_9REOV/8-180                 ...........................MDMLSDLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIVKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
NSP4_ROTYO/1-173                   ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKHCIVTIINTLLKLAGYKEQVTNKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKSIHDNLTTKPVDVIDMSKEFNQKNIKTLDEW.VSGKNPYEPSEVTA.....
E7CBL6_9REOV/1-172                 ...........................-DKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
F8U667_9REOV/1-173                 ...........................MDKLADLNY...TSNVIDLMNSTLHSIIDD.P.GMTYF...PY..IASVLTILFTLHKASVPTMKIALKTSKCSYKVIKYCIVTIFNALLKLAGYKEQISTKDEVEKQMDRIIKEMRRQLEMIEKLTTREVEQVELLKRIYDKLIIQRTDDIDMSKEFNQKNIKSIEEW.EEGRNPYEPSKVAA.....
M1KBS7_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVGVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q006L2_9REOV/1-173                 ...........................MEKLTDLNY...TLSVLTLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVREMRRQLEMIDKLTTREIEQVELLKRVHDMLILKPVDKIDMSQEINQKHFKTLNEW.AEGENPYEPKEVTA.....
S5RLM9_9REOV/2-174                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRAVDEIDMTKEINQKNVRTLEEW.ENGKNPYEPKEVTA.....
S5S2Q5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
S5RGF9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
Q9Z045_9REOV/1-173                 ...........................MEKLADLNY...TLGVITLLNDTLHNILEE.P.GMVYF...PY..IASALTVLFMMHKASLPAMKLAMRTSQCSYRIIKRVVVTLINTLLRLGGYNDYLTDKDETEKQINRVVKELRQQLAMIEKLTTREIEQVELLKRIYDMMVVRQNREIDMSKETNQKAFKTLHDW.GNDRNYDDNTDV--ia...
E2J2P0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVNMTKEFNQKNVKTLDEW.ENGKNPYEPIEVTA.....
T2CEG3_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALQTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLVTRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
B7ZGV0_9REOV/1-154                 ...........................-----DLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASVPTMKIALKTSRCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRPTDEIDMTKEINQKNVKTLEEW.--------------.....
B0ZSY1_9REOV/4-170                 ...........................MENATSINE...TF-VEEVYNMTLSYFEQNvI.IMKYF...PF..LASILTIVFTAWKMGKSTLKVTKTIAGSGYKVVRVVVVTVFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKM-TKNDVDMSFETNKKE---YEKW.I--KDPYQPT----ravs.
K4I4U7_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPMEVTA.....
L0CSA0_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHD.ViIMKYF...PF..LASILTIVFTVWKMGKSTLKVTKTVAGSGYKVVRVVIITLFNCVMRLFGSQTEVVSDDRLDALASKIVTQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMKK-NDVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
X5BZZ2_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINALLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITKPVDVIDMSKEFNQKNIKTLDEW.ESGRNPYEPSEVTA.....
S5IKK5_9REOV/8-180                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIIDMTKEFNQKNVKTLDEW.ENGKNPYEPIEVTA.....
Q9WAJ5_9REOV/1-173                 ...........................MDKLADLNY...TLSVIRLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTICEIEQVELLKRIHDNLITKPANALDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q4G659_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKTVDGIDMSREFNQKNIKTLDDW.ESGKNPYEPSEVTA.....
Q9PYD4_9REOV/1-173                 ...........................MDKLDDLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCIVTIFNTLLKLAGYKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVARSVDVIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
Q8UZ00_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.R.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLIVQSTGEIDMTKEINQKNVKTLEEW.ENGRNPYEPKEVTA.....
A4L5S2_9REOV/1-171                 ...........................--KLTDLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTXHKASLPTMKIALKTSRCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDMLIATSDDKIDMTQEFNQKHFKTLNEW.AEGENPYKPKEVTA.....
G5CPJ9_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHAILED.P.GMAYF...PY..IASVLTILFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRTTDEIDMTKEINQKNVRTLKEW.ENGKNPYEPKEVTA.....
Q1G1U3_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
B5AU00_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIERQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIRTIDEIDMTKEINQKNVKTLKEW.ENGKNPYEPKEVTA.....
H8ZHZ9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTVINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMARPVDVIDMSKEFNQKNVRTLDEW.ESGKNPYEPSEVTA.....
H9MZK8_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPADVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
G9DDQ2_9REOV/1-165                 ...........................--------Y...TLSVITLMNDTLHSIIQD.L.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q9WN93_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPIDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
G3FJ67_9REOV/1-159                 ...........................---------...-----TLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
NSP4_ROTAM/1-173                   ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKCCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDNLIIKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
D2KQT8_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLIVRPTGEIDMTKEINQKNVKTLEEW.ENGRNPYEPKEVTA.....
I2CNG1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIIDMTKEFNQKNVKTLDEW.ENGKNPYEPIEVTA.....
H9MZL0_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKNEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q06DN4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEHVELLKRIHDNLITRPVDIVDMTKEFNQKNVKTLDEW.ENGKNPYEPIEVTA.....
F5B530_9REOV/8-180                 .........................ik--VLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
F6MF72_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASLPTMKIALKTSRCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLIATSVDKIDMTQEFNQKHFKTLDEW.AEGENPYKPKEVTA.....
M4I1Y8_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVREMRRQLEMIDKLTTREIEQVELLKRVHDMLIIKPVDKIDMSQEINQKHFKTLNEW.AEGENPYEPKEVTA.....
X2FPJ5_9REOV/1-173                 ...........................MEKLADLNY...TLGVITLLNDTLHNILEE.P.XMVYF...PY..IVSALTVLFTMHKASLPAMKLAMRTSQCSYRIIKRVVVTLINTLLRLGGYNDYLTDKDETEKQINRVVKELRQQLTMIEKLTTREIEQVELLKRIYDMMIVRHDSEIDMSKETNQKAFKTLHDW.KNDRSYDDNTEVI-a....
X5D183_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTVINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLITRPADVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
G4WMK4_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
B7UFA5_9REOV/15-187                ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTVINTLLKLAGRKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMTRPADVIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
S5RE12_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNETLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPANIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
S5R541_9REOV/1-90                  ...........................---------...------------------.-.-----...--..------------------------------------------------GYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
B8Y8B8_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEMEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTGEIDMTKEINQKNVKTLEEW.ESGKNPYEPREVTA.....
D0UD33_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGCKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
C7EWT5_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
Q9IVG2_9REOV/1-134                 ...........................---------...------------HSIIQD.P.GMAYF...LY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKT----.--------------.....
S5K814_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSICEIDMAKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
R4X5P4_9REOV/1-166                 ...........................-------NY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
X2FTF9_9REOV/1-173                 ...........................MEKLADLNY...TLGVITLLNDTIHNILEE.P.GMVYF...PY..IVSALTVLFTMHKASLPAMKLAMRTSQCSYRIIKRVVVTLINTLLRLGGYNDYLTDKDETEKQINRVVKELRQQLTMIEKLTTREIEQVELLKRIYDMMIVRHDSEIDMSKETNQKAFKTLHDW.KNDRSYDDNAEVI-a....
Q1G1V1_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
Q4G647_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIGISKEFNQKNIKTLDEW.ESGKNPYEPSKVTA.....
X5BXU1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCTVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITKPVDVIDMSKEFNQKNIRTLDEW.ESGRNPYEPSEVTA.....
F1JZU3_9REOV/2-167                 menvstinetlvdevykmtlryfehnv---------...------------------.I.IMKYF...PF..IASILTIIFTAWKMGRSTLKVTKTVAGSRYKVIKVVIVTIFNCVLRIFGSKAEIVPEDKMDVMASIILMQIDEQVKVNEQLRKRELEQVKLLADIYELLKYKTEGNI--CSETNKKG---YETW.--GKDPYQPT----ravs.
B6SAP9_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASLPTMKIALKTSRCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDMLIATSVDKVDMTQEFNQKHFKTLNEW.AEGENPYKPKEVTA.....
C1K3K9_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITMFNCVMRLFGSKTEMVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
V5LF48_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLXSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIERQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPADIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
H9MZN6_9REOV/1-170                 ..........................f----TDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDETDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
E7CBI3_9REOV/1-171                 ...........................--KFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
C3U217_9REOV/14-186                ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
S5RE66_9REOV/2-174                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKCIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
G5CPK1_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTDGVDMTKEINQKNIKTLEEW.ESGKNPYEPKEVTA.....
F5C5I5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDAIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
U3LZX3_9REOV/1-173                 ...........................MEKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
U5S8Z9_9REOV/11-183                ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTILFTLHKASIPTMKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVARPVDAIDMSKEFNQKNIRTLDEW.ENGKNPYEPSEVTA.....
U5XLZ0_9REOV/2-164                 ...tsinetfveevynmtlsyfehnvi---------...------------------.-.IMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVAGSGYKVVRVVVITVFNCVMRLFGSQTEVVSDDRLDALASKIVTQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMKK-NDVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
H6SWU3_9REOV/2-174                 ...........................MEKLTDLNY...TLGVITLMNSTLHTILED.P.GMVYF...PY..IASVLTVLFTLHKASIPTMKIALKTLKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLIVQSTGEIDMTKEINQKNVKTLEEW.ESGRNPYESKEVTA.....
G3FJ66_9REOV/1-159                 ...........................---------...-----TLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
H9MZM5_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q9PYD5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAIF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVVRPVDVIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
V5YW58_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFALHKASIPTMKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEVEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLVTKPVDVIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
G3FJ64_9REOV/1-159                 ...........................---------...-----TLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
Q3LRN7_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMTRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
F5C724_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
M1H3L8_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVQSIGEIDMTKEINQKNVKTLEEW.KSGRNPYEPKEVTA.....
E9KPE2_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLIIKPVDKIDMSQEFNQKHFKTLNEW.AEGENPYEPKEVTA.....
V9VK10_9REOV/10-182                ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIQSIGEIDMTKEINQKNVKTLEEW.KSGRNPYEPKEVTA.....
S5S2S0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTVINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMINKLTTREIEQVELLRRIYDKLVTRPIDVIDMSKEFNQKNVRTLDEW.ESGKNPYEPSEVTA.....
E7CBJ3_9REOV/1-172                 ...........................-DKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEPGELLNPIHDNLITNPLDVIDMTKEFNQKNIETLDEW.ESGKNPYEPKEVTA.....
E2J2G8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMVYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
F5C4P7_9REOV/1-173                 ...........................MDKLADLNY...TLRVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
C7EWR7_9REOV/1-166                 .enatsinetfveevynmtlsyfehnv---------...------------------.I.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITMFNCVMRLFGSKTEMVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
Q9E165_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLETIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
H9MZP4_9REOV/1-170                 ..........................f----TDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTVLNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDETDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
F5AY54_9REOV/8-180                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYS...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGCKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDILITRPVDVIDMTKEFNHKNIKTLDEW.ESGKNPYEPIEVTA.....
A9ZP32_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCTVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLITRPVDVLDMSKEFNQKNIKTLDEW.KSGKHPYEPSEVTA.....
A0A024CET7_9REOV/1-173             ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVIKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKKVTA.....
Q9DSG5_9REOV/1-173                 ...........................MDELADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
B8XQX1_9REOV/1-173                 ...........................MEKLTDLNY...TLGVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFMLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRAADEIDMTKEINQKNVKTLEEW.ENGKNPYEPKEVTA.....
E0YLI8_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVIKEMRRQLGMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
H9MZN3_9REOV/1-170                 ..........................f----TDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PC..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTVLNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDETDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
A8HI53_9REOV/1-109                 ...........................---------...------------------.-.GIAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIERQMDRVVKEMRRQLEMIDRLTTREIEQVELLKRIYDKLMV-----------------------.--------------r....
B2Z9T1_9REOV/1-126                 ...........................---------...------------------.-.-----...--..----------LHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQFTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLIIRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEV--.....
A8HI54_9REOV/1-161                 ...........................-----DLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVVKYCIVTILNTLLKLAGYKEQVTTKDEIEKQMDRVIKEMRRQLEMIDKLTTREIEQVELLKRIHDRLMVRPTDEIDMTKEINQKNVKTLEEW.ESGKNPY-------.....
A5X363_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIRD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVARPVDAIDMSKEFNQKNIRTLDEW.ESGKNPYEPLEVTA.....
G9DDP8_9REOV/1-165                 ...........................--------Y...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
C7SYE9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDKLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
S5S0Q8_9REOV/2-174                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPADIVDMTKEFNQKNIKTLDEW.ESGKNPYEPTEVTA.....
F5C4Y1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
E7CBP1_9REOV/2-174                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
G3FJ63_9REOV/1-159                 ...........................---------...-----TLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
A5X361_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVREMRRQLEMIDKLTTREIEQVELLKRIHDKLASRPVDAIDMSKEFNQKNIRTLDEW.ENGKNPYEPSEVTA.....
D7F7N3_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...TY..IASVLTVLFTLHKASIPAMKIALKTSKCSYKVIKYCIVTIINTLLKLAGCKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKCIYDNLITRPVNVIDMSKEFNQKNIKTLDEW.ESVKNPYEPSEVTA.....
H9MZP0_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
F5B545_9REOV/8-180                 .........................ik--VLADLNY...TLSVITLMNDTLNSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
F6LP39_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEMEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLVVQSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
E7CBH3_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
A5HV78_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMITVINTLLKLAGHKEQVTTKDEIEQQMNRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLITRPVDVIDMSKEFNQKNVRTLDEW.ESGKNPYEPSEVTA.....
C5IXN9_9REOV/1-173                 ...........................MEKLTDLNY...TSSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRAVDEIDMTKEINQKNVRTLEEW.ENGKNPYEPKEVTA.....
A5X362_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVREMRRQLEMIDKLTTREIEQVELLKRIHDKLVSRPVDAIDMSKEFNQKNIRTLDEW.ENGKNPYEPSEVTA.....
F5C5R8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDSVDMMKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
Q1WEV2_ROTHU/1-95                  ...........................---------...------------------.-.-----...--..-------------------------------------------LLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLEEW.ENGKNPYEPIEVTA.....
B7SY75_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
K9ZS46_9REOV/1-169                 ........................tlp-------HY...KLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIRTADEIDMTKEINQKNVRTLKEW.ENGKNPYEPKEVTA.....
E0YLJ4_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVIKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
C7EWU2_9REOV/2-164                 ...tsinetfveevynmtlsyfehnvi---------...------------------.-.VMKYF...PF..LASILTIVFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
NSP4_ROTHS/1-173                   ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITAKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTGEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
B7ZGW2_9REOV/1-155                 ...........................-----DLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSRCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLIIKPVDKIDMSQEFNQRQFKTLTEW.--------------v....
D3JPT5_9REOV/1-145                 ...........................-EKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLTLRPTGEIDMTK-------------.--------------.....
Q4G623_9REOV/1-173                 ...........................MDKLADLNY...TLNVIPLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
Q9YKF9_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILDD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNIRTLEEW.ESGKNPYEPKEVTA.....
Q2XPN7_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GIAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVVKYCIVIIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRPTDEIDMTKEINQKNVKTLEEW.ESGKNPYEPKEVTA.....
J9QFX2_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKDQITTKDEIEKQMDRVVKEMRRQLEMIDRLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
F5C6A8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPIDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q4G656_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q4G632_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVARPVDAIDMSKEFNQMNIRTLDEW.VNGKNPYEPSEVTA.....
Q86224_9REOV/1-173                 ...........................MEKLTDLNY...TLSVVTLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASVPTMKIALKTSKCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIERQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLIIKPVDKIDMSQEFNQKYFKTLNDW.AEGENPYEPKEVTA.....
C1K3K8_9REOV/1-166                 .enatsinetfveevynmtlsyfehnv---------...------------------.I.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITMFNCVMRLFGSKTEMVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
J9QFX3_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDSLITRPVDVIDMTEEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
E7CBL8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
Q9YJC5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
S4U7T2_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSRCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDVLIIKPVDKIDMSQEFNQRQFKTLTEW.VEGENPYEPKEVTA.....
F5C5N3_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPIDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
B0ZSY6_9REOV/5-171                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIIFTAWKMGKSTLKVTKTVAGSGYKVVRVVVITMFNCVMRLLGSKTEVVSDDRLDALSSKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMKK-NDIDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
NSP4_ROTAD/1-173                   ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q1WEH9_ROTHU/1-105                 ...........................---------...------------------.-.-----...--..---------------------------------KYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIQFDLGAKNFDGMLMTKEINQKNVKTLEEW.ESGKNPYEPREVTA.....
Q2VC38_9REOV/1-171                 ...........................--KLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIVKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
M1KDE1_9REOV/1-173                 ...........................MDKLVDLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPVDVIDMTKEFNQKNIKTLDEW.ENGKNPYEPAEVTA.....
Q4G615_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q9DSG9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSNEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
F5C642_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPIDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
F5B2E9_9REOV/8-180                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGCKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
M1HD14_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESEKNPYEPKEVTA.....
G9DDQ1_9REOV/1-165                 ...........................--------Y...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IVSVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVNVIDMTKEFNQKNIKTLDEW.ESGKNPYEPTEVTA.....
Q9WAJ0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..VASVLTVLFTLHKASIPTMKIALKTSRCSYKVIKYCTVTIINTLLKLAGYQEQITAKDEIEQQMDRIVKEMRRQLEMIDKLTIREIEQVELLKSIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.DSGKNPYEPSEVTA.....
D3HU64_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLVVRSTDEIDMTKEINQKNVKTLEEW.ESGKNPYEPKEVTA.....
V9VH02_9REOV/10-182                ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDGIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
P87711_9REOV/1-162                 ...........................--------Y...TLSVITLMNDTLHSIIQN.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPIDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLE---.....
Q1G1T2_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDSLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
Q4G622_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
X2FTK8_9REOV/1-173                 ...........................MEKLADLNY...TLGVITLLNDTLHNILEE.P.GMVYF...PY..IVSALTVLFTMHKASLPAMKLAMRTSQCSYRIIKRVVVTLINTLLRLGGYNDYLTDEDETEKQINRVVKELRQQLTMIEKLTTREIEQVELLKRIYDMMIVRHDSEIDMSKETNQKAFKTLHDW.KNDRSYDDNTEVI-a....
C7EWT6_9REOV/1-166                 .enatsinetfveevynmtlsyfehnv---------...------------------.I.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
C4PBK6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYREQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVTRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
D1GHC0_9REOV/1-173                 ...........................MDKLAGLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKCCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLIIKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
D1GGR6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GIAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKHCMVTIINTLLKLAGYKEQVTNKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKSIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ENGKNPYESSEVTA.....
A9ZQ64_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHPILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKCIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
F5C4W7_9REOV/1-173                 ...........................MDKLADLNY...TLRVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
Q9PYB1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVTRPVDAIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
J9SQG1_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVSIFNTLFKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLIIKPVDKIDMSHEFNQKHFKTLNEW.AEGENPYEPKEVTA.....
A4ZD83_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITAKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVQSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
F4YUX9_9REOV/1-156                 ...........................---------...--------NSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
E7CBG6_9REOV/1-172                 ...........................-DKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
Q2VC35_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTVINTLLKLAGYKEQVTTKEEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLITRPADVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
A0A023NBL9_9REOV/1-173             ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPIMKIALKTSKCSYKVIKCCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDNLIIKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
Q599S3_9REOV/1-170                 ...........................---LTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMRIALKTSRCSYKVIKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVREMRRQLEMIDKLTTREIEQVELLRRIYDRLTVQKTDEIDMSKEINQKNIRTLDEW.ENGKNPYEPSEVTA.....
E7ECS7_9REOV/8-180                 .........................ik--VLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNVKTLDEW.ESGKNPYEPSEVTA.....
E7CBG5_9REOV/1-171                 ...........................--KLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGCKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
E0YLH9_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKDQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
G1FVM4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPADVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
A0A024CFM1_9REOV/1-173             ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDELIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
J9VAC1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...SY..IAFVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
L7NUH2_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.EDGKNPYEPVEVTA.....
E7ECR3_9REOV/8-180                 .........................ik--VLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
NSP4_ROTH5/1-173                   ...........................MEKLTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLIVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLTLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTGEIDMRKEINQKNVRTLEEW.ENGKNPYEPKEVTA.....
I3RPU6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIITIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
Q4G633_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKHCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDRLTTREIEQVELLKRIHDKLVTRPVDVIDMSKGFNQKNIKTLDEW.ESGKNPYEPSGVTA.....
A0A023NBM3_9REOV/1-173             ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTIINTLLKLAGYKEHVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLAVRPVDAIDMSKEINQKNIRTLDEW.ESGKNPYEPSEVTA.....
C7EWS3_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITMFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMKK-NEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
NSP4_ROTME/1-173                   ...........................MEKLADLNY...TLGVITLLNDTLHNILEE.P.GMVYF...PY..VASALTVLFTMHKASLPAMKLAMRTSQCSYRIIKRVVVTLINTLLRLGGYNDYLTDKDETEKQINRVVKELRQQLTMIEKLTTREIEQVELLKRIYDMMVVRHDREIDMSKETNQKAFNTLHDW.GNDRNYDDNTDV--ia...
H9MZM0_9REOV/1-170                 ...........................---LADLNY...TLSVITLLNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDILVTRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
H2DF33_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYRVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDRLVTQPTDGIDMTKEINQKNVKTLEEW.ESGKNPYEPKEVTA.....
M1PCZ1_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTVLED.S.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYRVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIRTADEMDMTKEINQKNVRTLKEW.ENGKNPYEPKEVTA.....
NSP4_ROT41/1-173                   ...........................MDKLTDLNY...TLSVITLMNSTLHKILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVIKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVREMRRQLEMIDKLTTREIEQVELLRRIYDRLTVQKTDEIDMSKEINQKNVRTLDEW.ENGKNPYEPSEVTA.....
Q4G5Z9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
D1GHI0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
U5XJA3_9REOV/2-164                 ...tsinetfveevynmtlsyfehnvi---------...------------------.-.IMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVAGSGYKVVRVVVITVFNCVMRLFGSQTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMKK-NDVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
C7EWR4_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKMTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
Q4G630_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
M5AFE5_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IAFVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKKVTA.....
A4L5S0_9REOV/1-145                 ...........................---------...------------------.-.GLAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDMMITKPVDKIDMSQEFNQRHFKTLNEW.AEGENPYESKEVTA.....
A9ZP38_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEMEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
D0UD27_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLMTKPVDVIDMSKEFNQKNIRTLDEW.ESGRNPYEPSEVTA.....
B2CQC0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRCQLEMIDKLTTREIEQVELLKRIHDKLVVRPVDAIDMSKEFNQKNIRTLDEW.ESGENPYEPSEVTA.....
D5HMU9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEKQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNVKTLDEW.ENGKNPYEPIEVTA.....
B2CQB7_9REOV/1-173                 ...........................MDKRCDLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRCQLEMIDKLTTREIEQVELLKRIHDKLVVRPVDAIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
R4I3K7_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSTGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
Q2VC43_9REOV/1-169                 ..........................a-----DLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
C7EWS6_9REOV/1-166                 .enatsinetfveevynmtlsyfehnv---------...------------------.I.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITMFNCVMRLFGSKTEMVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
E7CBG9_9REOV/1-134                 ...........................---------...------------------.-.-----...--..----LTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRMSDKLIVRSTDEIDMTKEINQKNVRTLEEW.EIGKNPYEPKEVTA.....
B2BMD9_9REOV/1-173                 ...........................MEKLTDLNY...TLNVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLRRIHDKMMVRPTDEIDMTKEINQKNVKTLEEW.ENGKNPYEPKEVTA.....
A9ZQ52_9REOV/1-173                 ...........................MEKLADLYY...TMNVITLMNDTLHTIIED.P.GMAYF...PY..IASVLTVLLTLHEASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRPLEMIDRLTTREIEQVELLKRIHDMLIIKPIEKIDMSEEFNQKLFKTLDEW.ADGENPYEPKEVTA.....
Q4G606_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTILFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
F5C614_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPIDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
D5J9X2_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCTVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMINKLTTREIEQVELLRRIYDKLVTRPIDVIDMSKEFNQKNVRTLDEW.ESGKNPYEPSEVTA.....
Q4G657_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDRLTTREIEQVELLKRIHDKLVTRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
K4I2L1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASALTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
C1K3H8_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVTQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
Q2VC31_9REOV/1-168                 ...........................-----DLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
I1SST2_9REOV/1-151                 ..........................s---------...--------------IIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
U3M0M7_9REOV/1-173                 ...........................MEKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
D1GGI2_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
F6MF83_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASLPTMKIALKTSRCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLMATSVDKIDMTREFNQKHFKTLNEW.EEGGNPYKSKEVTA.....
A8C4Z0_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEQNvI.IMKYF...PF..LASILTIVFTAWKMGKSTLKVTKTVAGSGYKVVRVVVITVFNCIMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKM-TKNDVDMSFETNKKE---YEKW.I--KDPYQPT----ravs.
V5QQG6_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRPIDGVDMTKEINQKNVRTLEEW.ENGKNPYEPKEVTA.....
M1KJA0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPVDVIDMTKEFNQKNIKTLDEW.ENGKNPYEPAEVTA.....
F5C4I7_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
Q9PYD9_9REOV/1-173                 ...........................MDKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSSCSYKVIKYCLVTIFNTLPKLAGYKEQITTKREIEKQMDRVIREMRRQLEMIDKLTTREIEQVELLRRIYDKLTVRKTDEIGMLKEINQKNIRTLDEW.ENGKNPYEPSKVTA.....
V5LFG4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEXERQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPADXVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
E2J394_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q4G605_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
C0JLT9_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLVVRPIDGVDMTKEINQKNVRTLEEW.ENGKNPYEPKEVTA.....
A2T3P6_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLTVLFALHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVQTTGEIDMTKEINQKNVRTLEEW.ESGKNPYEPREVTA.....
S5JLF4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNKKNIKTLDEW.ESGKNPYEPIEVTA.....
C1K3I6_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVTQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
B0ZSZ2_9REOV/4-170                 ...........................MENATSINE...TF-VEEVYNMTLSYFEQNvI.IMKYF...PF..LASILTIVFTAWKMGKSTLKVTKTVAGSGYKVVRVVVITVFNCIMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKM-TKNDVDMSFETNKKE---YEKW.I--KDPYQPT----ravs.
Q4G655_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLTLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTGEIDMTKEINQKNVRTLEEW.EDGKNPYEPKEVTA.....
X2FPG2_9REOV/1-173                 ...........................MEKLADLNY...TLGVITLLNDTIHNILEE.P.GMVYF...PY..IVSALTVLFTMHKASLPAMKLAMRTSQCSYRIIKRVVVTLINTLLRLGGYNDYLTDKDETEKQINRVVKELRQQLTMIEKLTTREIEQVELLKRIYDMMIVRHDSEIDMSKETNQKAFKTLHDW.KNDRSYDDNTEVI-a....
Q9YJ03_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q2VC37_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIITIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIVKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
M1NY97_9REOV/14-186                ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
F5C4D9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKMIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRSIDVIDMSKEFNQKTIKTLDEW.ESGKNPYEPSEVTA.....
C7EWS8_9REOV/1-166                 .enatsinetfveevynmtlsyfehnv---------...------------------.I.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITMFNCVMRLFGSKTEMVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
Q99IB0_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFMLHKASIPTMKIALKTSKCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLIIKPVDKIDMSQELNQKHFKTLNEW.AEGENPYEPKEVTA.....
S5I776_9REOV/8-180                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
Q9WAI6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GIAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKDCIVTIINTLLKLAGYQEQVTTTDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPANALDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
M4ZUB1_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLTVLFALHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
E7CBG8_9REOV/4-176                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIIKTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
E2J2V0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLRLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
H9MZM3_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
D7SC46_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
F5C517_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNVKTLDEW.ENGKNPYEPIEVTA.....
Q4G646_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLYSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q80DH7_9REOV/1-120                 ...........................---------...-----------------D.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTK-------------.--------------.....
H9MZL7_9REOV/1-170                 ..........................f----TDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTVLNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDETDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
M1KHA7_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
D1GHM8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
D1GGW4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
V5IX10_9REOV/1-173                 ...........................MEKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
G1DH77_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.EDGKNPYEPIEVTA.....
F5B544_9REOV/8-180                 ...........................MDKLADLNY...TLNVITLMNDTLNSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIVKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
D7NN68_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFMLHKASIPTMKIALKTSKCSYKMVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRTVDEIDMTKEINQKNVRTLEEW.ENGRNPYEPKEVTA.....
F8SPX3_9REOV/1-173                 ...........................MEKLADLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDMMITKPVDKIDMSQEFNQKHFKTLNEW.AEGENPYESKEVTA.....
D0E2W7_9REOV/1-171                 ...........................--KLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVARPVDAIDMSKEFNQKNIRTLDEW.ENGKNPYEPSEVTA.....
F1JZU4_9REOV/2-167                 menvstinetlvdevykmtlryfehnv---------...------------------.I.IMKYF...PF..IASILTIIFTAWKMGRSTLKVTKTVAGSRYKVIKVVIVTIFNCVLRIFGSKAEIVPEDKMDVMASIILMQIDEQVKVNEQLRKRELEQVKLLADIYELLKYKTEGNI--CSETNKKG---YETW.--GKDPYQPT----ravs.
S5RGF3_9REOV/2-174                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
Q9QPN0_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNPLLKLAGSKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLPPREIEQVELLKRIYDKLMIRTADEIDMTKEINQKNVRTLKEW.ENGKNPYEPKEVTA.....
X2FP65_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGCKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDNLMTRPVDIIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
E7ECS6_9REOV/8-180                 .........................ik--VLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E7D6L5_ROTHU/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
E0YN00_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKCCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVIKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYKPKEVTA.....
Q4G648_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
W0G3V4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTLKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVTRPADVIDMSKEFNQKNIRTLDEW.ENGKNPYEPSEVTA.....
E3W5A0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...SY..ITSVLTXXFIXHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
S5RE29_9REOV/2-174                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
M5AFE8_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYRVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDRLVTQPTDGVDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
S5JLF7_9REOV/1-165                 ...........................--------Y...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
Q4G636_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVEVLKRILDKLVVRPVDAIDMSKEFNQENLGTLGNR.ENGENPYGPSEVTA.....
D4P8E9_9REOV/1-170                 ...........................---LTDLNY...TLSVITLMNSTLHTILED.P.GMAFF...PS..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRPTDELDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
G1DH74_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMINKLTTREIEQVELLKRIHDNLITRPADIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
L0N427_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASALTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTGEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
O92323_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLTVLFALHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVQTTGEIDMTKEINQKNVRTLEEW.ESGKNPYEPREVTA.....
#=GR O92323_9REOV/1-173      SS    ...........................XXXXXXXXX...XXXXXXXXXXXXXXXXXX.X.XXXXX...XX..XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHXXXXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXXXXXX.....
I1YZL1_ROTHU/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQE.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTVINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDRLTTREIEQVELLKRIHDKLMTRPVDVIDMSKEFNQKNIRTLDEW.ESGQNPYESSEVTA.....
S4S3F9_9REOV/1-173                 ...........................MEKLTDLNY...TLGVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVSFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLIVQSTGEIDMTKEINQKNVKTLEEW.ESGRNPYESKEVTA.....
E7CBK3_9REOV/1-172                 ...........................-EKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
E7CBP3_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
D5HMU6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVAIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLIARPTDVIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
Q2PZB9_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLRKASIPTMKIALKTSRCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLIIKPVDKIDMSQEFNQKHFKTLNEW.AEGENPYEPKEVTA.....
G9G704_9REOV/1-162                 ...........................---------...--SVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSADGIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
B7ZGV9_9REOV/1-154                 ...........................-----DLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTLKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVTRPADVIDMSKEFNQKNIRTLDEW.--------------.....
K4IDQ4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDGIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDSVDVTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
A5X358_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTVINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLAVRSVDAIDMSKEINQKNIRTLDEW.ESGKNPYEPSEVTA.....
D3JTU1_9REOV/14-186                ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVVKYCIVTILNTLLKLAGYKEQVTTKDEIEKQMDRVIKEMRRQLEMIDKLTTREIEQVELLKRIHDRLMVRPTDEIDMTKEINQKNVKTLEEW.ESGKNPYKPKEVTA.....
M1H8C5_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIERQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVQSTGEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
D1GG03_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTTINTLLNLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPTEVTA.....
A3DSI1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLTGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNVKTLDEW.ENGKNPYEPIEVTA.....
B2Z9U6_9REOV/1-127                 ..........................t---------...------------------.-.-----...--..----------LHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEV--.....
D7SC42_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDSLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
B0ZSY8_9REOV/4-170                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIVFTAWKMGKSTLKVTKTVAGSGYKVVRVVIITMFNCVMRLLGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMKK-NDIDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
A9ZQ49_9REOV/7-160                 ...........................MEKFDVQDC...VLIAIPSVNATLHSDVSD.P.GRFPL...PL..VASGLADWISFPYASCPMVNLVYKTSQCSYKVVLYCTITIVYTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPADTLYMTKESNRKNI------.--------------i....
F5C6S7_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPTDTIDMTKEFNQKNVKTLDEW.ENGKNPYEPIEVTA.....
A9ZP25_9REOV/1-173                 ...........................MDKLADLNY...TLCVISLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVPLTLLKASIPTMYLAWKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIIDMTKEFNQKNLKTLDEW.ENGKNPYEPIEVTA.....
Q9PYD7_9REOV/1-173                 ...........................MDKLTDLNY...TLSVITLMNSTLHAILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVIKYCIVTIFNTLLKLAGYKEQITTKDEIERQMDRVVREMRRQLEMIDKLTTREIEQVELLRRIYDRLTVRKTDEIDMSKEINQKNIRTLDEW.ENGKNPYEPSEVTA.....
D1GG27_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKCCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLIIKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
Q98VN3_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...TY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPFDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q4G642_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRINDTLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
F5C4M3_9REOV/1-173                 ...........................MDKLADLNY...TLRVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
D1GH72_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q1G1T6_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
C7EWR3_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNITLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
H9MZL6_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
C9WLT2_9REOV/1-158                 ...........................---------...------LMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGCKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRSVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
B7TAF1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDSVDMMKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
E7CBN9_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
Q9WAA5_9REOV/1-173                 ...........................MEKFTDLNY...TLGVITLMNSTLHTILED.P.GMAYL...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKCCIVTIFNTLLKLAGYKEQITTKDEIEKQMDEFVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLIVQSTGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
F5B546_9REOV/8-180                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKMIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMKRQLEMIDKLTTREIEQVELLKRIHDNLITRSVDIIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
B7ZGV7_9REOV/1-154                 ...........................-----DLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRPTDEIDMTKEINQKNVKTLEEW.--------------.....
E5FPY2_9REOV/1-173                 ...........................MEKXTDLNY...TLSVIILMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
H6VLI3_9REOV/1-173                 ...........................MEKLTDLNY...TLNVITIMNDTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEMEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTGEIDMTKEINQKNVRTLEEW.ESGKNPYEPREVTA.....
F5C4L1_9REOV/1-173                 ...........................MDKLADLNY...TLRVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
I0B177_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTILED.P.GMAYF...PY..IASVLTILFTLHKASIPTMKIALKTSNCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEMEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKHIYDKLMVRSNSEIDMTKEINQKNVRTLEEW.ESGKNPYEPREVTA.....
F5B3L6_9REOV/8-180                 .........................ik--VLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
C7EWR2_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
H9N192_9REOV/1-173                 ...........................MEKLTDLNY...TSTVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRAVDEIDMTKEINQKNVRTLEEW.ENGKNPYEPKEVTA.....
E2J2T8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINALLRLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
D3JTU2_9REOV/14-186                ...........................MEKLTDLNY...TLSVITLMNSTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIERQMDRVVKEMRRQLEMIDRLTTREIEQVELLKRIYDKLMVRSTDEIDMTKEINQKNVKTLEEW.ENGRNPYEPKEVTA.....
J9QLB5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLEEW.ENGKNPYEPIEVTA.....
M9Q2S4_ROTHU/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCLVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQIDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q6GWF6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPAMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
E7CBF8_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
B6E4V9_9REOV/1-173                 ...........................MDKLADLNY...ALSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPIMNIAYRTSKCSYKVIKYCIVTIINTLLNLAGYKEQVTTKDEIEQQMDRIVKEMRCHLEMIDKLTTREIEQVELLKRIQDKLVVRPVDAIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
C0JLW1_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDRLVVQPIDDVDMTKEINQKNIRTLEEW.ENGKNPYEPKEVTA.....
Q9IV22_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMSYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEMEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLVVQSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
Q9WAJ3_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..VASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTTINNLLKLAGYKEQVITKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKKFKTLDEW.ESGKNPYEPKEVTA.....
NSP4_ROTPY/1-173                   ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFALHKASIPTMKIALKTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQPRMIDKLTTREIEQVELLKRIHDKLVTRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
H9MZP2_9REOV/1-170                 ..........................f----TDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTVLNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDETDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
M1KAU9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNMITRSVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
F5C4V7_9REOV/1-173                 ...........................MDKLADLNY...TLRVITLMNDTLYSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
H6VLH2_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLTGYREQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRPTDEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
C7EWS9_9REOV/1-166                 .enatsinetfveevynmtlsyfehnv---------...------------------.I.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITMFNCVMRLFGSKTEVVSDDRLDALASKIVTQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMKK-NEVGMSFETNKKE---YEKW.M--KDPYQPT----ravs.
Q1G1U5_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
F5C4T3_9REOV/1-173                 ...........................MDKLADLNY...TLRVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
F5C6E6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
D5HMV0_9REOV/1-173                 ...........................MDKLADLCY...TLCEITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
Q808S7_9REOV/1-137                 ...........................---------...------------------.-.-----...--..-ASVVTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTTLNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
E7CBG3_9REOV/1-171                 ...........................--KLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGCKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKYPYEPIEVTA.....
E9KPE1_9REOV/1-172                 ...........................-EKLTDLNY...TLSVITLMNDTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYGEQITTKDEMEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSNSEIDMTKEINQKNVRTLEEW.ESGKNPYEPREVTA.....
Q4G5Z8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E3W4Z2_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
D7SC43_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDSLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
F4YUY7_9REOV/1-172                 ...........................-DKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
G4WMH1_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
E7CBJ7_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
A9ZP33_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITFMNSTLHTILED.P.GTAYC...VH..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYREQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTGEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
C1K3J9_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
Q9QGR6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCTVTIINTLLKSAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLITRSADVIDMSKEFNQKNIRTLDEW.ENGRNPYEPSEVTA.....
E3W405_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLRLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
A0A024CFV6_9REOV/1-173             ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRSVDTMDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
D2D988_9REOV/1-173                 ...........................MDKLADLNS...TLSMITLVNETLYSIIPS.S.GMAYF...PY..IASVLTIIFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINALLKLAGFKGQVTTNDEIEKQMDRVVKEMQRQLEMIDKLTTREIEQVELLKRIYDKLVAKNVDAIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
P87719_9REOV/1-162                 ...........................--------Y...TWSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLE---.....
A0A024CG14_9REOV/1-173             ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYGIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
A0A023UIG9_9REOV/1-139             ...........................---------...------------------.-.-----...-Y..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKDQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
C7EWS0_9REOV/1-166                 .enatsinetfveevynmtlsyfehnv---------...------------------.I.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITMFNCVMRLFGSKAEMVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
I3RPT4_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDRLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
S5RGI7_9REOV/2-174                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEMEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
E5L0B9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTVINTLLKLAGYKEQVTTKDEIEQQMNRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVTRSVDVIDMSKEFNQKNVRTLDEW.ESGKNPYEPSEVTA.....
D1GGF8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q5KR60_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
D5G325_9REOV/1-173                 ...........................MEKLADLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVIKYCIVSVFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLIVKPVNKIDMSQEFNQKHFKTLNEW.AEGENPYESREVTA.....
D4P8E8_9REOV/1-169                 ...........................----TDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVVRTTDEIDMTKEINQKNVKTLEEW.ENGRNPYEPKEVTA.....
W0G3U9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQE.P.GMAYF...PY..IASVLTVLFTLHKASIPTLKIALRTSKCSYKVIKYCMVTVINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDRLTTREIEQVELLKRIYDKLITRPADVIDMSKEFNQKNVRTLDEW.ENGKNPYEPSEVTA.....
A9CQ68_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKAIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
E7CBM2_9REOV/1-171                 ...........................--KLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
G0YWE8_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVVRPIDAIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
B7ZGW6_9REOV/1-155                 ...........................-----DLNY...TLSVITLLNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSRCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLIIKPVDKIDMSQEFNQRQFKTLTEW.--------------v....
NSP4_ROTBB/1-173                   ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMERVVKEMRRHFKMIDKLTTREIEQVGLLKRIHDKLDIRAVDEIDMTKEINQKNVRTLEEW.EWGKNPYEPKEVTA.....
S5S2T6_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
Q4G602_9REOV/1-173                 ...........................MDKLADLNY...TLSVTTLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKGFNQENIKTVDEW.ESGKNPYGPSEVTA.....
C7EWR0_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
H9MZM7_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQIDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
NSP4_ROTF6/1-173                   ...........................MEKLTDLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASLPTMKIALKTSRCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDMLIATSVDKIDTTQEFNQKHFKTLNEW.AEGENPYKPREVTA.....
D3JPT6_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRTTDEIDMTKEINQKNVRTLKEW.ENGKNPYEPKEVTA.....
M1PLT5_9REOV/14-186                ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTVLNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDETDMTKEINQKNVRTLXEW.ESGKNPYEPKEVTA.....
Q719L4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLAARPVDAIDMSKEFNQKNIRTLDEW.ENGKNPYEPSEVTA.....
G0YZK8_9REOV/1-173                 ...........................MEKLTDLNY...TLSVVTLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFALHKASVPTMKIALKTSKCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIERQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLIIKPVDKIDMSQEFNQKYFKTLNDW.AEGENPYEPKEVTA.....
K4I0B1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHNNLITRPVDSVDVTKEFNQKNIKTLDEW.ESGKNPYEPIEVIA.....
D1GH84_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
T1RQF3_9REOV/1-166                 ...........................MENVTTINE...TL-VEEVYNITLGYFEHNvI.IMKYF...PF..LASILTILFTVWKMGSSTLKVTKTVAGSGYKVIKVVIVTIFNCILKIFGSKTEIVPEDKMDIMASKILKQIDEQVKVIEQLTKRELEQVKLLADIYELLKYKSEGTIP--SGINKKAYDT---W.N--KDPYQP-----travs
I1E4B1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIITIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNMITRSIDVIDMSQEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q2PGE4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPMEVTA.....
D1GG99_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKCCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLIIKPVDVIDMSKEFNQKNIKTLDEW.ENGKNPYEPLEVTA.....
D1GH12_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
M1HD12_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLRLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
Q77P43_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
K9L5A9_9REOV/1-173                 ...........................MEKLADLNY...TLGVITLLNDTLHNILEE.P.GMVYF...PY..IVSALTVLFTMHKASLPAMKLAMRTSQCSYRIIKRVVVTLINTLLRLGGYNDYLTDKDETEKQINRVVKELRQQLTMIEKLTTREIEQVELLKRIYDMMIVRHDSEIDMSKETNQKAFKTLHDW.KNDRSYDDNTEVI-a....
E7ECT0_9REOV/8-180                 .........................ik--VLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIVKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
D1GGP2_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKHCMVTIINTLLKLAGYKEQVTNKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKSIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ENGKNPYESSEVTA.....
Q9IVG0_9REOV/1-134                 ...........................---------...------------HSIIQD.P.GMAYF...LY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKT----.--------------.....
B8Y640_9REOV/1-101                 ...........................---------...------------------.-.-----...--..-------------------------------------VTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIRTADEMDMTKEINQKNVRTLKEW.ENGKNPYEPKEVTA.....
Q0PCH1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNETLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQEDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPADIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
B2Z9U1_9REOV/1-127                 ..........................t---------...------------------.-.-----...--..----------LHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEV--.....
Q4G651_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLTLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTGEIDMTKEINQKNVRTLEEW.EDGKNPYEPKEVTA.....
G9DDQ0_9REOV/1-165                 ...........................--------Y...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNVKTLDEW.ENGKNPYEPIEVTA.....
D1GGB1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKHCMVTIINTLLKLAGYKEQVTNKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKSIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ENGKNPYESSEVTA.....
E7CBN3_9REOV/1-170                 ..........................f----TDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
Q9PX23_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPVEVTA.....
R4I3L4_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCLVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVQSTGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
Q1G1U2_9REOV/1-170                 ...........................---LTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIMLSIGEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
A0A023UGL4_9REOV/1-139             ...........................---------...------------------.-.-----...-Y..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEINQKNIKTLDEW.ESGKNPYEPIEVTA.....
A0SXM4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIERQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPADIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
E7ECR0_9REOV/8-180                 .........................ik--VLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQFTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
F5B3L8_9REOV/8-180                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKMIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
H9MZL1_9REOV/1-170                 ..........................f----TDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIATVLNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDETDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
E0YLJ3_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRPTDKIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
Q3LRN5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMTRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
C7EWU1_9REOV/1-166                 .enatsinetfveevynmtlsyfehnv---------...------------------.I.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
C7EWS4_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMRYF...PF..LASILTIVFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITAFNCVMRLFGSKTEMVSDDRLDALASKIVTQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMKK-NDVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
A3EZQ9_9REOV/1-167                 ...........................------LNY...TLSVITFMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMINKLTTREIEQVELLRRIYDKLVTRPIDVIDMSKEFNQKNVRTLDEW.ESGKNPYEPSEVTA.....
S5I773_9REOV/7-179                 ...........................MDKLADLNY...TMNVITLMNDTLHTIIED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDRLTTREIEQVELLKRIHDMLIIKPIEKIDMSKEFNQKQFKTLDEW.TDGENPYKPKEVTA.....
V5IX03_9REOV/1-173                 ...........................MEKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASVPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
F5C5D7_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLVTRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
X4YPG6_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPAMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKDQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
B0ZSY2_9REOV/4-170                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITMFNCVMRLFGSKTEVISDDRLDALASKIVTQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMKK-NEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
A7VJD6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPANALDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
F5C6C1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDSVDVTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
A3DSF9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNETLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPADIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
W0G0H1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTLKIALRTSKCSYKVIKYCMVTVINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVTRPADVIDMSKEFNQKNIRTLDEW.ENGKNPYEPSEVTA.....
L7Z3B6_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
NSP4_ROTH2/1-173                   ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHRASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQFEMIDKLTTREIEQVELLKRIYDKLMVRATDGIDMTKEINQKNVKTLEEW.KSGKNPYEPKEVTA.....
E7ECT9_9REOV/6-180                 ........................gii----KDLNYiidTLSVITLMNDALHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
K7QGX9_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDRLMVRPIDEIDMTKEINQKNIKTIEEW.GNGKNPYEPKEVTA.....
L8AXT4_9REOV/1-173                 ...........................MEKLTDLNY...TSSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRAVDEIDMTKEINQKNVRTLEEW.ENGKNPYEPKEVTA.....
J7GXY2_9REOV/14-186                ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIRTADEIDMTKEINQKNVRTLKEW.ENGKNPYEPKEVTA.....
Q2PGE6_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVQSAGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
A9ZP42_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIRYCIVTIVNALLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLQMIDKLTTREIEQVELLTRIHVNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
X4YPA5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKITTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
C7EWS1_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
I3RPU3_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDRLTTREIEQVELLKRIHDNLIIRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
M1NQP5_9REOV/1-132                 ...........................MEKLTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLTVLFALHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYD---------------------------.--------------.....
T2CE70_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYRVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKHIYDRLVTQPTDGVDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
A0A024CDB7_9REOV/1-173             ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKTSIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLRRIYDRLVIRPTDGVDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
Q9DSH0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ENGKNPYEPAEVTA.....
H9MZL3_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
B2Z9V8_9REOV/1-127                 ..........................t---------...------------------.-.-----...--..----------LHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEV--.....
L8AX65_9REOV/1-173                 ...........................MEKLTDLNY...TSTVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNALLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRAVDEIDMTKEINQKNVRTLEEW.ENGKNPYEPKEVTA.....
F5C6D4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPIDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E7CBJ1_9REOV/1-171                 ...........................--KFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
E2J3B8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
H6B4F2_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLKEW.ESGKNPYEPKEVTA.....
I6ZLQ9_9REOV/1-157                 ...........................---------...-------MNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTIKIALKTSKCSYKVVKYCIVTIFNTLFKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRNYDKLVVRTTDEIEVAKGINQKNVRALKEW.ENGKNPYEPKKVTA.....
D3G8F2_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCTVTIINTLLKLAGYKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIYDKLITRPVDVLDMSKEFNQKNIKTLDEW.KSGKNPYEPSEVTA.....
I6Z1B8_9REOV/1-157                 ...........................---------...-------MNNTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKTMVRPTDEIDMTKEINQKNVKTLKEW.ESGKNPYEPKEVTA.....
G1FW91_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQVDRMVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
F5B3L7_9REOV/8-180                 .........................ik--VLADLNY...TLSVITLMNDPLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
F5C648_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKMALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
M1PE32_9REOV/1-144                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDRLTTREIEQVELLKRIHDNLITRPVDTIDM---------------.--------------.....
B2Z9V2_9REOV/1-127                 ..........................t---------...------------------.-.-----...--..----------LHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEV--.....
Q82032_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
Q06DN3_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVFFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
W8Q983_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSRCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLVIKPVDKVDMSQEFNQIQFKTLTEW.VEGENPYEPKEVTA.....
F5C771_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIITIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTTDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
M9V587_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAFF...PP..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
E7CF33_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPVDVIDMSKEFNQKNIKTLDEW.NSGKNPYEPTEVTA.....
W0G546_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTVINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDRLVTRPVDVIDMSKEFNQKNVRTLDEW.ESGKNPYESSEVTA.....
B6E4X0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRCQLEMIDKLTTREIEQVELIKRIHDKLVVRPVDAIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
T2CES3_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIITIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
NSP4_ROTH7/1-173                   ...........................MEKLTVLNY...TLNVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHRASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLADYKEQITTKDEIEKQMDRVAKEMRRQLEMIDKLTTREIEQVKLLKRIYDKLMVRATDGIDMTKEINQKNVKTLEEW.KSGKNPYEPKEVTA.....
C1K3I9_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITMFNCVMRLFGSKTEMVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
X2FPY2_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKAEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPADIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
A9CQ71_9REOV/1-173                 ...........................MEKLTDLNY...TLGVITLMNSTLHTILED.P.GIAYF...PY..IASVLTVLFTLHKASIPTMKTALKTSKCSYKVVKYWIETIYNTLLKLARYHEQITTKDEIEKHMDRVVKEMRRRLQMIDQLTTREIEQVELLRRVHDKLIVQSTGEIDMTKEINLKSVKTLEEC.QSGRNPYEPKEVTA.....
D2K889_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKIIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDKLAARSVDAIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
X2FUS2_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGCKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDNLMTRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
Q5KR59_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
S5S0W0_9REOV/14-186                ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKCIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
U3MGV6_9REOV/9-181                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIFNTLMKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLRRIHDKLIVQSTGGIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
Q4G641_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
NSP4_ROTBU/1-173                   ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IVSVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRTVDEIDMTKEINQKNVRTLEEW.ENGRNPYEPKEVTA.....
G1FW70_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPVDVIDMSKEFNQKNIKTLDEW.NSGKNPYEPTEVTA.....
M1PQJ5_9REOV/1-166                 ...........................-------NY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLTVLFALHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTGEIDMTKEINQKNVRTLEEW.ESGRNPYEPKEVTA.....
T1UL23_9REOV/9-181                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMLTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMKRQLEMIDKLTTREIEQVELLKRIHDKLMTRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
G9DDQ7_9REOV/1-165                 ...........................--------Y...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IVSVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVNVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
R9T9Z5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKHCIVTIINTLLKLAGYKEHVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
G1DH75_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPADVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
F5C734_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
Q1G1V2_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKMAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLIIRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
U5S8Z1_9REOV/11-183                ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVARPVDAIDMSKEFNQKNIRTLDEW.ENGKNPYEPSEVTA.....
S5IKL1_9REOV/1-130                 ...........................---------...------------------.-.-----...--..--------FTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMINKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
Q1L7K9_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTILED.P.GMAYF...PY..IASVLTILFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEHITTKDEMEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSNSEIDMTKEINQKNVRTLEEW.ESGKNPYEPREVTA.....
Q9PYC1_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDVIETQMDRVVKEMRRQLEMIDKLTTREIEQVELLKCIYDKLMVRTADEIDMTKEINQKNVRTLKEW.ENGKNPYEPKEVTA.....
#=GR Q9PYC1_9REOV/1-173      SS    ...........................XXXXXXXXX...XXXXXXXXXXXXXXXXXX.X.XXXXX...XX..XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-HHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHT-XXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXXXXXX.....
Q8AYX9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
E0XH86_9REOV/9-181                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPADIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
M1H7G0_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSNDEIDMTKEINQKNVRTLEEW.EIGKNPYEPKEVTA.....
Q1G1T9_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
C1K3H9_9REOV/1-166                 .enatsinetfveevynmtlsyfehnv---------...------------------.I.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVTQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
C4PBK7_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..VASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
D5G327_9REOV/1-173                 ...........................MEKLADLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVIKYCIVSVFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLIVKPVNKIDMSQEFNQKHFKTLNEW.AEGENPYESREVTA.....
Q2VC32_9REOV/1-173                 ...........................MDKLANLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIIKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
G3FJ69_9REOV/1-159                 ...........................---------...-----TLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIDQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
M4Q5A0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTTINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIVKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q4G653_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLTLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTGEIDMTKEINQKNVRTLEEW.EDGKNPYEPKEVTA.....
G8H3U8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRSVDVIDMSKEFNQKNIKTLDEW.ESGKNPYESSEVTA.....
S5RLJ6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
Q6QT01_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVVQSTGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
I6ZLR7_9REOV/1-157                 ...........................---------...-------MNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKTVVRSTDEVDMTKEINQKNVKTLEEW.ESGKNPYEPTEVTA.....
C7EWR6_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVTQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
S5RE05_9REOV/2-174                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPADIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
G9DDQ9_9REOV/1-165                 ...........................--------Y...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IVSVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITKPVNVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
D7SC39_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDSLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
V9VK12_9REOV/10-182                ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDGIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
Q19A90_9REOV/1-173                 ...........................MDKLADLHN...TLSMITLVNDTLHSIIPN.S.GMAYF...PY..IASVLTIIFTLHKASIPTMKIALKTSKCSYKVIKYCVVTIINALLKLAGFKGQVTTNDEIEKQMDRVVKEMQRQLEMIDKLTTREIEQVELLKRIYDKLMVKNVDAIDMSKEFNQKNVRTLDEW.ENGRNPYEPSEVTA.....
E7CBI0_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
A9ZP35_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNSTLHTILED.P.GTAYC...HH..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYREQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTGEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
A9CQ81_9REOV/1-158                 ...........................---------...------LMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
G9DDQ4_9REOV/1-165                 ...........................--------Y...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
I2CN77_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLIIRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
Q1G1U4_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
Q8B4J1_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIITILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
S5S2S3_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEMEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
X4YLH5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKYEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
K9LHJ8_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMYSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSIGEIDMTKEINQKNVRTLEEW.ESGRNPYEPKEVTA.....
F5C5C5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLVTRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q9WAJ8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GIAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTVVNILLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLVTRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
D1GGQ4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKCCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLRRIHDNLIIKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
Q9W8B5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIEKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q9DSG8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E2J2L6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDAIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
Q9YKF8_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLTLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTSEIDMTKEINQKNVRTLEEW.EDGKNPYEPKEVTA.....
I6ZV05_9REOV/1-115                 ...........................---------...-------MNSTLHTILED.P.GMAYF...PY..IASVLTILFTLHKASIPTMKMALKTSKCSYKVVKYCIVTIFNTLVKLAGYKEQITTKDEIEKQMDRVVKEMRRQLKMIDKLTTREIEQVELLKRIY----------------------------.--------------.....
S5S0U5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPADVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
D1GHG8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKHCMVTIINTLLKLAGYKEQVTNKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKSIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ENGKNPYESSEVTA.....
X2FR49_9REOV/1-173                 ...........................MEKLADLNY...TLGVITLLNDTLHNILEE.P.GMVYF...PY..IASALTVLFTMHKASLPAMKLAMRTSQCSYRIIKRVVVTLINTLLRLGGYNDYLTDKDETEKQINRVVKELRQQLTMIEKLTTREIEQVELLKRIYDMMIVRHDSEIDMSKETNQKAFKTLHDW.KNDRSYDDNTEVI-a....
Q9YKF5_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
E0XH89_9REOV/1-167                 ..........................p-------HY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIRTADEIDMTKEINQKNVRTLKEW.ENGKNPYEPKEVTA.....
H9MZP9_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
A5X360_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTVINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLADRPIDVIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
S5RMT5_9REOV/1-124                 ...........................---------...------------------.-.-----...--..--------------SIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
K4IDQ2_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLNMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
NSP4_ROTHL/1-173                   ...........................MEKLTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKIAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVQSTGEIDMTKEINQKNVKTLGEW.ESGRNPYEPKEVTA.....
E7CBM7_9REOV/1-172                 ...........................-DKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
E7CF42_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPVDVIDMSKEFNQKNIKTLDEW.NSGKNPYEPTEVTA.....
M4VRW1_9REOV/1-168                 ...........................-----DLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKCCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTDGIDMTKEINQKNIRTLEEW.ESGKNPYEPKEVTA.....
NSP4_ROTW3/1-173                   ...........................MDKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNALLKLAGYKEQITTKDEIEKQTDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRAVDEIDMTKEINQKNVKTLEEW.ENGKNPYEPKEVTA.....
X2FPN5_9REOV/1-173                 ...........................MEKLADLNY...TLGVITLLNDTLHNILEE.P.GXVYF...PY..IASALTVLFTMHKASLPAMKLAMRTSQCSYRIIKRVVVTLINTLLRLGGYNDYLTDKDETEKQINRVVKELRQQLTMIEKLTTREIEQVELLKRIYDMMIVRHDSEIDMSKETNQKAFKTLHDW.KNDRSYDDNTEVI-a....
T1RQ47_9REOV/1-166                 ...........................MENVTTINE...TL-VEEVYNITLGYFEHNvI.IMKYF...PF..LASILTILFTAWKMGSSTLKVTKTVAGSGYKVIKVVIVTIFNCILKIFGSKTEIVPEDKMDIMASKILKQIDEQVKVIEQLTKRELEQVKLLADIYELLKYKSEGTIP--SGINKKAYDT---W.N--KDPYQP-----travs
F6JTH8_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVIIFNTLLKLAGYEEQITNKDEIEKQIDRVVKEMRRQLEMIDKLTTREIEQVELLRRIYDKLLVQPIDGVDMTKEINQKNIRTLEEW.ENGKNPYEPKEVTA.....
Q71MF0_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTGEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
D1GGX6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
G0YY27_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLTVLFALHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTGEIDMTKEINQKNVRTLEEW.ESGRNPYEPKEVTA.....
Q4G628_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVNVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
A9ZP30_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCTVTIINTLLKLAGYKEQVTTKDEMGPQMEFVVKELRRQPELMDELTTREIEQVESLKRIYDTSITRPVDVIDMSKEFNQNNIKTLDEW.ESGKNPYEPSEETA.....
B7ZGV5_9REOV/1-154                 ...........................-----DLNY...TLSVITLMNDTLHSIIQE.P.GMAYF...PS..LASVLTVLFTLHKASIPTLKIALRTSKCSYKVIKYCMVTVINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDRLTTREIEQVELLKRIYDKLITRPADVIDMSKEFNQKNVRTLDEW.--------------.....
H9MZM9_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E7ECT3_9REOV/8-180                 .........................ik--VLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
I2CNB4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTILFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPADTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
Q98VJ5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q8B4J3_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKRSYKVIKYCIVTIVNTLLKLAGYKEQVTTKVEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
X4XXA8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPTEVTA.....
A0A024CE09_9REOV/1-173             ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYESIEVTA.....
B2BMF0_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRPTDEIDMTKEINQKNVKTLEEW.ENGKNPYEPKEVTA.....
C4MQ11_ROTHU/1-173                 ...........................MDMLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKGEIEQQMDRIVKEMKRQLEMIDKLTTREIEQVELLKCIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPSEPSEVTA.....
A9ZQ57_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSILQD.P.GMVFL...PP..IASVLTVLFTLHKASIPTMKIALQTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDGLTTREIEQVELLKRIHDNLITRPVDIIDMTKEWSQCDHKTLDEW.ESGKNPYEPIEVTA.....
C1K3I8_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
Q9WAJ2_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQITAEDEIEQQMDRIVKEMRRPLEMIDKLTTREIEQVELLKSIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.DSGKNPYEPSEVTA.....
Q80AQ0_9REOV/1-173                 ...........................MDKLTDLNY...TLSVITLMNSTLHAILED.P.GMAYF...PY..IASVLTVLFTLHKASLPTIKIALKTSKCSYKVIKYCIVTVFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLRRIYDKLTVQKTDEIDMSKEINQKNTLTLHEW.ENGKNPYEPSEVTA.....
R4I379_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCLVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVQSTGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
A0A024CDK6_9REOV/1-173             ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTILFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNILLKLAGYKEQITTKDEMEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLVVQSTDEIDMTKEINQKNVRTLEEW.ESGRNPYEPKEVTA.....
NSP4_ROTSH/1-173                   ...........................MEKLTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLTVLFALHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVQTTGEIDMTKEINQKNVRTLEEW.ESGKNPYEPREVTA.....
S5S2N6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPADIIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
C3U215_9REOV/14-186                ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E7ECS2_9REOV/8-180                 .........................ik--VLADLNY...RWSVITLMNDTLHSIIQD.P.GMAYF...PS..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDES.ERGKNPYEPSEVTA.....
I0B176_9REOV/1-170                 ...........................---LTDLNY...TLSVITLMNDTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSNCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEMEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKHIYDKLMVRSNIEIDMTKEINQKNVRTLEEW.ESGKNPYEPREVTA.....
D5HMU4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSNKVIKYCMLTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMKRQLEMIDKLTTREIEQVELLKRIHDKLMTRTVDVIDMSKEFNQKNIKPLDEW.ESRKNPYEPSEVT-p....
L0L0Y2_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNMITRSVDVIDMSQEFNQKNIKTLDEW.ESRKNPYEPSEVTA.....
A5HAV0_9REOV/1-158                 ...........................---------...------LMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E7CBI4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKELNQKNIKTLDEW.ESGKNPYEPIEVTA.....
M1GT65_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTVKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
Q4G616_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKTVDVIDMSKEFNQENIKTLDEW.ESGKNPYEPSEVTA.....
F5AXY5_9REOV/8-180                 .........................ik--VLADLNY...TLSVITLMNDTEDSIIQD.P.GMAYF...PY..MASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPADVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
M9Q2R8_ROTHU/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
C1K3H3_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
NSP4_ROTA1/1-167                   ...........................MENATTINE...TL-VEEVYNMTMSYFEHNvI.IMKYF...PF..LASILTIAFTAWKMGKSTFKVTKTVAGSGFKVVRVIVITIFNCIMRLFGSKTEIVSDDRLDALASKILAQINNQVKVIEQLTKRELEQVKLLADIYEMLKFK-KDEVDMSFETNKKE---YEKW.--VKDPYQPT----ravs.
Q8B4J5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTINMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
M9Q2Q2_ROTHU/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
D5J9V6_9REOV/1-137                 ...........................---------...------------------.-.-----...--..-ASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
A0A024CDV4_9REOV/1-173             ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKCCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVNIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
I6ZUZ6_9REOV/1-157                 ...........................---------...-------MNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYVKTVVRSTDEVDMTKEINQKNVKTLEEW.ESGKNPYEPKEVTA.....
I3RPT9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDRLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
S5S0S4_9REOV/2-174                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
D1GHD2_9REOV/1-173                 ...........................MDKLAGLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKCCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLIIKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
F5C5Y9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
F6LP50_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKCIYDKLVIRPTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
I6ZYZ3_9REOV/1-132                 ...........................---------...-------MNSTLHTILED.P.GMAYF...PY..IASVLTILFTLHKASIPTMKMALKTSKCSYKVVKYCIVTIFNTLFKLAGYKEQITTKDEIEKQMDRVVKEMRRQLKMIDKLTTREIEQVELLKRIYEKLRMRTADERYTTK-------------.--------------yt...
E2J2D2_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRSVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q9DSH1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVNALDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
I6YQX3_9REOV/1-157                 ...........................---------...-------MNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLFKLAGYKEQITTKDEIEKQMDRVVKEMRRQWEMIDKLTTREIEQVELLKRNYDKLVVRTTDEIELAKEINQKNVRAQKEW.ENGKNPYEPKKVTA.....
E7CBH5_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
Q98VN4_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLIIKPVDKIDMSQELNQKHFKTLNEW.AEGENPYEPKEVTA.....
F1JZU1_9REOV/2-167                 ......................menvc-----TINV...TL-VDEVYKMTLRYFEHNvI.IMKYF...PF..IASILTIIFTAWKMGRSTLKVTKTVGGSRYKVIKVVIVTIFNCVLRIFGSKAEIVPEDKMDVMASIILMHIDEQVKVNEQLRKRELEQVKLLADIYELLKYKTEGNI--CSETNKKG---YETW.--GLDPYQP-----travt
X4YNG0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGCKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
W0G4X6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTLKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLITRPADVIDMSKEFNQKNIRTLDEW.ENGKNPYEPSEVTA.....
I2CMM7_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDISKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
A0A024CD73_9REOV/1-173             ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GIAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRSVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
D9D7M1_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLIVQSTGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
M1KHT9_9REOV/1-173                 ...........................MDKFADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
B8Y638_9REOV/1-101                 ...........................---------...------------------.-.-----...--..-------------------------------------VTILNTLLKLAGYKEQITAKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTGEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
E7CBI5_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSTIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
B2ZPL1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLYKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
A4ZD73_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCLVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLIVQATGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
G0YWE6_9REOV/1-166                 ...........................-------NY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVVRPIDAIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
E7CBF0_9REOV/1-171                 ...........................--KLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
F5C5P4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
E5E7S3_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNALLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRAADEIDMTKEINQKNVKTLEEW.ENGKNPYEPKEVTA.....
E7CBF3_9REOV/1-170                 ..........................f----TDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
Q9DSG4_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLTLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTGEIDMTKEINQKNVRTLEEW.EDGKNPYELKEVTA.....
A0A024CEA0_9REOV/1-173             ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLRLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIVKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E7CBL4_9REOV/1-171                 ...........................--KLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
H9MZQ2_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
U3M0G2_9REOV/1-173                 ...........................MEKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPIDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
C1K3H2_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
B2Z9W0_9REOV/1-127                 ..........................t---------...------------------.-.-----...--..----------LHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEV--.....
M4I1I2_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSRCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLIIKPVDKIDMSQEFNQRQFRTLNEW.AEGENPYEPKEVTA.....
A0A024CGE6_9REOV/1-173             ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
U5XJC7_9REOV/2-164                 ...tsinetfveevynmtlsyfehnvi---------...------------------.-.IMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVAGSGYKVVRVVVITVFNCVMRLFGSQTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMKK-NDVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
B0LWB5_9REOV/3-175                 ...........................MDKLADLNY...TLSVIALMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTLKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLITRPVDVIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
Q4G612_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GIAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
F8UF72_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLTVLFALHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKGEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVQTTGEIDMTKEINQKNVRTLEEW.ESGKNPYEPREVTA.....
Q9WAI5_9REOV/1-173                 ...........................MEKFTDLNN...TLSVLTLMNSTLHTILED.P.GMAYL...PY..IASVLTVWFTSHKASIPTMKIALKTSKCSYKVVEYCIVTILNTSLKLAGYKERITTKDELEQQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTGEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
A9CQ78_9REOV/1-173                 ...........................MDKLADLNY...TSSVITLVNTPLHSIIPE.P.GMAYF...PY..IASDLTVLFTLHKASLPTMKIALKSSKCSYKVIMYCIVTIIHPLLKLAGYKEQVTPKDEIEQQMDRIVKEMRRQLEMIDKLTTCEIEQVELKKRIHDNLITRPVAIVDMRKEFNQKNIKTLDSW.ENGKNPYEPIEVTA.....
H2DF31_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNVKTLDEW.ENGKNPYEPIEVTA.....
Q2N3R9_9REOV/1-173                 ...........................MDKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYREQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVRSTDEIDMTKEINQKNVRTLKEW.ESGKNPYEPKEVTA.....
D1GG51_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKHCMVTIINTLLKLAGYKEQVTNKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKSIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ENGKNPYESSEVTA.....
NSP4_ROT18/1-173                   ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IAYVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDRLTTREIEQVELLKRIHDKLVMQSTGEIDMTKEINQKNMKTLEEW.ESGRNPYEPKEVTA.....
Q9WAJ9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GIAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLVTRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
A5X365_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIRSIGEIDMTKEINQKNVKTLEEW.ESGKNPYEPKEVTA.....
G9DDQ8_9REOV/1-165                 ...........................--------Y...TLSVITLMNDTLHSIIQD.L.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E3W441_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIITIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E2J2Q2_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDSLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
F5B2E8_9REOV/8-180                 .........................ik--VLADLNY...TLSVITLMNDTLLSIIQD.P.GMAYF...PY..GASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
P87720_9REOV/1-162                 ...........................--------Y...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKCCIITIINTLLKLAGYKEQINTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKSVDVIDMSKEFNQKNIKTLDEW.ESGNNPYEPLE---.....
M1PYH0_9REOV/14-186                ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIMRSIGEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
D1GHQ2_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDNLVTRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
F5C674_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDSVDVTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
E3W4M0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITKPVDVIDMSKEFNQKNIRTLDEW.ESGRNPYEPSEVTA.....
V9VHT5_9REOV/10-182                ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
C7EWT4_9REOV/1-166                 .enatsinetfveevynmtlsyfehnv---------...------------------.I.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITMFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMKK-NEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
Q4G664_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCVVTIINTLLKLAGYKEQVTTKDGIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
E3W580_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIKD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLRLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIVKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q9DSH2_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPVNALDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
F5C4B5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
F5B2F0_9REOV/8-180                 .........................ik--VLADLNY...TLSVITLMNDTLESIIQD.P.GMAYF...PY..NASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
D0UD06_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTVLNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
Q1WEV3_ROTHU/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
I6Z1C1_9REOV/1-136                 ...........................---------...-------MNSTLHTILED.P.GMAYF...PY..IASVLTILFTLHKASIPTMKMALKTSKCSYKVVKYCIVTIFNTLFKLAGYKEQITTKDEIEKQMDRVVKEMRRQLKMIDKLTTREIEQVELLKRIYEKLTIRSTDKKYTTKYTNK---------.--------------et...
C7EWS2_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIVFTAWKMGKSTLKVTKTITGSGYKVVRVVVITAFNCVMRLFGSKTEMVSDDRLDALASKIVTQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMKK-NDIDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
F5C6K5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E7CBN2_9REOV/1-147                 ...........................---------...-----------------D.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
E7ECT1_9REOV/8-180                 .........................ik--VLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
B0ZSY0_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIVFTAWKMGKSTLKVTKTVAGSGYKVVRVVVITMFNCVMRLLGSKTEMVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMKK-NDIDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
E7CBN7_9REOV/1-150                 ...........................---------...--------------IIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
Q1G1T8_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
F4YUY6_9REOV/1-156                 ...........................---------...--------NDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPIDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
G3FJ71_9REOV/1-159                 ...........................---------...-----TLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLVVRSTDEIDMTKEINQKNVKTLEEW.ESGKNPYEPKEVTA.....
X2FWQ0_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVSIFNILLKLAGYKEQITTKDEIEKQMDRVVREMRRQLEIIDKLTTREIEQVELLKRVHDMLIIKPVDKIDMSQEINQKHFKTLNEW.AEGENPYEPKEVTA.....
Q2VC30_9REOV/1-168                 ...........................-----DLNY...TLSVITLMNSTLHKILEV.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDRLMVRPTDEIDMTKEINQKNVKTLEEW.ESGKNPYEPKEVTA.....
B2WWU9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
T2DPM5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMTRPADIIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q9WAJ6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTIREIEQVELLKRIHDNLITKPANALDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
NSP4_ROTHP/1-173                   ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRSVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E9NIB4_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVQSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
G3FJ62_9REOV/1-159                 ...........................---------...-----TLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
E2J272_ROTHU/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDRLTTREIEQVELLKRIHDNLITRPVDTMDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
E7CBL5_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
A0A024CFE4_9REOV/1-173             ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPAMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREVEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
S5GGA0_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYESKEVTA.....
M1PZ10_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTILED.S.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIRTADEMDMTKEINQKNVRTLEEW.ENGKNPYEPKEVTA.....
V5M0F0_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLVIKSVDKIDMSQEFNQKHFKTLNEW.AEGENPYEPKEVTA.....
Q2N3S3_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYREQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVRSTDEIDMTKEINQKNVRTLKEW.ESGKNPYEPKEVTA.....
A9ZP29_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCTVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLITRPVDVLDMSKEFNQKNIKTLDEW.KSGKNPYEPSEVTA.....
Q9PYD3_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKEEIEQQMDRIVKEMRRQLEMIEKLTTREIEQVELLKRIHDKLVARPVDAIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
D5LG79_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASVPTMKIALKTSRCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIERQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRPTDEIDMTKEINQKNVKTLEEW.ESGKNPYETKEVTA.....
H9MZM2_9REOV/1-170                 ..........................f----TDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTVLNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
G1DH80_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
A0A024CG93_9REOV/1-173             ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCMVTIINTLLKLAGRKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMTRPADVIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
G5CPK2_9REOV/1-168                 ...........................-----DLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLFKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMTRTVDEIDMTKEINQKNVRTLREW.ENGKNPYEPKEVTA.....
C3U214_9REOV/14-186                ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLIARPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
Q6QT00_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDGCVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTDEIDMTKEINQKNVRTLEEW.ESAKNPYEPKEVTA.....
F5CRH9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
S5S2S7_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
C7EWT7_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITMFNCVMRLFGSKTEMVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
E7ECR6_9REOV/8-180                 .........................ik--VLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIVKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
F6MF93_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDRLTTREIEQVELLKRIHDKLMVRSTDEIDMTKEINQKNVRTLEEW.ENGRNPYEPKEVTA.....
S5RLK5_9REOV/14-186                ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPADVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
B6E4V7_9REOV/1-173                 ...........................MDNLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRCQLEMIDKLTTREIEQVELLKRIHDKLVVRPVDAIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
Q4G608_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GIAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLTGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E2J3A6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q910Q6_9REOV/1-173                 ...........................MEKLTDLNY...TLGVITLMNSTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLRRIHDKLMIRPTDDIDMTKEINQKNIKTLEEW.ENGRNPYESKEVTA.....
D7SC34_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDSLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
I1TJT7_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTILFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMMQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
D1GHE4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GIAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKHCMVTIINTLLKLAGYKEQVTNKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKSIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ENGKNPYESSEVTA.....
A5H1R5_9REOV/1-158                 ...........................---------...------LMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
H6SWT8_9REOV/1-156                 ...........................---------...--------NSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLIVQSTGEIDMTKEINQKNVKTLEEW.ESGRNPYESKEVTA.....
E7CBK4_9REOV/1-171                 ...........................--KFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
F5C6N0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDSVDMMKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
T2CD90_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTVINTLLKLAGYKEQVTTKDEIEQQMNRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLAVRPFDAIDMSKEINQKNIRTLDEW.ESGKNPYEPSEVTA.....
B6E4W1_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIRTIDEIDMTKEINQKNVKTLKEW.ENGKNPYEPKEVTA.....
A9ZP31_9REOV/1-173                 ...........................MDKLADLNY...TSSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCTVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLITRPVDVLDMSKEFNQKNIKTLDEW.KSGKNPYEPSEVTA.....
V5IX05_9REOV/1-173                 ...........................MEKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E7ECT2_9REOV/8-180                 ...........................MDMLSDLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIVKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q8V789_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.IMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVAGSGYKVVRVVVITTFNCVMRLFGSQTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMKK-NDVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
E3W515_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPIDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
I6U0S7_9REOV/3-144                 ......................hnvii---------...------------------.-.-MKYF...PF..LASILTILFTAWKMGSSTLKVTKTVAGSGYKVIKVVIVTIFNCILKIFGSKTEIVPEDKMDIMASKILKQIDEQVKVIEQLTKRELEQVKLLADIYELLKYKSEE--TIPSGINKKAYDT---W.N--KDPYQP-----travs
F5C4Z3_9REOV/1-173                 ...........................MDKLADLNY...TLRVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKLALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
H9BPQ3_9REOV/1-157                 ...........................---------...-------MNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRPADEIDMTKEINQKNVKTLEEW.ENGKNPYEPKEVTA.....
B0ZSX5_9REOV/1-166                 ...........................MENVTTINE...TL-VEEVYNMTLGYFEHNvI.IMKYF...PF..LASILTIIFTAWKMGRSTLKVTKTVAGSGYKAVKVVIVTIFNCVLRMFGSKAEIVPEDKMDIMASKILKQIDEQVKVIEQLTKRELEQVKLLADIYELLKYKNEGNIS--SETNRKA---YETW.--SKDPYQPT----ravs.
E7D6L2_ROTHU/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNFKTLDDW.ESGKNPYEPIEVTA.....
D2KQT7_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPIDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
E0XH97_9REOV/8-105                 .......................rphs---------...TLSMITLVNDTLHSIIPN.S.GMAYF...PY..VASALTILFTLHKASIPTMKIALKTSKWSYKVIKILVVTIINALLKLAGFKGQVTTNDEIEKQMDRIV--------------------------------------------------------.--------------.....
D3JPS9_9REOV/1-172                 ...........................-EKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRTTDEIDMTKEINQKNVRTLKEW.ENGKNPYEPKEVTA.....
A0A024CFR7_9REOV/1-173             ...........................MDKLADLNY...TLSVITLINDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIVKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q4G640_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
V9VGZ6_9REOV/10-182                ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
H2DF34_ROTHU/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
M4ZVL9_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFALHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
Q1G1V3_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKMAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLIIRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
F6JTH7_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYEEQITNKDEIEKQIDRVVKEMRRQLEMIDKLTTREIEQVELLRRIYDKLLVQPIDGVDMTKEINQKDIRTLEEW.ENGKNPYEPKEVTA.....
L7WQ36_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRCQLEMIDKLTTREIEQVELLKRIHDKLVVRPVDAIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
NSP4_ROTBN/1-173                   ...........................MEKLTDLNY...TSSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRAVDEIDMTKEINQKNVRTLEEW.ENGKNPYEPKEVTA.....
Q9Z038_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYREQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTGEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
A0MD51_9REOV/1-173                 ...........................MDKLADLIY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRCQLEMIDKLTTREIEQVELLKRIHDKLVVRPVDAIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
A8C503_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEQNvI.IMKYF...PF..LASILTIMFTAWKMGESTLKVTKTVAGSGCKVVRVVVITVFNCIMRLFGSKTEMVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKM-TKNDVDMSFETNKKE---YEKW.I--KDPYQPT----ravs.
M1KJM2_9REOV/1-173                 ...........................MDKLTDLND...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ENGKNPYEPSEVTA.....
F5C5G4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLVTRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q9DHA4_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASALTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTGEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
H6UJ58_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLETIDKLTTREIEQVELLKRIHDKLMTRPVDFIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
F5C6Y8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
E7CBF2_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
B0ZSY7_9REOV/4-170                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNiI.VMKYF...PF..LASILTIVFTAWKMGKSTLKVTKTVAGSGYKVVRVVIITIFNCVMRLLGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMKK-NDIDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
X4Y0W3_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTILFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGCKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
B2Z9W1_9REOV/1-124                 ...........................---------...------------------.-.-----...--..--------------SIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
D1GG63_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKHCMVTIINTLLKLAGYKEQVTNKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKSIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ENGKNPYESSEVTA.....
F5C5J7_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
H9MZN8_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASILTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
I6SYA2_9REOV/1-166                 ...........................MENVTTINE...TL-VEEVYNITLGYFEHNvI.IMKYF...PF..MASILTILFTAWKMGSSTLKVTKTVAGSGYKVIKIVIITIFNCVLKIFGSKTEIVPEDKMDMMASKILKQIDEQVKVIEQLTKRELEQVKLLADIYELLKYKS--EETVSSGINKKAYDT---W.N--KDPYQP-----travs
S4UCF1_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLVVRSTDEIDMTKEINQKNVKTLEEW.ESGKNPYEPKEVTA.....
E7CBL9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
G9DDQ5_9REOV/1-165                 ...........................--------Y...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
E0YLK0_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNGTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKDQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNIRTLEEW.ESGKNPYEPKEVTA.....
S5S2R0_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.EDGKNPYEPIEVTA.....
E7ECR4_9REOV/8-180                 .........................ik--VLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYESSEVTA.....
C1K3K2_9REOV/1-166                 .enatsinetfveevynmtlsyfehnv---------...------------------.I.VMKYF...PF..LASILTIAFTVWKMGKSTLKVTKTVTGSGYKVVRVVVITMFNCVMRLFGSKTEMVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
F5CRG7_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
J9QFX0_9REOV/1-173                 ...........................MDKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
D7SC31_9REOV/1-130                 ...........................---------...------------------.-.-----...--..--------FTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDSLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
D7SC44_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDSLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
M4YFT7_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASVPTMKIALKTSRCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRPTDEIDMTKEINQKNVKTLEEW.ESGKNPYETKEVTA.....
A9CQ75_9REOV/7-160                 ...........................MEKFDVQDC...VLIAIPSVNATLHSDVSD.P.GRFPL...PL..VASGLADWISFPYASCPMVNLVYKTSQCSYKVVLYCTITIVYTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPADTLYMTKESNRKNI------.--------------i....
D7NN67_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFMLHKASIPTMKIALKTSKCSYKMVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRTVDEIDMTKEINQKNVRTLEEW.ENGRNPYEPKEVTA.....
A0SXM5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLQSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIERQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPADIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
E3TPX4_9REOV/1-173                 ...........................MEKLTDLNY...TLGVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLIVQSTGEIDMTKEINQKNVKTLEEW.ESARNPYEPKEVTA.....
W0G4Y1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTLKIALRTSKCSYKVIKYCMVTIINTLLKLAGYREQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLITRPADVIDMSKEFNQKNIRTLDEW.ENGKNPYEPSEVTA.....
G8DPJ5_9REOV/1-131                 ...........................---------...-------MNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTIQQPDEIDMTKE------------.--------------.....
V5IX12_9REOV/1-173                 ...........................MEKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q1G1V0_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
T1UNG2_9REOV/9-181                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEKQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNVKTLDEW.ENGKNPYEPIEVTA.....
E2ICS8_9REOV/7-179                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPIDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
T1RPC9_9REOV/1-166                 ...........................MENVTTINE...TL-VEEVYNITLGYFEHNvI.IMKYF...PF..LASILTVLFTAWKMGSSTLKVTKTVAGSGYKVIKVVIVTIFNCILKIFGSKTEIVPEDKMDIMASKILKQIDEQVKVIEQLTKRELEQVKLLADIYELLKYKSEGTIP--SGINKKAYDT---W.N--KDPYQP-----travs
H9MZP7_9REOV/1-170                 ...........................---LTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASVPTMKIALKTSRCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRPTDEIDMTKEINQKNVKTLEEW.ESGKNPYETKEVTA.....
S5RQX2_9REOV/8-180                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
G1FVW1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
F5C529_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLVTRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E7ECU0_9REOV/8-180                 ...........................MDMLSDLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
R4I3N9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITIMNDTSHSIIQD.P.GMVYF...PY..IASVLTVLFTLHKVSIPTMKIALKMSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELFKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
Q1G1U9_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
E7CBI9_9REOV/1-171                 ...........................--KFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
X2FJE4_9REOV/1-173                 ...........................MEKLADLNY...TLGVITLLNDTLHNILEE.P.GMVYF...PY..IXSALTVLFTMHKASLPAMKLAMRTSQCSYRIIKRVVVTLINTLLRLGGYNDYLTDKDETEKQINRVVKELRQQLTMIEKLTTREIEQVELLKRIYDMMIVRHDSEIDMSKETNQKAFKTLHDW.KNDRSYDDNTEVI-a....
A5HJT3_9REOV/1-167                 ...........................------LNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
E7ECU1_9REOV/8-180                 .........................ik--VLADLNY...TLSVITLMNDILHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
F5C6L8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q4G607_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKDPYEPSEVTA.....
M1HCH4_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGKNPYEPKEVTA.....
V9TG12_9REOV/10-182                ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIRSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
S5RGD0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPADIVDMTKEFNQKNIKTLDEW.ESGKNPYEPMEVTA.....
Q4G625_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKAPIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
Q4G667_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
H9MZK7_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q1WK51_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMLTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMKRQLEMIDKLTTREIEQVELLKRIHDKLMTRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q4G649_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GIAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKIIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q3LRX7_9REOV/1-168                 ...........................-----DLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTVINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMTRSIDVIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
M1JST4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCTVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPAEVTA.....
D1GG87_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
NSP4_ROTH4/1-173                   ...........................MDKLADLNY...TLSVITLMNDTLHSIIED.P.GMAYF...PY..IASVLTVLFALHIASIPTMKIALKASKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
R4V160_9REOV/1-173                 ...........................MDKLADLNY...TLSVITVMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q805Q5_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYREQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTGEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
G5CPK3_9REOV/1-170                 ...........................---LTDLNY...TLSVITLMNSTLHTILED.P.GMVYF...PH..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIERQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRTTDEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
E5FPY1_9REOV/1-173                 ...........................MEKXTDLNY...TLSVIXLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKXVTA.....
Q45GC2_9REOV/1-163                 .........................ie---------...---CITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIRTADEIDMTKEINQKNVRTLKEW.ENGKNPYEPKEVTA.....
I3RPT8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDRLTTREIEQVELLKRIHDNLIIRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
C7EWR5_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNITLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
C7FFR8_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
D1GGL8_9REOV/1-173                 ...........................MDKLAGLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKCCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLIIKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
E0YLI6_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMRIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNIRTLEEW.ESGKNPYEPKEVTA.....
Q53AU0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLAAGPVDAIDMSKEFNQKNIRTLDEW.ENGKNPYEPSEVTA.....
Q9DSG6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNFKTLDEW.ESGKNPYEPIEVTA.....
NSP4_ROTHM/1-173                   ...........................MDKLADLNY...TLSVITSMNDTLHSIIED.P.GMAYF...TY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVLKYCIVTIINTFLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
NSP4_ROTHO/1-173                   ...........................MDKLADLNY...TLSVVTLMNDTLHSIIQD.P.GMAYF...PY..VASVLTVLFALHKASIPTMKMALKTSKCSYKVIKYCIVPIINTLFKLAGFQEPITTKDEIEQPMDGIVKEIRRPLEMIDKLTTPEIEQVELLKSLHDHLITRPVDVIDMSKEFNQKNIKTLDEW.DSGKNPYEPSEVTA.....
B2Z9U9_9REOV/1-127                 ..........................t---------...------------------.-.-----...--..----------LHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEV--.....
E2J2R4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
Q778G0_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMKRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
U3M0M6_9REOV/1-173                 ...........................MEKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNVKTLDEW.ENGKNPYEPIEVTA.....
V5IX77_9REOV/1-173                 ...........................MEKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
K4IDQ8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTALFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGHKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
Q9IVG4_9REOV/1-134                 ...........................---------...------------HSIIQD.P.GMAYF...LY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKT----.--------------.....
Q9WAJ7_9REOV/1-173                 ...........................MEKLTDPNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..VASVLTVLFTLHKASIPTMKIALRTSRCSYKVIKYCIVSIFNTLLKLVGFKEQITTKDEIEKQMDRSVKEMRLQLEMIDKPTTREIEQVELLKRIHDMLIIKPVDKIDMSQEFNQIQFKTLNEW.AEGENPYERKEVTA.....
Q77P38_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
M1GTR0_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMAKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
R9QU95_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVAIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSICEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
Q4G673_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLTLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTGEIDMTKEINQKNVRTLEEW.EDGKNPYEPKEVTA.....
Q4G658_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q3LRN8_9REOV/1-168                 ...........................-----DLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMTRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
L7ZB07_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLVVRSTDEIDMTKEINQKNVKTLEEW.ESGKNPYEPQEVTA.....
J9QBW5_9REOV/10-182                ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRTIDEIDMTKEINQKNVKTLEEW.ENGKNPYEPKEVTA.....
E2GK17_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIRSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
F5C5E9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLVTRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
P87714_9REOV/1-162                 ...........................--------Y...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTGGFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMPKEFNQKNTQTLDEW.ESGKNPYEPIE---.....
G4XR49_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLTVLFALHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVQTTGEIDMTKEINQKNVRTLEEW.ESGKNPYEPREVTA.....
P87721_9REOV/1-162                 ...........................--------Y...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKCCIITIINTLLKLAGYKEQINTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKSVDVIDMSKEFNQKNIKTLDEW.ESGNNSYEPLE---.....
D0UD35_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGCKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPADTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
A0A024FBC2_9REOV/1-173             ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLIPRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
I6XSU6_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTILFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
E3W540_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
D5LN54_ROTHU/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIGVTA.....
E7CBK7_9REOV/1-171                 ...........................--KFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
Q808T0_9REOV/1-114                 ...........................---------...------------------.-.-----...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKD------------.--------------.....
F8U689_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYEEQITNKDEIEKQIDRVVKEMRRQLEMIDKLTTREIEQVELLRRIYDKLLVQPIDGVDMTKEINQKNIRTLEEW.ENGKNPYEPKEVTA.....
Q4G600_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
G8FNI8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPVEVTA.....
C1K3L0_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITMFNCVMRLFGSKTEMVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
F5C4H5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
Q1G1T5_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIITIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
C1K3K7_9REOV/1-166                 .enatsinetfveevynmtlsyfehnv---------...------------------.I.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITMFNCVMRLFGSKTEMVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
E7CBF5_9REOV/1-170                 ..........................f----TDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
Q4G627_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
V9VH00_9REOV/10-182                ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIQSIGEIDMTKEINQKNVKTLEEW.KSGRNPYEPKEVTA.....
E7CF15_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIIREMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDDW.ESGKNPYEPTEVTA.....
A0FJ13_ROTHU/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
K4I115_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
D5HMU8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKEIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNVKTLDEW.ENGKNPYEPIEVTA.....
H6SWU2_9REOV/1-162                 ..........................g---------...---VITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLIVQSTGGIDMTKEINQKNVKTLEEW.ESGRNPYESKEVTA.....
M1PD69_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTILED.S.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALETSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIRTADEMDMTKEINQKNVRTLEEW.ENGKNPYEPKEVTA.....
Q4G614_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
G0YWF0_9REOV/1-167                 ...........................------LNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTLKIALKTSKCSYKVIKYCMVTVINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVARPIDAIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
G0YWE9_9REOV/1-169                 ..........................a-----DLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVVRPIDAIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
S5RE36_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.EDGKNPYEPIEVTA.....
C7EWT2_9REOV/1-166                 .enatsinetfveevynmtlsyfehnv---------...------------------.I.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITMFNCVMRLFGSKTEMVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
Q4G618_9REOV/1-173                 ...........................MDKPADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSNKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q8QY58_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNIRTLEEW.ESGKNPYEPKEVTA.....
E0XH90_9REOV/1-163                 ...........................---------...-LSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTVINTLLKLAGYKEQVTTKDEVEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLRRIYDKLMTRPDDVIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
Q1G1S5_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKCCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
C3RY81_9REOV/1-173                 ...........................MEKLTDLNY...TLNVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRPTDEIDMTKEINQKNVKTLEEW.ENGKNPYEPKEVTA.....
M1PYH5_9REOV/14-186                ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
T1SQZ2_9REOV/4-176                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
S5RE25_9REOV/2-174                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYSIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
X2FR19_9REOV/1-173                 ...........................MEKLADLNY...TLGVITLLNDTLHNILEE.P.GMVYF...PY..IVSALTVLFTMHKASLPAMKLAMQTSQCSYRIIKRVVVTLINTLLRLGGYNDYLTDKDETEKQINRVVKELRQQLTMIEKLTTREIEQVELLKRIYDMMIVRHDSEIDMSKETNQKAFKTLHDW.KNDRSYDDNTEVI-a....
B6SAK5_ROTCU/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASLPTMKIALKTSRCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDMLIATSVDKIDMTQEFNQKHFKTLNEW.AEGENPYRPKEVTA.....
F6LR30_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSRCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDVLIIKPVDKIDMSREFNQKQFKTLTEW.VEGENPYEPKEVTA.....
B2BMC8_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDRLTTREIEQVELLKRIHDRLMVRSTDEIDMTKEINQKNVRTLEEW.ENGRNPYEPKEVTA.....
NSP4_ROTH3/1-173                   ...........................MEKLTDLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSRCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLIIKPVDKIDMSQEFNQRQFKTLNEW.AEGENPYEPKEVTA.....
F5C5H3_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLVTRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E7CBH7_9REOV/1-171                 ...........................--KLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGCKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
A9ZQ59_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
M4Q1S3_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASTPTMKIALKTSKCSYKVIKYCIVTIINTLLRLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
C7EWQ9_9REOV/1-166                 .enatsinetfveevynmtlsyfehnv---------...------------------.I.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
Q9DSG3_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFALHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITAKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTGEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
B6SAN8_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASLPTMKIALKTSRCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDMLIATSVDKIDMTQEFNQKHFKTLNEW.AEGENPYKSREVTA.....
H9MZQ0_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMMKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
S5S2R5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.EDGKNPYEPIEVTA.....
B2BRH3_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGCKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
E7BKX3_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIRSIDGIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
D1GHP0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
K9ZU11_9REOV/1-173                 ...........................MEKLPDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLVVRSTDEVDMTKEINQKNVKTLEEW.ESGKNPYEPKEVTA.....
A0SXN0_ROTHU/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDSLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
Q2PGE7_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLRSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
Q8AZ11_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPANALDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
A0A023UIG2_9REOV/1-139             ...........................---------...------------------.-.-----...-Y..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
H2DLV3_9REOV/1-139                 ...........................---------...------------------.-.-----...-Y..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPIDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
A9ZP16_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
F5C6V2_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E7ECT6_9REOV/8-180                 ...........................MDKLADLNL...TLSVITLMNDTLRSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
X4YQR4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENRKNPYEPIEVTA.....
X2FJ00_9REOV/1-173                 ...........................MEKLADLNY...TLGVITLLNDTIHNILEE.P.GMVYF...PY..IVSALTVLFTMHKASLPAMKLAMRTSQCSYRIIKRVVVTLINTLLRLGGYNDYLTDKDETEKQINRVVKELRQQLTMIEKLTTREIEQVELLKRIYDMMIVRHDSEIDMSKETNQKAFKTLHDW.KNDRSYDDNTEVI-a....
H9MZM1_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q9YIH2_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVRSTDEIDMTKEINQKNVRTLEEW.ENGKNPYEPKEVTA.....
F5C685_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPIDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
A0A024CGL3_9REOV/1-173             ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRTTDEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
S5RE18_9REOV/12-184                ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNVKTLDEW.ENGKNPYEPIEVTA.....
S5I901_9REOV/8-180                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVQSAGEIDMTKEINQKNVRTLEEW.ESGRNPYEPKEVTA.....
D3JPT2_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTGEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
C1K3J0_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVTQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
B2Z9T3_9REOV/1-127                 ..........................t---------...------------------.-.-----...--..----------LHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNMITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEV--.....
B6SAM7_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTIMED.S.GMAYF...PY..IASVLTVLFTLHKASLPTMKIALKTSRCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDMLIATSVDKIDMTQEFNQKHFKTLNEW.AEGENPYKPKEVTA.....
E0YLK3_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVIKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSIDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
S5RLI9_9REOV/2-174                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
Q1G1T4_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
A9ZQ51_9REOV/1-173                 ...........................MEKFTVLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVTTVLITLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLADYKEQITTKDEIEKLMDRVVKEIRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
M1PQN4_9REOV/1-95                  ...........................---------...-----------------D.P.GMAYF...PY..IASVLTVLFMLHKASIPTMKIALKTSKCSYKMVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREI--------------------------------------.--------------.....
C4PBK4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITKPVDVIDMSKEFNQKNIRTLDEW.ESGRNPYEPSEVTA.....
E7CBJ6_9REOV/1-171                 ...........................--KFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
Q1G1U6_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIITIINTLLKLAGYKEQFTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLIIRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYKPIEVTA.....
I1E473_9REOV/1-171                 ...........................--KLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRPTDGIDMTKEINQRNVRTLEEW.ESGKNPYEPKEVTA.....
F5C577_9REOV/1-173                 ...........................MDKLADLNY...TLRVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
D1GGV2_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
B5ATN2_9REOV/1-165                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEP-----.....
C3U212_9REOV/14-186                ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.NSGKNPYEPTEVTA.....
E3W565_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLDGYKEQVTIKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q6QSZ9_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDVIETQMDRVVKEMRRQLEMIDKLTTREIEQVELLKCIYDKLMVRTADEIDMTKEINQKNVRTLKEW.ENGKNPYEPKEVTA.....
E0YLI5_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVIKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
E2J2Z8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKMLDEW.ENGKNPYEPIEVTA.....
F5CRK3_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
A0A024CF32_9REOV/1-173             ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKMVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLVVRSTDEIDMTKEINQKNVKTLEEW.ESGKNPYEPKEVTA.....
A0A024CG74_9REOV/1-173             ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIVKPVDVIDMSKEFNQKNIKTLYEW.ESGKNPYEPSEVTA.....
S4U8X2_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSNCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEMEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKHIYDKLMVRSNIEIDMTKEINQKNVRTLEEW.ESGKNPYEPREVTA.....
L7NV19_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKCCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVNTVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
D1GGD5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKHCMVTIINTLLKLAGYKEQVTNKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKSIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ENGKNPYESSEVTA.....
M1HMU1_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIVLKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
E7CBJ2_9REOV/1-171                 ...........................--KLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
B2BMB7_9REOV/1-173                 ...........................MEKLTDLNY...TLNVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRPTDEIDMTKEINQKNVKTLEEW.ENGKNPYEPKEVTA.....
Q4G626_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
A5H1R8_9REOV/1-158                 ...........................---------...------LMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGCKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRILDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
E0YLJ7_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVIKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
X2G8X7_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIYDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
B8LFN5_9REOV/1-158                 ...........................---------...------LMNSTLHTLLED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVQSTGEIDMTKEINQKNVKTLKEW.ESGRNPYEPKEVTA.....
V5IX07_9REOV/1-173                 ...........................MEKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
L8AVA0_9REOV/1-173                 ...........................MEKLTDLNY...TSTVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRAVDEIDMTKEINQKNVRTLEEW.ENGKNPYEPKEVTA.....
L7NUW7_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLELIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPVEVTA.....
E7CBK9_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
S5S2Q1_9REOV/3-175                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
T2HS61_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTLLED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.KSGRNPYEPKEVTA.....
E5L0C1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTVINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMTRPVDVIDMSKEFNQKNVRTLDEW.ESGKNPYEPSEVTA.....
E7CBK6_9REOV/1-170                 ..........................f----TDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
B2Z9T5_9REOV/1-124                 ...........................---------...------------------.-.-----...--..--------------SIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVTEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
E7CUG7_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASVPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDRLTTREIEQVELLKRIHDKLMVRSTDGIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
F5C6Q4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQE.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDSVDMMKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
Q9W9Y0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKSAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
Q5KR57_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNVKTLDEW.ENGKNPYEPIEVTA.....
Q9YKF6_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
K4HLU7_9REOV/1-173                 ...........................MDKLANLNS...TLSMITLVNGTLHSIIPN.S.GMAYF...PY..IASALTILFTLHKASIPTMKIALKTSKCSYKLIKYCIVAAINALLKLAGFEGQVTINDEIEKQMDRVVREMQRQLEMIDKLTTREIEQVELLKRIYDKLMLKNVDAIDMSKEFNQKNIRTLDEW.ENGRNPYEPTEVTA.....
E7CBM5_9REOV/1-162                 ...........................---------...--SVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFALHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITAKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTGEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
E3W4A0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKFAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
B5ATN4_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
F5C5V5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPIDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E7ECR2_9REOV/8-180                 .........................ik--VLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E7CBK2_9REOV/1-166                 ...........................-------NY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
Q1G1U8_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
G3G3W5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVTRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
I6YQW5_9REOV/1-157                 ...........................---------...-------MNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSTCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLRRIYEKTIIRPADEIDMTKEINQKNVKTLEEW.ESGKNPYEPKEVTA.....
E7CBP2_9REOV/1-163                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRLVDVIDMTKEFNQKNIKTLDEW.ESGKNPY-------.....
Q80AP8_9REOV/1-173                 ...........................MDKLTDLNY...TLSVISLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVIKYCIVTIFNTLLKLAGYKEQITTKDEIERQMDRVVKEMRRQLEMIDKLTTREIEQVELLRRIYDKLMVKRTDEIDMSKEINQKNIRTLDEW.ENGKNPYEPSEVTA.....
F1JZU5_9REOV/2-167                 menvstinetlvdevykmtlryfehnv---------...------------------.I.IMKYF...PF..IASILTIIFTAWKMGRSTLKVTKTVAGSRYKVIKVVIVTIFNCVLRIFGSKAEIVPEDKMDVMASIILMQIDEQVKVNEQLRKRELEQVKLLADIYELLKYKTEGNI--CSETNKKG---YETW.--GKDPYQPT----ravs.
E0XH96_9REOV/1-121                 ...........................---------...------------------.-.-----...--..-----------------TMKIALKTSRCSYKVIKYCVVTIINALLKLAGFKGQVTTNDEIEKQMDRVVKEMQRQLEMIDKLTTREIEQVELLKRIYDKLMARNADVIDMSKELNQKNIRTLDEW.ENGRNPYEPSEVTA.....
Q1WEV6_ROTHU/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLYSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKWSYKVIKYWIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
M1HM54_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLIVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLTLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTGEIDMTKEINQKNVRTLEEW.ENGKNPYEPKEVTA.....
F5C6W2_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
F5C6J4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
F5C504_9REOV/1-173                 ...........................MDKLADLNY...TLRVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKLALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
A0A024CFA4_9REOV/1-173             ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTVINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLAVRPFDAIDMSKEINQKNIRTLDEW.ESGKNPYEPSEVTA.....
B2ZPK8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLRLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
F5AXY4_9REOV/8-180                 .........................ik--VLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
B6D406_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKAQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
T2CEK6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIVKPVDVIDMSKEFNQKNIKTLDEW.KSGKNPYEPSEVTA.....
F5C6I2_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSNEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
A9ZP23_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTPKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
Q1G1T7_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
Q2VC36_9REOV/1-173                 ...........................MEELTDLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSRCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLIIKPVDKIDMSQEFNQRQFKTLNEW.TEGENPYEPKEVTA.....
E0YN02_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVIKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSIDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
I6T9U5_9REOV/1-164                 .nvttinetlveevynitlgyfehnvi---------...------------------.-.IMKYF...PF..LASILTILFTAWKMGRSTLKVTKTVAGSGYKVIKVVVVTIFNCVLKVFGSKTEIVSEDKMDIMASKILKQIDEQVKVIEQLTKRELEQVKLLADIYELLKYK--SEETMSSGTNKKAYDT---W.--SKDPYQP-----travs
F5C4A3_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q1WK38_9REOV/1-173                 ...........................MDKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKLALKTSRCSYKVIKYCVVTTFNALLKLAGYKEQVTTKDEIEKQMDRVVREMRRQLEMIDKLTTREIEQVELLRRIYDRLMVQETDEIDMSKEINQKNIRTLNEW.ENGKNPYKPSEVTA.....
F5C588_9REOV/1-173                 ...........................MDKLADLNY...TLRVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
A5X359_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLAARPVDAIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
B0ZSW9_9REOV/4-169                 ...........................MENVTTINE...TL-VEEVYNMTLGYFEHNvI.IMKYF...PF..LASILTIIFTVWKMGRSTLKVTKTVAGSGYKAIKVVIVTIFNCILRMFGSKAEIVPEDKMDIMASKILKQIDEQVKVIEQLTKRELEQVKLLADIYELLKYKSEGSIS--SETNRKA---YETW.--SKDPYQPT----ravs.
I2CMQ1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPADAIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
R4I447_9REOV/1-155                 ...........................MEKLTDLNY...TLGVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLIVQSTGEIDMTKEINQKNVKT----.--------------.....
D7NN66_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKMVKYCIVTIFNTLLELAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRTVDEIDMTKEINQKNVRTLEEW.ENGRNPYEPKEVTA.....
G3BFZ0_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILKN.P.GMAYF...PY..IASVLTVLFTLHKASLPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEMEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKHIHDKLMAQPTDNIDMTKEINQKNVKTLAEW.ENGKNPYEPKEVTA.....
D1GGC3_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKCCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLIIKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
E7ECQ6_9REOV/8-180                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYS...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
C9WLT4_9REOV/1-158                 ...........................---------...------LMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGCKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
T2CEU3_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALQTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
C9WLT3_9REOV/1-158                 ...........................---------...------LMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGCKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQAELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
P90508_9REOV/1-162                 ...........................--------Y...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPANALDMSKEFNQKNIKTLDEW.ESGKNPYEPSE---.....
E7CBG0_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
A5HAV3_9REOV/1-158                 ...........................---------...------LMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
S5RGE8_9REOV/2-174                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
Q4G675_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
S5RGH2_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPADVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
A0MM87_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPADIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
H9LJ12_9REOV/1-171                 ...........................--KLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRTTDEIDMTKEINQKNVKTLKEW.ESGKNPYEPKEVTA.....
Q4G652_9REOV/1-173                 ...........................MEKLTDLDY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLTLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTGEIDMTKEINQKNVRTLEEW.EDGKSPYEPKEVTA.....
H6SWT9_9REOV/1-92                  ...........................---------...------------------.-.-----...--..----------------------------------------------LAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLIVKSTGEIDMTKEINQKNVKTLEEW.ESGRNPYESKEVTA.....
B3VQM0_9REOV/1-173                 ...........................MEQLTDLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIAIKTSKCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEEQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLIIKPVDKIDMSQEFNQKRFKTLNEW.AEGENPYEPKEVTA.....
B2Z9W9_9REOV/1-124                 ...........................---------...------------------.-.-----...--..--------------SIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
H8ZHF6_9REOV/1-164                 ...........................---------...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPADIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
E0XH87_9REOV/9-181                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRSVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
G3FJ61_9REOV/1-159                 ...........................---------...-----TLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
NSP4_ROTHT/1-173                   ...........................MDKLADLNY...TLSVITSMNDTLHSIIED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKASKCSYKVIKYCVVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQIELLKRIHDNLITRPVNVIDMSMEFNQKNIKTLDEW.ESRKNPYEPSEVTA.....
#=GR NSP4_ROTHT/1-173        SS    ...........................XXXXXXXXX...XXXXXXXXXXXXXXXXXX.X.XXXXX...XX..XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-XXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXXXXXX.....
D1GGY8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
C1K3H5_9REOV/1-167                 .......................meia----TSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVTQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
T1RQA0_9REOV/1-164                 .nvttinetlveevynitlgyfehnvi---------...------------------.-.IMKYF...PF..LASILTILFTAWKMGSSTLKVTKTVAGSGYKVIKVVIVTIFNCILKIFGSKTEIVPEDKMDIMASKILKQIDEQVKVIEQLTKRELEQVKLLADIYELLKYKSEE--TIPSGINKKAYDT---W.N--KDPYQP-----travs
S5U498_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVVKYCIVTIFNTLLKLAGYEEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIRPTDGIDMTKEINQKNVKTLEEW.ENGKNPYEPKEVTA.....
Q77P45_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GIAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLVTRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
L0CBA1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKSVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEQSEVTA.....
F5C5T0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDSVDVTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
H9MZQ4_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
D1GHK4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKHCMVTIINTLLKLAGYKEQVTNKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKSIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ENGKNPYESSEVTA.....
Q9IVG3_9REOV/1-134                 ...........................---------...------------HSIIQD.P.GMAYF...LY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKT----.--------------.....
X2FWL9_9REOV/1-173                 ...........................MEKLADLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVIKYCIVSVFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLIVKPVNKIDMSQEFNQKHFKTLNEW.AEGENPYESREVTA.....
T2HR40_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLELAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.KSGRNPYEPKEVTA.....
D1MEZ8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIYDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E7CBM3_9REOV/1-170                 ..........................f----TDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVQSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
F5C553_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLVTRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E7CBK0_9REOV/1-171                 ...........................--KFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
B8Y642_9REOV/1-101                 ...........................---------...------------------.-.-----...--..-------------------------------------VTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIRTADEMDMTKEINQKNVRTLEEW.ENGKNPYEPKEVTA.....
U3M051_9REOV/1-173                 ...........................MEKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...SY..IASVLTVLFMLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
B7ZGV8_9REOV/1-154                 ...........................-----DPNY...TLSVITLMIDTLHSLIQE.P.GMAYF...PY..IASVLTVLFTLHKASIPTLKIALRTSKCSYKVIKYCMVTVINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDRLTTREIEQVELLKRIYDKLITRPADVIDMSKEFNQKNVRTLDEW.--------------.....
G3FJ70_9REOV/1-159                 ...........................---------...-----TLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNVKTLDEW.ENGKNPYEPIEVTA.....
F5C7B9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
Q1L7J8_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEMEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSNSEIDMTKEINQKNVRTLEEW.ESGKNPYEPREVTA.....
NSP4_ROTP5/1-173                   ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDKLAARSVDAIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
F4YUY3_9REOV/1-161                 ...........................---------...---VITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
H2DF35_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILEE.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLIVRPTGEIDMTKEINQKNVKTLEEW.ENGRNPYEPKEVTA.....
E7CBI2_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
E7CBP4_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
E0XH92_9REOV/1-99                  ...........................---------...------------------.-.-----...--..---------------------------------------VINTLLKLAGYKEQVTTKDEVEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLTRIHDKLMTRPADVIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
B7ZGW3_9REOV/1-155                 ...........................-----DLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSRCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLIIKPVDKIDMSQGFNQRQFKTLTEW.--------------v....
D1L624_9REOV/1-173                 ...........................MEKLADLNY...TLGVITLLNDTLHNILEE.P.GMVYF...PY..IASALTVLFMMHKASLPAMKLAMRTSQCSYRIIKRVVVTLINTLLRLGGYNDYLTDKDETEKQINRVVKELRQQLAMIEKLTTREIEQVELLKRIYDMMVVRQNREIDMSKETNQKAFKTLHDW.GNDRNYDDNTD---vit..
S5I2Y8_9REOV/1-126                 ...........................---------...------------------.-.-----...--..------------KASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
K4I2L8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYRVIKYCIVTIISTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
F5C4Q8_9REOV/1-173                 ...........................MDKLADLNY...TLRVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
D1GGU0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
A0A023UIZ7_9REOV/1-139             ...........................---------...------------------.-.-----...-Y..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLNLAGYKEQITTKDEIEKQMDRVIKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
T1RQ45_9REOV/1-164                 .nvttinetlveevynitlgyfehnvi---------...------------------.-.IMKYF...PF..LASILTILFTAWKMGSSTLKVTKTVAGSGYKVIKVVIVTIFNCILRIFGSKTEIVPEDKMDIMASKILKQIDEQVKVIEQLTKRELEQVKLLADIYELLKYKN--EETTSSGINKKAYDT---W.N--KDPYQP-----travs
C7SAQ4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLIIRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
E7CBF9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
F8SPZ5_9REOV/2-174                 ...........................MEKLTDLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASLPTMKIALKTSRCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDMLIATSDDKIDMTQEFNQKHFKTLNEW.AEGENPYKPKEVTA.....
H9MZL8_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E7CBI6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
E7CBP5_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
Q5G536_9REOV/1-144                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMSYF...PY..VASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEMEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLVVQSTDEIDM---------------.--------------.....
I6U4M3_9REOV/1-163                 ..vttinetlveevynitlgyfehnvi---------...------------------.-.IMKYF...PF..LASILTILFTAWKMGSSTLKVTKTVAGSGYKVIKVVIVTIFNCILKIFGSKTEIVPEDKMDIMASKILKQIDEQVKVIEQLTKRELEQVKLLADIYELLKYKSEE--TIPSGINKKAXDT---W.N--KDPYQP-----travs
Q2VC42_9REOV/1-168                 ...........................-----DLNY...TLCVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E7CF51_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPVDVIDMSKEFNQKNIKTLDEW.NSGKNPYEPTEVTA.....
B3SRU0_9REOV/1-176                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYFpyfPY..IASVLTVLFILHKASIPTMKIALKTSKCSYKVIKCCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKSIHDNLITKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
B7ZGV4_9REOV/1-154                 ...........................-----DLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIERQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRPTDEIDMTKEINQKNVKTLEEW.--------------.....
B2Z9U3_9REOV/1-121                 ...........................---------...------------------.-.-----...--..-----------------TMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E7CBL2_9REOV/1-172                 ...........................-DKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNMKTLDEW.ESGKNPYEPIEVTA.....
D1GGK6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKHCMVTIINTLLKLAGYKEQVTNKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKSIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ENGKNPYESSEVTA.....
B2CQB9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRCQLEMIDKLTTREIEQVELLKRIHDKLVVRPVDAIDMSKEFNQKNIRTLDEW.ESEKNPYEPSEVTA.....
Q4G663_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
V9VIJ8_9REOV/10-182                ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
A9ZP19_9REOV/1-173                 ...........................MEKFTVLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVREMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
D0UD08_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCLVTVINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLITRPVDSIDMSKEFNQKNVRTLDEW.ENGKNPYEPSEVTA.....
S5S0V4_9REOV/14-186                ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVITVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSISEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
P87712_9REOV/1-162                 ...........................--------Y...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCTVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLITRPVDVLDMSKEFNQKNIKTLDEW.KSGKNPYEPSE---.....
E7CBH2_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
F5C7D1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
S5K2A5_9REOV/1-156                 ...........................---------...--------NDTLHTIIED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDRLTTREIEQVELLKRIHDMLIIKPIEKIDMSKEFNQKQFKTLDEW.TDGENPYKPKEVTA.....
M1HCU5_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVKTLEEW.ESGKNPYEPKEVTA.....
S5RLG7_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMINKLTTREIEQVELLKRIHDNLITRPADIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
G0YWF3_9REOV/1-167                 ...........................------LNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTIINTILKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVSRPIDAIDMSKEFNQKNIRTLDEW.ENGKNPYEPSEVTA.....
S5IGJ5_9REOV/1-125                 ...........................---------...------------------.-.-----...--..-------------ASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIIDMTKEFNQKNVKTLDEW.ENGKNPYEPIEVTA.....
A0A024CEI5_9REOV/1-173             ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
S5RLI4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNETLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPANIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
G1CDA7_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEVEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLATRPVDVIDMSKEFNQKNIRTLDEW.ENGKNPYEPSEVTA.....
Q9QPN1_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIRTADEIDMTKEINQKNVRTLKEW.ENGKNPYEPKEVTA.....
Q99IA9_9REOV/1-173                 ...........................MEKLADLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFALHKASIPTMKIALKTSRCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDMMITKPVDKIDMSQEFNQKHFKTLNEW.AEGENPYEPKEVTA.....
A7VJD5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPVNALDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
A8C4Z7_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEQNvI.IMKYF...PF..LASILTIMFTAWKMGKSTLKVTKTVAGSGYKVVRVVVITVFNCIMRLFGSKTEMVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKM-TKNDVDMSFETNKKE---YEKW.I--KDPYQPT----ravs.
Q8B4J4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASISTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
Q808S9_9REOV/1-116                 ...........................---------...------------------.-.----F...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKD------------.--------------f....
G0YWE7_9REOV/1-169                 ..........................a-----DLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVVRPIDAIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
B5ATN3_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
Q3LRN4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIINTLLKLAGYKEQVTTKEEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDRLVTRPVDVIDMSKEFNQKNIRTLDEW.ENGKNPYEPSEVTA.....
W0G0Q4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTLKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTAKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLIIRPADAIDMSKEFNQKNIRTLDEW.ENGKNPYEPSEVTA.....
B2BM95_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTDGIDMTKEINQKNVKTLEEW.ESGKNPYEPKEVTA.....
E7CBH4_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
F5C4J9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
Q4G603_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVSTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
U5XMF7_9REOV/2-164                 ...tsinetfveevynmtlsyfehnvi---------...------------------.-.IMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVAGSGYKVVRVVIITVFNCVMRLFGSQTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMKK-NDVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
C1K3K6_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITMFNCVMRLFGSKTEMVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
A0FL80_ROTHU/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASFQTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
B0ZSY3_9REOV/2-168                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITMFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMKK-NEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
Q53AU1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVTRSVDAIDMSKEFNQKNIRTLDEW.ENGKNPYEPSEVTA.....
C1K3K3_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTVWKMGKSTLKVTKTVTGSGYKVVRVVVITMFNCVMRLFGSKTEMVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
NSP4_ROTMB/1-173                   ...........................MEKLADLNY...TLGVITLLNDTLHNILEE.P.GMVYF...PY..IVSALTVLFTMHKASLPAMKLAMRTFQCSYRIIKRVVVTLINTLLRLGGYNDYLTDKDETEKQINRVVKELRQQLTMIEKLTTREIEQVELLKRIYDMMIVRHDSEIDMSKETNQKAFKTLHDW.KNDRSYDDNTEVI-a....
Q9E166_9REOV/1-173                 ...........................MDKFADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPANALDMSKELNQKNIKTLDEW.ESGKNPYEPSEVTA.....
C7EWT8_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITMFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMKK-NEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
Q8B4J0_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIINTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEMDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
G3CEQ3_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRTTDEIDMTKEINQKNVKTLEEW.ENGRNPYEPKEVTA.....
V9VFF4_9REOV/10-182                ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIQSIGEIDMTKEINQKNVKTLEEW.KSGRNPYEPKEVTA.....
Q9IV25_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKETNQKNVRTLEEW.ESGKNPYEPKEVTA.....
A5H1R3_9REOV/1-120                 ...........................---------...------LMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKMALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVZLLKRIYNKL-------------------------.--------------i....
D0QB94_9REOV/1-173                 ...........................MDKLADLNY...TLSAITSMNDTLHSIIQD.P.GMAYF...LY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
A3E0Y0_9REOV/1-173                 ...........................MDKLADLNY...TMNVITLMNDTLHTIIED.P.GMAYF...PY..IASVLTILFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDRLTTREIEQVELLKRIHDMLIIKPIEKIDMSKEFNQKQFKTLDEW.TDGENPYEPKEVTA.....
C8C1J8_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMRYF...PF..LASILTIVFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITAFNCVMRLFGSKTEMVSDDRLDALASKIVTQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMKK-NDVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
B8Y641_9REOV/1-101                 ...........................---------...------------------.-.-----...--..-------------------------------------VTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIRTADEMDMTKEINQKNVRTLKEW.ENGKNPYEPKEVTA.....
NSP4_ROTHV/1-173                   ...........................MDKLADLNY...TLSVITSMNDTLHSIIED.P.GMAYF...PY..IASVLTVLFALHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLVGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESRKNPYEPSEVTA.....
H9MZN5_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
D1GG39_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKCCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLRRIHDNLIIKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
P87717_9REOV/1-162                 ...........................--------Y...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IAFVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNITTLDEW.ESGKNPYDPLE---.....
J9QK91_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITIMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVSVFNTLLKLAGYKEQITTKDEIEKQMDRVVREMRRQLEMIDKLTTREIEQVELLKRVHDMLIIKPVDKIDMSQEINQKHFKTLNEW.AEGENPYEPKEVTA.....
I3RPU2_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDRLTTREIEQVELLKRIHDNLIIRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
Q77P70_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
B2Z9T0_9REOV/1-127                 ..........................t---------...------------------.-.-----...--..----------LHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEV--.....
K4HLB5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCIVTIINTLLKLAGYREQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLATRPVDAIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
V9VFF8_9REOV/10-182                ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDGIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
H9MZN9_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
M1H3Q8_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVKTLEEW.ESGKNPYEPKKVTA.....
D4P8F1_9REOV/1-170                 ...........................---LTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRPTDELDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
T2CE92_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDSLITRPVDSVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
E7CBF6_9REOV/1-170                 ..........................f----TDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
B2Z9U7_9REOV/1-127                 ..........................t---------...------------------.-.-----...--..----------LHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEV--.....
B0ZSX1_9REOV/2-167                 ...........................MENVTTINE...TL-VEEVYNMTLGYFEHNvI.IMKYF...PF..LASILTIIFTAWKMGRSTLKVTKTVAGSGYKVIKVVIVTIFNCVLRIFGSKAEIVPEDKIDVMASKILKQIDEQVKVIEQLTKRELEQVKLLADIYELLKYKSEGNIS--SETNKKA---YETW.--SKDPYQPT----ravs.
S5G3A8_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRTTDEVDMTKEINQKNVRTLKEW.ENGKNPYEPKEVTA.....
H9MZN1_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E7CBM6_9REOV/1-172                 ...........................-DKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
Q5Q1N4_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYREQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTGEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
S5RGJ8_9REOV/2-174                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
B2Z9W4_9REOV/1-124                 ...........................---------...------------------.-.-----...--..--------------SIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQFTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLIIRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
D1GGS8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKHCMVTIINTLLKLAGYKEQVTNKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKSIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ENGKNPYESSEVTA.....
F4YUY0_9REOV/1-157                 ...........................---------...-------MNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVQSAGEIDMTKEINQKNVRTLEEW.ESGRNPYEPKEVTA.....
S5RE41_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.EDRKNPYEPIEVTA.....
M1PJJ2_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFMLHKASIPTMKIALKTSKCSYKMVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRTVDEIDMTKEINQKNVRTLEEW.ENGRNPYEPKEVTA.....
G0YWF6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIVQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLASRPIDAIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
B6E4W7_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCIVTIINRLLKLAGYKDQVTTKDEIEQQMDRIVKEMRCQLEMIDKLTTREIEQVELLKRIHDKLVVRPVDAIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
D2DXN3_9REOV/1-169                 ..........................a-----DLNY...TMNVITLMNDTLHTIIED.P.GMAYF...PY..IASVLTVLFTLHKTSIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDRLTTREIEQVELLKRIHDMLIIKPIEKIDMSKEFNQKQFKTLDEW.ADGENPYEPKEVTA.....
D7NN69_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..ITSVLTVLFMLHKASIPTMKIALKTSKCSYKMVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRTVDEIDMTKEINQKNVRTLEEW.ENGRNPYEPKEVTA.....
Q91E94_9REOV/1-173                 ...........................MEKLTDLNY...TLGVITLMNSTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRPTDDIDMTKEINQKNIKTLEEW.ENGRNPYEPKEVTA.....
D2CSV0_ROTHU/1-173                 ...........................MDKLADLNY...TLSVVPLMNDTLHSLIQD.P.GMAYF...PY..IASFLTVLFTLHKASIPTMTIALKTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRPLEMIDKLTTREIEQVELLKRIHDNLITRPVDVKDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
B0ZSW8_9REOV/4-169                 ...........................MENVTTINE...TL-VEEVYNMTLGYFEHNvI.IMKYF...PF..LASILTIIFTAWKMGRSTLKVTKTVAGSGYKAIKVVIVTIFNCVLKMFGSKAEIVPEDKMDVMASKILKQIDEQVKVIEQLTKRELEQVKLLADIYELLKYKSEGSIS--SETNRKA---YETW.--SKDPYQPT----ravs.
E3W552_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLLNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLVTRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q8B4J2_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIITIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMAKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
C1K3J4_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITMFNCVMRLFGSKTEMVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
A0A024CFI7_9REOV/1-173             ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTTINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
B7ZGW8_9REOV/1-155                 ...........................-----DLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSRCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLIIKPVDKIDMSQEFNQRQFKTLTEW.--------------v....
C1K3J7_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITMFNCVMRLFGSKTEMVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
F4YUY5_9REOV/1-158                 ...........................---------...------LMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKVALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
B2Z9U2_9REOV/1-127                 ..........................t---------...------------------.-.-----...--..----------LHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDKW.ESGKNPYEPSEV--.....
G0YY15_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFMLHKASIPTMKIALKTSKCSYKMVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRTVDEIDMTKEINQKNVRTLEEW.ENGRNPYEPKEVTA.....
I3RPU5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDRLTTREIEQVELLKRIHDNLIIRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
D7SC47_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
D0UD24_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPADTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
I6Z1D2_9REOV/1-157                 ...........................---------...-------MNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTPREIEQVELLKRIHDKTMVRPAGEIDMTKEINQKNVKTLEEW.ESGKNPYEPKEVTA.....
Q4G669_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
D1GHA8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
G1CD95_9REOV/1-173                 ...........................MDKLADLNY...TSSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFALHKASIPTMKIALKTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEVEQQMDRIVKEMRRQLEMIEKLTTREIEQVELLKRIHDKLATRPVDVIDMSKEFNQKNVRTLDEW.ESGKNPYEPSEVTA.....
D1GGH0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTTINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPTEVTA.....
F5C5B3_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLVTRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E7CBF1_9REOV/1-171                 ...........................--KFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
A2I7V8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
F8SYY1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDRLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
B2BM84_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
M1PQR0_9REOV/1-168                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFMLHKASIPTMKIALKTSKCSYKMVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRTVDEIDMTKEINQKNVRTLEEW.ENGRNPYEP-----.....
Q9WAI9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQY.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
H6SWT7_9REOV/1-162                 ..........................g---------...---VITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLIVQSTGEIDMTKEINQKNVKTLEEW.ESGRNPYESKEVTA.....
G0ZS21_9REOV/1-173                 ...........................MEKLTDLNY...TSSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRAVDEIDMTKEINQKNVRTLEEW.ENGKNPYEPKEVTA.....
Q4G611_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q7TDX1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTIINTLLKLAGYKEHVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLAVRPVDAIDMSKEINQKNIRTLDEW.ESGKNPYEPSEVTA.....
E0XH91_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTVINTLLKLAGYKEQVTTKDEVEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLRRIYDKLMTRPDDVIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
X2FP91_9REOV/1-173                 ...........................MEKLADLNY...TLGVITLLNDTIHNILEE.P.GMVYF...PY..IVXALTVLFTMHKASLPAMKLAMRTSQCSYRIIKRVVVTLINTLLRLGGYNDYLTDKDETEKQINRVVKELRQQLTMIEKLTTREIEQVELLKRIYDMMIVRHDSEIDMSKETNQKAFKTLHDW.KNDRSYDDNTEVI-a....
NSP4_ROTH1/1-173                   ...........................MDKFTDLNY...TLNVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCTVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDRLTTREIEQVELLKRIHDKLMVQSTGEIDMRKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
C5IAV7_9REOV/1-173                 ...........................MEKLADLNY...TLGVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASVPTMKIALKTSKCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLVIKPVDKIDMSKEFNQKNFKTLSEW.ADGENPYEPKEVTA.....
G3FZG4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNETLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHRASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPADIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
Q2PF44_9REOV/1-173                 ...........................MDKLADLSY...TLSVITLMKDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREKEQVESLKRIHDILITRPVDIVDMTKEFNQKNVKTLHEW.QNGKNPYEPIEVTA.....
Q91E92_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTIMED.P.GMAYF...PY..IAFVLTVLFTLHKASIPTMKIALRTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEIRRQLEMIDRLTTREIEQVELLKRIHDKLMARSTDGIDMTKEINQKNVKTIEEW.ENGRNPYEPKEVTA.....
B0LWB3_9REOV/1-163                 ...........................---------...-LSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTLKIALKTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLITKPVDVIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
A0A024CGP4_9REOV/1-173             ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKCCIVTFFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSIDGVDMTKEINQKNIRTLEEW.ESGKNPYEPKEVTA.....
F5C5Q6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPIDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E7ECS5_9REOV/8-180                 .........................ik--VLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
I6ZZ03_9REOV/1-135                 ...........................---------...-------MNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKTVVRSTDEIEMIDK------------.--------------nkek.
Q1G1S9_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGCKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
L7T8T1_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKVAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKHIYDKLIVQSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
M1KCN5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
Q99IB1_9REOV/2-174                 ...........................MEKLTDLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASLPTMKIALKTSRCSYKVIKYCIVSMFNTLLKLAGYKEQMTTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDMLIATSVDKIDMTQEFNQKHFKTLNEW.AEGENPYKPKEVTA.....
K9ZUH3_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTIRTADEIDMTKEINQKNVRTLKEW.ENGKNPYEPKEVTA.....
NSP4_ROTS1/1-173                   ...........................MEKLTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLTGLFALNKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVQTTGEIDMTKEINQKNVRTLEEW.ESGKNPYEPREVTA.....
#=GR NSP4_ROTS1/1-173        SS    ...........................XXXXXXXXX...XXXXXXXXXXXXXXXXXX.X.XXXXX...XX..XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCSH-XXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXXXXXX.....
M1PIA2_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTILED.S.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMKRQLEMIDKLTTREIEQVELLKRIYDKLMIRTADEMDMTKEINQKNVRTLKEW.ENGKNPYEPKEVTA.....
Q1G1U7_9REOV/1-170                 ...........................---LTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIMLSIGEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
I6Z1C9_9REOV/1-157                 ...........................---------...-------MNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQWEMIDKLTTREIEQVELLKRNYDKLVVRTTDEIEMAKEINQKNVRALKEW.ENGKNPYEPKKVTA.....
Q4G645_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E7CBM0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
G9DDQ6_9REOV/1-165                 ...........................--------Y...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNVKTLDEW.ENGKNPYEPIEVTA.....
S5I907_9REOV/1-123                 ...........................---------...------------------.-.-----...--..---------------IPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
M1PSI1_9REOV/14-186                ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIINTLLKLAGYKDQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDVTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
C7EWR9_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLNYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
A0EXC3_9REOV/1-164                 ...........................---------...TLSMITLVNDTLHSIIPN.S.GMAYF...PY..IASVLTILFTLHKASIPTVKIALKTSKCSYKVIKYCIVTIINALLKLAGFKGQVTTNDEIEKQMDRVVKEMQRQLEMIDKLTTREIEQVELLKRIYDKLMVKNVDAIDMSKEFNQKNIKTLDEW.ENGRNPYEPSEVTA.....
M1KHS4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTTINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPTEVTA.....
A8JYK2_9REOV/1-162                 ...........................---------...--SVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDRLMVQSAGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
S5IGI9_9REOV/7-179                 ...........................MDKLADLNY...TMNVITLMNDTLHTIIED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDRLTTREIEQVELLKRIHDMLIIKPIEKIDMSKEFNQKQFKTLDEW.TDGENPYKPKKVTA.....
C1K3K1_9REOV/1-166                 .enatsinetfveevynmtlsyfehnv---------...------------------.I.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITMFNCVMRLFGSKTEMVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
Q4G654_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLTLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTGEIDMTKEINQKNVRTLEEW.EDGKNPYEPKEVTA.....
E7ECQ5_9REOV/8-180                 .........................ik--VLADLNY...TLSVITLMNDILHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
V9VIK1_9REOV/10-182                ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGHKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
A9ZQ54_9REOV/1-173                 ...........................MDKLADLNY...TMNVITLMNDTLHTIIED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDRLTTREIEQVELLKRIHDMLIIKPIEKIDMSKEFDQKQFNTARCHgQKVINPYD------strts
H6VV39_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLRLAGYKEQVTTKDEVEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKALDEW.ENGKNPYEPIEVTA.....
S5R9Q0_9REOV/1-125                 ...........................---------...------------------.-.-----...--..-------------ASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
M1QWC6_9REOV/1-173                 ...........................MDKLADLNY...TLSVVTLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDKLAARSVDAIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
D1GG15_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRSVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
M1HHC5_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
M4VN72_9REOV/1-168                 ...........................-----DLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKCCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTDGIDMTKEINQKNIRTLEEW.ESGKNPYEPKEVTA.....
Q4G666_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVTKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
E7CBK5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
S5I2Z3_9REOV/1-128                 ...........................---------...------------------.-.-----...--..----------LHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
C8C1J9_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
Q9WN92_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPIDVIDMSKEFNQKNIKTLDEW.ESGKNPYESLEVTA.....
E5LLE5_9REOV/8-180                 .........................ik--VLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
D1GHL6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
B0ZSY5_9REOV/3-169                 ...........................MENATSINE...TF-VEEVYNMTLSYFERNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
E7CBK1_9REOV/1-171                 ...........................--KFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
G0YVY3_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFALHKASIPTMKIALKTSKCSYKVIKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDRLMVRPIDEIDMTKEINQKNIKTIEEW.GNGKNPYEPKEVTA.....
E5L0C0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTVINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVTRPVDVIDMSKEFNQKNVRTLDEW.ESGKNPYEPSEVTA.....
S5IGI2_9REOV/1-124                 ...........................---------...------------------.-.-----...--..--------------SIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
E7ECS8_9REOV/8-180                 .........................ik--VLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
K4I0B8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDSVDVTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
Q1KZY6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTVINTLLKLAGYKEQVTTKGEIEQQMDRIVKEMRRHLEMIDKLTTREIEQVELLKRIHDKLAVRPVDAIDMSKEISQKNIRTLDEW.ESGKNPYEPSEVTA.....
B7ZGV1_9REOV/1-154                 ...........................-----DLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLVVRSTDEIDMTKEINQKNVKTLEEW.--------------.....
Q8V788_9REOV/1-166                 ...........................MENVTTINE...TL-VEEVYNMTLGYFEHNvI.IMKYF...PF..LASVLTIIFTAWKMGRSTLKVTKTVAGSGYKVIKVVVVTIFNCVLRMFGSKTEIVSEDKMDVMASKILKQIDEQVKVIEQLTKRELEQVKLLADIYELLKYKSEGNIS--SETNRKA---YETW.--SKDPYQPT----ravs.
A5H1R4_9REOV/1-158                 ...........................---------...------LMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYNKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
Q3LRN2_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTVINTLLKLAGYKEQVTTKEEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDRLVTRSVDVIDMSKEFNQKNIRTLDEW.ENGKNPYEPSEVTA.....
S5RE52_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEMEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
B0ZSX9_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIVFTAWKMGKSTLKVTKTVAGSGYKVVRVVVITIFNCVMRLLGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMKK-NDIDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
F5C602_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
B2Z9T2_9REOV/1-126                 ...........................---------...------------------.-.-----...--..----------LHKASIPTIKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEV--.....
Q9Z043_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASVPTMKIALRTSKCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIRDMLIIKPADKIDMSQEFNQKHFKTLNEW.AEGENPYEPKEVTA.....
B3SRW4_9REOV/1-173                 ...........................MEKLTDLNY...TLGVITLMNSTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRPTDDIDMTKEINQKNIKTLEEW.ENGRNPYEPKEVTA.....
C7EWR8_9REOV/1-166                 .enatsinetfveevynmtlsyfehnv---------...------------------.I.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEIVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
D7SC36_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDSLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
B0LWB0_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTLKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDRLTTREIEQVELLKRIHDKLITRPVDVIDMSKEFNQKNIRTLDEW.ENGKNPYEPSEVTA.....
M1PZR0_9REOV/1-160                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDRLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.E-------------.....
H9MZN4_9REOV/1-170                 ..........................f----TDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTVLNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDETDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
S5RE72_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
C7SB29_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPADVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
S5RGH9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMINKLTTREIEQVELLRRIYDKLVTRPIDVIDMSKEFNQKNVRTLDEW.ESGKNPYEPSEVTA.....
I6Z1C5_9REOV/1-115                 ...........................---------...-------MNSTLHTILED.P.GMAYF...PY..IASVLTILFTLHKASIPTMKMALKTSKCSYKVVKYCIVTIFNTLFKLAGYKEQITTKDEIDKQMDRVVKEMRRQLKMIEKLTTREIEQVELLKRIY----------------------------.--------------.....
U5XK68_9REOV/2-164                 ...tsinetfveevynmtlsyfehnvi---------...------------------.-.IMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVAGSGYKVVRVVVITVFNCVMRLFGSQTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMKK-NDVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
A9ZP21_9REOV/1-153                 ...........................MDKLADLNY...TLSVITVMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKSSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMVRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFDQ---------.--------------cdh..
S5K2A1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTSHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIIDMTKEFNQKNVKTLDEW.ENGKNPYEPIEVTA.....
Q2VC39_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTVLNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
S5U3H0_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLGMIDKLTTREIEQVELLKRIYDKLMIRTADEIDMTKEINQKNVRTLKEW.ENGKNPYEPREVIA.....
Q9WAI4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVIKYCLVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPANVLDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
B0ZSX4_9REOV/1-162                 ...tainetlveevynmtlgyfehnvi---------...------------------.-.IMKYF...PF..LASILTITFTAWKMGRSTLKVTKTVAGSGYKVIKVVIVTIFNCVLRIFGSKAEIVSEDKMDVMASKILKQIDEQVKVIEQLTKRELEQVKLLADIYELLKYKSGES--ISSETNRKA---YETW.--SKDPYQPT----ravs.
H9MZP5_9REOV/1-170                 ..........................f----TDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTVLNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDETDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
B2Z9V9_9REOV/1-127                 ..........................t---------...------------------.-.-----...--..----------LHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEV--.....
H9MZQ7_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
S4S3F5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
I3RPU1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDRLTTREIEQVELLKRIHDNLIIRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
Q4G613_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDKW.ESGKNPYEPSEVTA.....
E7CBM8_9REOV/1-165                 ...........................--------Y...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
X4Y0J6_9REOV/1-173                 ...........................MEKLADLNY...TLSVITLMNDTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVIKYCIVSVFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLIVKPVNKIDMSQEFNQKHFKTLNEW.AEGENPYESREVTA.....
D1G6C1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKIIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVTRSVDAIDMSKEFNQKNIRTLDEW.ENGKNPYEPSEVTA.....
B6SAL6_ROTD9/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASLPTMKIALKTSRCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQIELLKRIYDMLIATSVDKIDMTQEFNQKHFKTLNEW.AEGENPYKPKEVTA.....
D0UD29_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVQSAGEIDMTKEINQKNVRTLEEW.ESGRNPYGPKEVTA.....
O55588_9REOV/1-167                 ...........................MENATTINE...TL-VEEVYNMTMSYFEHNvI.IMKYF...PF..LASILTIAFTAWKMGKSTFKVTKTVAGSGFKIVRVVVITIFNCVMRLFGSKTEVVSDDRLDALASKILAQIDNQVKVIEQLTKRELEQVKLLADIYEMLKFK-KDEIDMSFETNKKE---YEKW.--VKDPYQPT----ravs.
H2EUN3_9REOV/1-166                 ...........................MENVTTINE...TL-VEEVYNMTLGYFEHNvI.IMKYF...PF..LASILTIIFTAWKMGRSTLKVTKTVAGSGYKVIKVVIVTIFNCVLRMFGSKTEIVSEDKMDVIASKILKQIDEQVKVIEQLTKRELEQVKLLADIYELLKYKSEGSV--SSETNKKA---YETW.--SKDPYQPT----ravs.
D1GGN0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q9Z042_9REOV/1-173                 ...........................MEKLTDLNY...TLNVITLLNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIRPTDEIDMTKEINQKNVKTLEEW.ENGKNPYESKEVTA.....
E7CBL7_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
M9Q2Q7_ROTHU/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCTVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
U5XK61_9REOV/2-164                 ...tsinetfveevynmtlsyfehnvi---------...------------------.-.IMKYF...PF..LASILTIVFTVWKMGKSTLKVTKTVAGSGYKVVRVVVITMLNCVMRLFGSQTEMVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMKK-NDVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
E7ECQ8_9REOV/8-180                 ...........................MDMLSDLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIVKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
G1FWB6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRSVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
J9QLB0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTIVNTLLKLAGYKEQVTTKGEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLITRPTDVIDMSKEFNQKNVRTLDEW.ESGKNPYEPSEVTA.....
Q9W927_9REOV/1-173                 ...........................MDKLTDLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPANAVDMSKEFNQKNIKTLDEW.KSGRNPYEPSEVTA.....
Q808S8_9REOV/1-137                 .........................rl---------...------------------.-.-----...--..---VVTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
G1FVZ9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
S5RGG7_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.EDGKNPYEPIEVTA.....
Q3LRN9_9REOV/1-166                 ...........................-------NY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASVPTMKIALKTSKCSYKVIKYCMITIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
X2G3U1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
D7SC40_9REOV/1-170                 ...........................---LADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDSLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
E2ICT2_9REOV/7-179                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVKTLEEW.ESGKNPYEPKEVTA.....
B0ZSW7_9REOV/2-153                 .............vynmtlgyfehnai---------...------------------.-.IMKYF...PF..LASILTIIFTAWKMGRSTLKVTKTVAGSGYKAIKVVIVTIFNCILRMFGSKAEIVPEDKMDVMASKILKQIDEQVKVIEQLTKRELEQVKLLADIYELLKYKSEGSIS--SETNKKA---YETW.--SKDPYQPT----ravs.
NSP4_ROTE2/1-173                   ...........................MDKLTDLNY...TLNVITLLNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRHLEMIDKLTTREIEQVELLKRIYDKLMARATDEIDMTKEINQKNVKTLEEW.ENGKNPYESKRMTA.....
M1HMG5_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLRLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVQSIGEIDMTKEINQKNVKTLEEW.ESGINPYEPKEVTA.....
Q4G661_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
M4ZUT3_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEMEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSNSEIDMTKEINQKNVRTLEEW.ESGKNPYEPREVTA.....
Q3LRN6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTVINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLIIRPVDAIDMSKEFNQKNVKTLDEW.ESGKNPYEPSEVTA.....
Q4G619_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTVINTLLKLAGYKEQVTTKDGIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDGIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
Q1G1S8_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
D1GGJ4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKCCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLIIKPVDVIDMSKEFNQKNIKTLDEW.ENGKNPYEPLEVTA.....
S5S0Q4_9REOV/2-174                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMINKLTTREIEQVELLKRIHDNLITRPADIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
Q6L5Y0_9REOV/1-173                 ...........................MDKLADPHY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTIISPLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLAARPVDAIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
Q4G639_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVTKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDSLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E2ICT3_9REOV/7-179                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKDQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
J9QLA5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLITRPTDVIDMSKEFNQKNVRTLDEW.ESGKNPYEPSEVTA.....
E7ECS4_9REOV/8-180                 .........................ik--VLADLNY...TLSVITLMNDIEISIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKLVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E7ECS1_9REOV/8-180                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKMIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMKRQLEMIDKLTTREIEQVELLKRIHDNLITRSVDIIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
H9N1A3_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFMLHKASIPTMKIALKTSKCSYKVIKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRTVDEIDMTKEINQKNVRTLEEW.ENGKNPYEPKEVTA.....
M1JRV8_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLLNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
C1K3I3_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
U5XJD3_9REOV/2-164                 ...tslnetfveevynmtlsyfehnvi---------...------------------.-.IMKYF...PF..LASILTIVFTVWKMGKSTLKVTKTVAGSGYKVVRVVVITMLNCVMRLFGSQTEMVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMKK-NDVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
E7CBH1_9REOV/1-172                 ...........................-EKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
D7SC48_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
L0HST5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKCIRDNLITRPVNVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
B5KFX3_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLPTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMXIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
B7ZGW4_9REOV/1-154                 ...........................-----DLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQVTTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLVVRSTDEIDMTKEINQKNVKTLEEW.--------------.....
A9ZP20_9REOV/1-173                 ...........................MDKLADLNY...TLSKSLLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHRASIPTMKIALKTSQCSYKVIKYCIGTIINTLFKLGGYKEQVTTKDEIEQQMDRIVKKPRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
H6UJ57_9REOV/1-172                 ...........................MDKLADLNY...TLSVITL-NDTLHSIVQD.P.GMAYF...LY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTVINTLLRLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
C1K3L1_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITMFNCVMRLFGSKTEMVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
E7CBN5_9REOV/1-171                 ...........................--KLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDSLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
F5C6A3_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
T2HRC9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIIDMTKEFNQKNVKTLDEW.ENGKNPYEPIEVTA.....
Q2VC33_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
B2Z9V3_9REOV/1-127                 ..........................t---------...------------------.-.-----...--..----------LHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEV--.....
M1Q7V2_9REOV/14-186                ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASVPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLVVRSTDEIDMTKEINQKNVKTLKEW.ESGKNPYEPKEVTA.....
L7ZAY3_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKDQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
I3RPU0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDRLTTREIEQVELLKRIHDNLIIRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
S5R273_9REOV/1-156                 ...........................---------...--------NDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
B0ZSZ1_9REOV/2-154                 ............vynmtlsyfeqnvil---------...------------------.-.-MKYF...PF..LASILTIMFTAWKMGKSTLKVTKTVAGSGYKVVRVVAITVFNCIMRLFGSKTEMVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKM-TKSDVDMSFETNKKE---YEKW.I--KDPYQPT----ravs.
E7ECR8_9REOV/8-180                 .........................ik--DLNYLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
B2Z9T9_9REOV/1-127                 ..........................t---------...------------------.-.-----...--..----------LHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEV--.....
W0I9V3_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVNEMRCQLEMIDKLTTREIEQVELLKRIHDKLVVRPVDAIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
I1TJT6_9REOV/1-173                 ...........................MDKQADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
E7CBJ0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
B7ZGW5_9REOV/1-154                 ...........................-----DLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTLKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTAKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLIIRPADAIDMSKEFNQKNIRTLDEW.--------------.....
U5XJA8_9REOV/2-164                 ...tsinetfveevynmtlsyfehnvi---------...------------------.-.IMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVAGSGYKVVRVVVITVFNCVMRLFGSQTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMKK-NDVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
S5R268_9REOV/1-131                 ...........................---------...------------------.-.-----...--..-------LFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
E3W4V6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
V5IX06_9REOV/1-173                 ...........................MEKLADLNY...TLSVITLMNDTLHSIIQD.S.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
B2Z9U8_9REOV/1-127                 ..........................t---------...------------------.-.-----...--..----------LHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEV--.....
E7ECQ9_9REOV/8-180                 .........................ik--VLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
D2KQT2_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVIKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVQSTDEIDMTKEINQKNVRTLKEW.ESGKNPYEPKEVTA.....
G9DDP9_9REOV/1-165                 ...........................--------Y...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
A0A024FCJ0_9REOV/1-173             ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTVINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLAVRPFDAIDMSKEINQKNIRTLDEW.ESGKNPYEPSEVTA.....
O11981_9REOV/1-173                 ...........................MEKLADLNY...TLGVITLLNDTLHNILEE.P.GMVYF...PY..IASALTVLFTMHKASLPAMKLAMRTSQCSYRIIKRVVVTLINTLLRLGGYNDYLTDKDETEKQINRVVKELRQQLAMIEKLTTREIEQVELLKRIYDMMVVRQNREIDMSKETNQKAFKTLHDW.GNDRNYDDNTDV--ia...
C1K3J6_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITMFNCVMRLFGSKTEMVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
H9BPG1_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
S5R536_9REOV/1-120                 ...........................---------...------------------.-.-----...--..-------LFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVREMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESG-----------.....
Q8VA30_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFALHKASIPTMKIALKTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVTRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E3W5C4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIVKPVDVIDMSKEFNQKNIKTLDEW.ENGKNPYKPLEVTA.....
I6VGG2_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAFF...PP..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDRLMVRSTDEIDMTKEINQKNVKTLEEW.ENGRNPYEPKEVTA.....
S5RLK9_9REOV/2-174                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
A8JNY6_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILEE.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVQSAGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
S5RE46_9REOV/2-174                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMINKLTTREIEQVELLRRIYDKLVTRPIDVIDMSKEFNQKNVRTLDEW.ESGKNPYEPSEVTA.....
B2Z9U4_9REOV/1-121                 ...........................---------...------------------.-.-----...--..-----------------TMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
F5AY55_9REOV/8-180                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGCKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
S5RDZ8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMINKLTTREIEQVELLKRIHDNLITRPADIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
Q98VJ6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSELTA.....
E7CBJ8_9REOV/1-152                 ...........................-------NY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.--------------.....
A0A023NBK3_9REOV/1-173             ...........................MDKLADLNY...TLSAITSMNDTLHSIIQD.P.GMAYF...LY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q4G624_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDENEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
A0A024CDT5_9REOV/1-173             ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRTTDEIDMTKEINQKNVKTLEEW.ENGRNPYEPKEVTA.....
H9MZQ5_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
Q8UYH4_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKMALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
A5X357_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVARPVDAIDMSKEFNQKNIRTLDEW.ENGKNPYEPSEVTA.....
D0QB70_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
K4HLK7_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTVINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQVEMIDKLTTREIEQVELLKRIHDKLMTRPADVIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
A9ZP26_9REOV/1-124                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQV-----------------------------------.--------------.....
C1K3K0_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTVWKMGKSTLKVTKTVTGSGYKVVRVVVITMFNCVMRLFGSKTEMVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
D0E2W6_9REOV/1-171                 ...........................--KLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTILFTLHKASIPTMKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVARPVDAIDMSKEFNQKNIRTLDEW.ENGKNPYEPSEVTA.....
D9HP94_9REOV/1-146                 ...........................---------...------------------.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLIVQSTGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
M4ZQX3_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYSMVTIINTLLKLAGYKEQVTTKDEVEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLVTRPVDVIDMSKEFNQKNVRTLDEW.ESGKNPYEPSEVTA.....
B2Z9W7_9REOV/1-124                 ...........................---------...------------------.-.-----...--..--------------SIPTMKIALKASKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E7CBN6_9REOV/1-170                 ..........................f----TDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
Q4G665_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
B0ZSX8_9REOV/3-169                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVAGSGYKVVRVVVITMFNCVMRLLGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMRK-NDIDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
Q9IVG1_9REOV/1-134                 ...........................---------...------------HSIIQD.P.GMAYF...LY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKT----.--------------.....
M4Q592_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPADXIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
A9ZP24_9REOV/1-173                 ...........................MDKLADLNY...MWTVITLMNDTLHSIIHD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
S5R9P6_9REOV/9-181                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
Q2VC40_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASVPTMKIALKTSRCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIERQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRPTDDIDMTKEINQKNVKTLEEW.ESGKNPYETKEVTA.....
A9ZP39_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKCIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
E7ECT7_9REOV/8-180                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIVKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q80FH4_9REOV/1-125                 ...........................---------...-----------------D.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQK--------.--------------.....
S5RLH9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNETLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPANIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
M1KIN9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
H9MZL9_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
P87713_9REOV/1-162                 ...........................--------Y...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKE---.....
B2Z9V4_9REOV/1-127                 ..........................t---------...------------------.-.-----...--..----------LHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEV--.....
B2Z9T6_9REOV/1-127                 ..........................t---------...------------------.-.-----...--..----------LHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEV--.....
B6SAJ4_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASLPTMKIALKTSRCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLITTSIDKIDMTQEFNQKHFKTLDEW.AEGENPYKPKEVTA.....
H9MZP8_9REOV/1-170                 ...........................---LADLNY...TLSVIALMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
B5KFX7_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIFNTLMKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLRRIHDKLIVQSTGGIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
T2HRR4_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTLLED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.KSGRNPYEPKEVTA.....
S5S2T2_9REOV/2-174                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKCIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
Q4G610_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GIAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
V5IX72_9REOV/1-173                 ...........................MEKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
D1GH00_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E0XH94_9REOV/1-163                 ...........................---------...-LSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQVEMIDKLTTREIEQVELLKRIHDKLVTRPADVIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
C3TTS7_9REOV/1-166                 ...........................MENVTTINE...TL-VEEVYNMTLGYFEHNvI.IMKYF...PF..LASILTIIFTAWKMGRSTLKMTKTVAGSGYKVIKVVVVTVFNCILRIFGSKTEIVSEDKMDVMASKILKQIDEQVKVIEQLTKRELEQVKLLADIYELLKYKSEGNVP--SETNRKA---YETW.--SKDPYQPT----ravs.
Q3LRN0_9REOV/1-164                 ...........................---------...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCMVTTINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLITRPADVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
S5RE61_9REOV/2-174                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSISEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
Q4G609_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDKW.ESGKNPYEPSEVTA.....
E7ECS3_9REOV/8-180                 ...........................MDKLADLNY...TLSVITLMNDTLESIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
M1H617_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCTVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMINKLTTREIEQVELLRRIYDKLVTKPVDVIDMSKEFNQKNVRTLDEW.ENGKNPYEPSEVTA.....
C9DQ52_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLVVRSTDEIDMTKEINQKNVKTLEEW.ESGKNPYEPKEVTA.....
D5G326_9REOV/1-173                 ...........................MEKLADLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVIKYCIVSVFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLIVKPVNKIDMSQEFNQKHFKTLNEW.AEGENPYESREVTA.....
Q9PX30_9REOV/1-173                 ...........................MDKLTDLNY...TLSVITLMNSTLHAILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVIKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVIREMRRQLEMIDKLTTREIEQVELLRRIYDRLTVRKTDEIDMSKEINQKNIRTLDEW.ENGKNPYEPSEVTA.....
S5GG98_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVIKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVQSTDEIDMTKEINQKNVRTLKEW.ESGKNPYEPKEVTA.....
D4P8F2_9REOV/1-171                 ...........................--KLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRPTDELDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
D0UD16_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITIPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
Q4G674_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRRLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
B5ATM5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
A0A023UHV9_9REOV/1-128             ...........................---------...------------------.-.-----...-Y..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESG-----------.....
S5GIX1_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVQSTGEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
F5AXY3_9REOV/8-180                 .........................ik--VLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
B7ZGV2_9REOV/1-155                 ...........................-----DLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSRCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLIIKPVDKIDMSQEFNQRQFKTLTEW.--------------v....
S5RLM4_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
F5C491_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
P87718_9REOV/1-162                 ...........................--------Y...TLSVITLMNRTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKITTREIEQVELLKRIYDKLIVQSTSEIDLTKEINQKNVKKLEEW.ESGKNPYEPKE---.....
B5ATN0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
Q7TDP2_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..VASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDRLMVRPIDEIDMTKEINQKNIKTIEEW.GNGKNPYEPKEVTA.....
M1Q7U8_9REOV/14-186                ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDGIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
T2CCQ8_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYRVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDRLVTQPTDGVDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
Q1WEV4_ROTHU/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLEEW.ENGKNPYEPIEVTA.....
F5C4G3_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
H6SWU0_9REOV/1-166                 ...........................-------NY...TLGVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLIVQSTGEIDMTKEINQKNVKTLEEW.ESGRNPYESKEVTA.....
Q9PYD6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVVRPVDVIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
F5C4C7_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDSLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
Q2PGE3_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ENGKNPYEPKEVTA.....
D1GHJ2_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
A3EZQ7_9REOV/1-168                 ...........................-----DLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASALTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVSTFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLIIKPIDEIDMSQEFNQKHFKTLNEW.AEGENPYEPKEVTA.....
H9MZP1_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
S5RLH3_9REOV/2-174                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPADIVDMTKEFNQKNIKTLDEW.ESGKNPYEPTEVTA.....
C1K3J3_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVTQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
A9CQ83_9REOV/1-173                 ...........................MDKLADLNY...TLRVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKSAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
E2J334_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTTINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPTEVTA.....
D7SC49_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
Q80FH3_9REOV/1-142                 ...........................---------...------------------.-.---YF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
E7CBL0_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
B5KFX6_9REOV/1-173                 ...........................MEKLTDLNY...PLGVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLIVQSTGGIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
A9ZP40_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCVVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
F5C7A8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
E0XH88_9REOV/1-156                 ........................tah---------...-----------SHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIRTANEIDMTKEINQKNVRTLKEW.ENGKNPYEPKEVTA.....
M1KH37_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKSIHDNLMTRPADVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q80FH5_9REOV/1-125                 ...........................---------...-----------------D.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRSVDIVDMTKEFNQK--------.--------------.....
E7D6L4_ROTHU/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNFKTLDDW.ESGKNPYEPIEVTA.....
I2CN89_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLKMIDKLTTREIEQVELLKRIHDNLITRPVDAIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
M1PYM5_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTVLED.S.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIRTADEMDMTKEINQKNVRTLKEW.ENGKNPYEPKEVTA.....
B7SY70_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEMEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLITRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
I1SST1_9REOV/1-173                 ...........................MEKLTNLNY...TLGVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLIVQSTGEIDMTKEINQKNVKTLEEW.ESGRNPYESKEVTA.....
D9MX00_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDRLTTREIEQVELLKRIHDNLITRPVDTMDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
G5CPK4_9REOV/1-170                 ...........................---LTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PS..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEKITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTDGIDMTKEINQKNIKTLEEW.ESGKNPYEPKEVTA.....
U5KM56_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDRLMVRPTDEIDMTKEINQKNVKTLEEW.ESGKNPYEPKEVTA.....
V9TKF0_9REOV/10-182                ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGGIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
E2J382_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTTINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPTEVTA.....
C7SAQ7_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIIDMTKEFNQKNIKTLDEW.KSGKNPYEPIEVTA.....
C3RX26_9REOV/1-173                 ...........................MEKLTDLNY...TLSVVTLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASVPTMKIALKTSKCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIERQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLIIKPVDKIDMSQEFNQKYFKTLNDW.AEGENPYEPKEVTA.....
I3QD96_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTGEIDMTKEINQKNVRTLEEW.ESGRNPYEPKEVTA.....
E9NAZ4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDSLINRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
S4SB62_9REOV/1-171                 ...........................--KLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASLPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMAQPTDNIDMTKEINQKNVKTLAEW.ENGKNPYEPKEVTA.....
X4Y7W2_9REOV/1-173                 ...........................MDKLTDLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGCKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
M1H7X4_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIINTLLKLAGYKDQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
A8HI55_9REOV/1-168                 ...........................-----DLNY...TLSVITLMNSTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIERQMDRVVKEMRRQLEMIDRLTTREIEQVELLKRIYDKLMIRSTDEIDMTKEINQKNVKTLEEW.ENGRNPYEPKEVTA.....
E0YLJ0_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVKTLEEW.ESGKNPYEPKEVTA.....
H2EHT4_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASLPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMAQPTDNIDMTKEINQKNVKTLAEW.ENGKNPYESKEVTA.....
S4VFZ8_ROTHU/1-171                 ...........................MDKLADLNY...TMNVITLMNDTLHTIIED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDRLTTREIEQVELLKRIHDMLIIKPIEKIDMSKEFNQKQFKTLDEW.TDGENPYKPKEV--.....
G3FZF3_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDSLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
E2ICT1_9REOV/7-179                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKDQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
T1RQ01_9REOV/1-166                 ...........................MENVTTINE...TL-VEEVYNITLGYFEHNvI.IMKYF...PF..LASILTIIFTAWKMGSSTLKVTKTVAGSGYKVIKVVIVTIFNCILKIFGSKTEIVPEDKMDMMASKILKQIDEQVKVIEQLTKRELEQVKLLADIYELLKYKS--EETVSSGINKKAYDT---W.N--KDPYQP-----travs
F5B529_9REOV/8-180                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
L7V334_9REOV/1-173                 ...........................MDKLADLNY...TMNVITLMNDTLHTIIED.P.GMAYF...PY..IASVLTILFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDRLTTREIEQVELLKRIHDMLIIKPIEKIDMSKEFNQKQFKTLDEW.TDGENPYKPKEVTA.....
E7ECR7_9REOV/8-180                 ...........................MDMLSDLNY...TLSVITLMNDPLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
I3QDA7_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFMLHKASIPTMKIALKTSKCSYKMVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRTVDEIDMTKEINQKNVRTLEEW.ENGRNPYEPKEVTA.....
S5S0U8_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ENGRNPYEPKEVTA.....
Q9Z041_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFALHKASIPSMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRPTDEIDMTKEINQKNVKTLKEW.ENGKNPYEPKEVTA.....
D1GGE7_9REOV/1-173                 ...........................MDKLAGLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKCCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLIIKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
Q6WEB4_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLKMIDKLTTREIEQVELLKRIYDKLLVRSTDEIDMTKEINQKNVKTLEEW.ESGKNPYEPKEVTA.....
G5CPK0_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEKITTKDEMEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRTTDEIDMTKEINQKNVRTLKEW.ENGKNPYEPKEVTA.....
L0GCX5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...SY..IASVLTVLFILHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
F5C541_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLVTRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
V5LGP1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIERQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPADIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
B0LWB4_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTLKIALKTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLITRPVDVIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
A9ZP18_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKELVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
F5C6X6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
Q2N3R8_9REOV/1-173                 ...........................MEKFTVLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYREQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTVRSTDEIDMTKEINQKNVRTLKEW.ESGKNPYEPKEVTA.....
Q80AP9_9REOV/1-173                 ...........................MDKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVIKYCIVTIFNTLLKLAGCKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLRRIYDKLTVRRTDEIDMLKETNHKNIRTLNEW.ENGENPYEPSEVTA.....
B2Z9U0_9REOV/1-127                 ..........................t---------...------------------.-.-----...--..----------LHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEV--.....
V5IX74_9REOV/1-173                 ...........................MEKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q1G1S6_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GIAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKCCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
F5C6G9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPIDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
C1K3I5_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVTQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
H2DLU8_9REOV/14-186                ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIRSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
M4VQM9_9REOV/1-168                 ...........................-----DLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKCCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTDGIDMTKEINQKNIRTLEEW.ESGKNPYEPKEVTA.....
B2Z9V6_9REOV/1-127                 ..........................t---------...------------------.-.-----...--..----------LHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEV--.....
M9PLK0_9REOV/1-156                 ...........................---------...--------NNTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRTADEIDMTKEINQKNVKTLKEW.ENGKNPYEPKEVTA.....
I6ZYZ8_9REOV/1-157                 ...........................---------...-------MNSTLHTILED.P.GMAYF...PY..IASVLTILFTLNKASIPTMKMALKTSKCSYKVVKYCIVTIFNTLVKLAGYKEQITTKNEIEKQMDRVVKEMRRQLKMIDKLTTREIEQVELLKRIYDKLMTRTADEIDMRKEINQKNVRTLKEW.ESGKNPYEPKEVTA.....
D1GH60_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKHCMVTIINTLLKLAGYKEQVTNKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKSIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ENGKNPYESSEVTA.....
E0XH98_ROTHU/1-161                 ...........................---------...---VITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTLKIALKTSKCSYKVIKYCMVTIINTVLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVAKPVDVIDMSKEFNQKNIRTLDEW.ESGKNPYKPSEVTA.....
H6VLJ4_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLTGYREQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRPTDEIDMTKEINQKNVKTLEEW.KSGRNPYEPKEVTA.....
F6JTI4_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYEEQITNKDEIEKQIDRVVKEMRRQLEMIDKLTTREIEQVELLRRIYDKLLVQPIDGVDMTKEINQKNIRTLEEW.ENGKNPYEPKEVTA.....
F5C783_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
B0ZSX7_9REOV/4-170                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
Q4G634_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTLKIALKTSKCSYKVIKYCMVTVINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLGTRPVDVIDMSKEFNQKNIKTLDEW.ESGENPYEPSEVTA.....
X4Y3Y4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEKQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKSIKTLDEW.ENGKNPYEPIEVTA.....
S5S2N1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMINKLTTREIEQVELLKRIHDNLITRPADIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
Q2PF43_9REOV/1-173                 ...........................MEKLTDLHY...PLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLGMIDKLTTREIEQVELLKRIHDKLMVQSAGEIDMTKEINQKNVKTLEEW.SYCNHPYEPKEVTA.....
Q9E162_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIITILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDRLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVKTLEEW.ESGKNPYEPKEVTA.....
Q4G672_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTRAIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
L0CRY7_9REOV/1-167                 ...........................MENATTINE...TLI-EEVYNMTISYFEHNvI.IMKYF...PF..LASILTIAFTAWKMGTSTFKVTKTVAGSGFKVVRVVVITIFNCIMRLFGSKTEVVSDDRLDALASKILAQIDNQVKVIEQLTKRELEQVKLLADIYEMLKFK-KDEIDMSFETNKKE---YEKW.--VKDPYQPA----ravs.
Q4G604_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
C1K3H7_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVTQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
B7ZGW0_9REOV/1-154                 ...........................-----DLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIERQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRPTDEIDMTKEINQKNVKTLEEW.--------------.....
C1K3J1_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVTQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
A5HAV2_9REOV/1-158                 ...........................---------...------LMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
F5C7E4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
T2HTS1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
G1FWC7_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E7CBG7_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIIREMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDDW.ESGKNPYGPTEVTA.....
D9HP95_9REOV/1-146                 ...........................---------...------------------.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLIVQSTGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
A3DSK3_9REOV/1-173                 ...........................MDKLADLNY...TMNVITLMNDTLHTIIED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDRLTTREIEQVELLKRIHDMLIIKPIEKIDMSKEFNQKQFKTLDEW.TDGENPYEPKEVTA.....
A0MM86_9REOV/1-164                 ...........................---------...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPADIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
E7D6L0_ROTHU/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNFKTLDDW.ESGKNPYEPIEVTA.....
H9BPF3_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTLKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
Q2VC44_9REOV/1-168                 ...........................-----DLNY...TLSVITLMNDTLHSIIQD.P.GTAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIVKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
M1KBD2_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIXQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
E2EA88_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNALLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRAVDEIDMTKEINQKNVKTLEEW.ENGKNPYEPKEVTA.....
Q4G617_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNNTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQITTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDGIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
U3M0G4_9REOV/1-173                 ...........................MEKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDRLTTREIEQVELLKRIYDNLITRPADIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
T1RPE2_9REOV/1-164                 .nvttinetlveevynitlgyfehnvi---------...------------------.-.IMKYF...PF..LASILTILFTAWKMGSSTLKVTKTVAGSGYKVIKVVIVTIFNCILKIFGSKTEIVPEDKMDIMASKILKQIDEQVKVIEQLTKRELEQVKLLADIYELLKYKSEE--TIPSGINKKAYDT---W.N--KDPYQP-----travs
X4Y203_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKDQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVKTLEEW.ESGKNPYEPKEVTA.....
B7TAC9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDSLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
F5C6U0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCIVTIINTLLKLAGYKEQFTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
S5RLL5_9REOV/2-174                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEMEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
R4I445_9REOV/1-173                 ...........................MEKLTDLNY...TLGVITLXNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKXTTREIEQVELLKRIHDKLIVQSTGEIDMTKEINQKNVKTLEEW.ESGRNXYESKEVTA.....
D5HMU2_9REOV/1-173                 ...........................MDKLADLCY...TLSVITLMNDTLHSIIQD.P.GIAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLAARPVDAIDMSKEFNQKNIRTLDEW.ENGKNPYEPSEVTA.....
NSP4_ROTKU/1-173                   ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTGEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
A9ZP36_9REOV/1-71                  ...........................---------...------LMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYK-------------------------------------------------------------------------.--------------.....
W6CN59_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDGVVKEMRRQLEMIDRLTTREIEQVELLKRIHDKLMVRSTDEIDMTKEINQKNVRTLEEW.ENGRNPYEPKEVTA.....
I3RPU7_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSFKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLAVRPVDTIDMSKEFNQKNVRTLDEW.ESGKNPYEPSEVTA.....
B2ZPL0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.RMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLRLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
S5RMU0_9REOV/8-180                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
V5IX88_9REOV/1-173                 ...........................MEKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E7ECT8_9REOV/8-180                 .........................ik--VLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
S5G915_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVIKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVQSTDEIDMTKEINQKNVRTLKEW.ESGKNPYEPKEVTA.....
X4Y6S7_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDSLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
NSP4_ROTHW/1-173                   ...........................MDKLADLNY...TLSVITSMNDTLHSIIQD.P.GMAYF...LY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q4G621_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLRLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
K4HL13_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTVINALLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQVEMIDKLTTREIEQVELLKRIHDKLMTRPADVIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
U5XLZ4_9REOV/2-164                 ...tsinetfveevynmtlsyfehnvi---------...------------------.-.IMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVAGSGYKVVRVVVITVFNCVMRLFGSQTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMKK-NDVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
E3W472_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIITIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMLKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
V5IX08_9REOV/1-173                 ...........................MEKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNVKTLDEW.ENGKNPYEPIEVTA.....
F5C4F1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
I2FFT2_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDAIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
F1JZT7_9REOV/2-167                 menvstinetlvdevykmtlryfehnv---------...------------------.I.IMKYF...PF..IASILTIIFTAWKMGRSTLKVTKTVAGSRYKVIKVVIVTIFNCVLRIFGSKAEIVPEDKMDVMASIILMQIDEQVKVNEQLRKRELEQVKLLADIYELLKYKTEGNI--CSETNKKG---YETW.--GKDPYQPT----ravs.
I6TST8_9REOV/1-166                 ...........................MENVTTINE...TL-VEEVYNITLGYFEHNvI.IMKYF...PF..LASILTILFTAWKMGSSTLKVTKTVAGSGYKVIKVVIVTIFNCILKIFGSKTEIVPEDKMDIMASKILKQIDEQVKVIEQLTKRELEQVKLLADIYELLKYKSEE--TIPSGINKKAYDT---W.N--KDPYQP-----travs
M1HHG0_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLIVRPTGEIDMTKEINQKNVKTLEEW.ENGRNPYEPKEVTA.....
D7NN65_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLMVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTGEIDMTKEINQKNVRTLEEW.ESGRNPYEPKEVTA.....
H9MZK9_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLIIRPTDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
J9QFX5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKCCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRSVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E9KPE0_9REOV/1-100                 ...........................---------...------------------.-.-----...--..--------------------------------------TIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRTTDEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
A8C4Z4_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEQNvI.IMKYF...PF..LASILTIVFTAWKMGKSTLKVTKTVAGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKM-TKNDVDMSFETNKKE---YEKW.I--KDPYQPT----ravs.
D1GHR4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCVVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
D7SC32_9REOV/1-142                 ...........................---------...------------------.-.---YF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDSLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
X2FYG2_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVTRSVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
C1K3I2_9REOV/1-166                 .enatsinetfveevynmtlsyfehnv---------...------------------.I.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
D3JPT3_9REOV/1-172                 ...........................-EKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IVSVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRTTDEIDMTKEINQKNVRTLKEW.GNGKNPYEPKEVTA.....
D1M901_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMLTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLITRPVDVIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
A0A023UH66_9REOV/1-139             ...........................---------...------------------.-.-----...-Y..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
S5TDL6_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKCIYDKLMIRTADEIDMTKEINQKNVRTLKEW.ENGKNPYEPKEVTA.....
D5J9Y3_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
E7ECT5_9REOV/8-180                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
R4JKL9_9REOV/1-162                 ...........................---------...--SVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDRLITRPADAIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
G0YWF2_9REOV/1-166                 ...........................-------NY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVVRPIDAIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
V5IX87_9REOV/1-173                 ...........................MEKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
A5H1R6_9REOV/1-158                 ...........................---------...------LMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
I3RPT5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDRLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
C3U210_9REOV/14-186                ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
G3FJ68_9REOV/1-159                 ...........................---------...-----TLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKCIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
U5XMG3_9REOV/2-164                 ...tsinetfveevynmtlsyfehnvi---------...------------------.-.IMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVAGSGYKVVRVVVITVFNCVMRLFGSQTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMKK-NDVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
P87715_9REOV/1-162                 ...........................--------Y...TLCVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMMRSIGEIDMTKEINQKNVRTLEEW.ESGKNPYEPKE---.....
Q9E164_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIAVKTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLITRPADVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
A2I7V9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVIKYCMVTIINALLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLITRSVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q1G1T1_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGCKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
Q8AYX5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GIAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLVTRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
A8C4Z9_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEQNvI.IMKYF...PF..LASILTIVFTAWKMGKSTLKVTKTVAGSGYKVVRVVVITVFNCIMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLK-TTKNDVDMSFETNKKE---YEKW.I--KDPYQPT----ravs.
T1RQ95_9REOV/1-166                 ...........................MENVTTINE...TL-VEEVYNITLGYFEHNvI.IMKYF...PF..LASILTILFTAWKMGSSTLKVTKIVAGSGYKVIKVVIVTIFNCILKIFGSKTEIVPEDKMDIMASKILKQIDEQVKVIEQLTKRELEQVKLLADIYELLKYKSEE--TIPSGINKKAYDT---W.N--KDPYQP-----travs
E2ICS9_9REOV/7-179                 ...........................MDELADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E3W4B3_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIYDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYESSEVTA.....
B5AAV3_9REOV/1-173                 ...........................MEKLTDLNY...TLDVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRPTDEIDMTKEINLKNVKTLEEW.ENGRNPYEPKEVTA.....
C3TUN3_ROTHU/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
K4GF53_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNNTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSRCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLIIKPVDKIDMSQEFNQRQFKTLNEW.TEGENPYEPKEVTA.....
S5S0W4_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
T2CE26_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPIDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
B2Z9U5_9REOV/1-127                 ..........................t---------...------------------.-.-----...--..----------LHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPGDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEV--.....
Q4G629_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GIAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
T2HS67_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLVVRSTDEIDMTKEINQKNVKTLEEW.ESGKNPYEPQEVTA.....
Q8QY57_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPIMKIALKTSKCSYKVIKCCIVTIISTLLKLAGYKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDNLIIKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
B2Z9V0_9REOV/1-127                 ..........................t---------...------------------.-.-----...--..----------LHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEV--.....
P89060_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKCCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHNNLIIKPVDVIDMSKEFNQKNIKTLDEW.EGGKNPYEPLEVTA.....
Q9IVG5_9REOV/1-134                 ...........................---------...------------HSIIQD.P.GMAYF...LY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLIIKPVDVIDMSKEFNQKNIKT----.--------------.....
E7CBJ9_9REOV/1-170                 ..........................f----TDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ENGKNPYEPKEVTA.....
Q80AQ1_9REOV/1-173                 ...........................MDKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKLALKTSRCSYKVIKYCVVTTFNALLKLAGYKEQVTTKDEIEKQMDRVVREMRRQLEMIDKLTTREIEQVELLRRIYDRLMVQETDEIDMSKEINQKNIRTLNEW.ENGKNPYKPSEVTA.....
E0XH93_9REOV/1-169                 ..........................a-----DLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTVINTLLKLAGYKEQVTTKDEVEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLRRIHDKLMTRPADVIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
B0LWB1_9REOV/1-170                 ...........................---LADPHY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTLKIALRTSKCSYKVIKYCMVTIINTFLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLAARPVDAIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
R9QU53_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKELNQKNIKTLDEW.ESGKNPYEPSEVTA.....
F5C700_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
B5KFX4_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLLNSTLHTILDD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLIVQSNGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
Q91HS4_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKDQITTKDEIEKQMDRVAKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
M4Q432_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLXTXPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
D1GH48_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKCCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLTIKPVDVIDMSKEFNQKNIKTLDEW.ENGKNPYEPLEVTA.....
D0UD19_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPIDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
D1GH36_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
M1NPF8_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHSILED.S.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIRTADEMDMTKEINQKNVRTLEEW.ENGKNPYEPKEVTA.....
F5B543_9REOV/8-180                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKMIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMKRQLEMIDKLTTREIEQVELLKRIHDNLITRSVDIIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E5FXI5_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASVPTMKIALKTSKCSYKVVKYCIVSIFNTLLKLAGYKEQITTKEEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDMMIVRPTEKVDMSLETNQKYFKTSGEW.KNGENPYEPKEVTA.....
Q9IVG7_9REOV/1-134                 ...........................---------...------------HSIIQD.P.GMAYF...LY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLIIRPVDVIDMSKEFNQKNIKT----.--------------.....
NSP4_ROTHK/1-173                   ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...TY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLRLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKSIHDNLITRSVDVIDMSKEFNQKNIKTLDEW.ESGRNPYEPSEVTA.....
Q3LRN1_9REOV/1-168                 ...........................-----DLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTVINTLLKLAGYKEQVTTKEEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDRLVTRPVDVIDMSKEFNQKNIRTLDEW.ENGKNPYEPSEVTA.....
H2EHT5_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASLPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMAQPTDNIDVTKEINQKNVKTLAEW.ENGKNPYEPKEVTA.....
E7ECT4_9REOV/8-180                 ...........................MDKLADLNY...TLSVITLMNDPLKSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRSVNVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E7ECS9_9REOV/8-180                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKMIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMKRQLEMIDKLTTREIEQVELLKRIHDNLITRSVDIIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E7CBI1_9REOV/1-173                 ..........................k-DKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
X4Y7A6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIIDMTKEFNQKNVKTLDEW.ENGKNPYEPIEVTA.....
Q9DSG2_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLTVLFALHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTDEIDMTKEINQKNVRTLEEW.ENGKNPYEPKEVTA.....
I0B178_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSNCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEMEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKHIYDKLMVRSNIEIDMTKEINQKNVRTLEEW.ESGKNPYEPREVTA.....
H8ZHZ1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFALHKASIPTMKIALKTSKCSYKVIKYCMVTVINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLIARPVDVIDMSKEFNQKNVRTLDEW.ESGKNPYEPSEVTA.....
D0UD05_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKDQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
Q9W9K6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPANALDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
R9TE54_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDDW.ESGKNPYEPSEVTA.....
E7ECS0_9REOV/8-180                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E1CJH4_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRTADEIDMTKEINQKNVRTLKEW.ENGKNPYEPKEVTA.....
E7CBL1_9REOV/1-171                 ...........................--KFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
Q1G1U0_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
S5RLK1_9REOV/2-174                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.EDGKNPYEPIEVTA.....
S5S0R4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNETLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPANIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
X2GA26_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCTVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
A0A024CFV1_9REOV/1-173             ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRPADEIDMTKEINQKNVKTLEEW.ESGKNPYEPKEVTA.....
B0ZSY4_9REOV/5-171                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
D0UD25_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
G0YWF4_9REOV/1-71                  ...........................---------...-LSVITFMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTIINTLLK------------------------------------------------------------------------------.--------------.....
A9CQ79_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYWIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKESYQKNLKTLDEW.ENGKNPYEPIEVTA.....
E7CBN0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
E7D6L1_ROTHU/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNFKTLDDW.ESGKNPYEPIEVTA.....
K0I9A0_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
Q1WEV7_ROTHU/1-173                 ...........................MDKLADLNY...TLSVITLMTDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNFKTLDEW.ESGKNPYEPIEVTA.....
M1KJI1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
S5RLM0_9REOV/1-173                 ...........................MEKLTDLNY...TLSAITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
K7S1R0_9REOV/1-173                 ...........................MDKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLDMIDKLTTREIEQVELLKRIHDKLMIRTTDEIDMTKEINQKNVRTLKEW.ENGKNPYEPKEVTA.....
Q1G1U1_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
M1HE13_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITNKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSICEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
H6B4D0_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVKTLEEW.KSGKNPYEPKEVTA.....
A2SUF9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMLTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMKRQLEMIDKLTTREIEQVELLKRIHDKLMTRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
S5JQA1_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVQSAGEIDMTKEINQKNVRTLEEW.ESGRNPYEPKEVTA.....
E3W4G1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLVTRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
F4YUY4_9REOV/1-159                 ...........................---------...-----TLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITGPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
A0A024FRX5_9REOV/1-173             ...........................MEKLTDLNY...TLSVITLMNSTLHTLLED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVKTLEEW.KSGRNPYEPKEVTA.....
E7CBF7_9REOV/1-166                 ...........................-------NY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
D7SC45_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
H9MZN0_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSQCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
F5C6F6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPIDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
R9TAP4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDSLITRPVNVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
O56851_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLIIKPVDKIDMSQEFNQRQFKTLNEW.AEGENPYEPKEVTA.....
D3JPT4_9REOV/1-172                 ...........................-EKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCVVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRPTDEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
G1DH78_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
D4P8F0_9REOV/1-170                 ...........................---LTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTLFNTLLRLAGYKEQITTKDEMEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRTTDEIDMTKEINQKNVKTLEEW.ENGRNPYEPKEVTA.....
M1NQL2_9REOV/1-166                 ...........................-------NY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFMLHKASIPTMKIALKTSKCSYKMVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRTVDEIDMTKEINQKNVRTLEEW.ENGRNPYEPKEVTA.....
E9KPE4_9REOV/1-172                 ...........................-DKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
I2CMV8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKXVDVIDISKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
NSP4_ROTWI/1-173                   ...........................MDKFADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKCCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLIIKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
F5B547_9REOV/8-180                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKMIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMKRQLEMIDKLTTREIEQVELLKRIHDNLITRSVDIIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q4G678_9REOV/1-64                  ...........................---------...------------------.-.-----...--..--------------------------------------------------------------------------LEMIDKLTTREIEQVELLKRIHDNLITKTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
F5C795_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
X4Y112_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDAIDMTEEFNQKNIKTLDEW.ENGKNPYKPIEVTA.....
F5C564_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E0YLI0_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFALHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKDQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
F4YUY1_9REOV/1-94                  ...........................---------...------------------.-.-----...--..--------------------------------------------LKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRPTDEIDMTKEINQKNVKTLEEW.ESGKNPYEPKEVTA.....
J9QLB2_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
B2Z9W3_9REOV/1-124                 ...........................---------...------------------.-.-----...--..--------------SIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIELQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
F4YUY2_9REOV/1-156                 ...........................---------...--------NSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRPTDEIDMTKEINQKNVKTLEEW.ESGKNPYEPKEVTA.....
J9QNI2_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMKRQLEMIDKLTTREIEQVELLKRIHDKLIVRPTGEIDMTKEINQKNVKTLEEW.ENGRNPYEPKEVTA.....
Q9PYD8_9REOV/1-173                 ...........................MEKLTDLNY...TLNVITLLNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCIVTIFNTLLKLAGYKEQITTKEWIEKQLDKVIKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIRKTDEIDMTKEINQKNVKTLDEW.ENGKNPYESKEVTA.....
A0MM90_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
H9BPF8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
S5S2P0_9REOV/2-174                 ...........................MDKLADLNY...TLSVITLMNETLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPANIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
C1K3I0_9REOV/1-166                 .enatsinetfveevynmtlsyfehnv---------...------------------.I.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
E7CBJ5_9REOV/1-171                 ...........................--KFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
Q4G644_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
D2K6F5_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIRTVDEIDMTKEINQKNVRTLKEW.ENGKNPYEPKEVTA.....
I6ZV08_9REOV/1-157                 ...........................---------...-------MNSTLHTILED.P.GMAYF...PC..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKTVVRSTDEVDMTKEINQKNVKTLEEW.ESGKNPYEPTEVTA.....
NSP4_ROTE1/1-173                   ...........................MDKLTDLNY...TLNVITLINSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVIKEMRRHLEMIDKLTTREIEQVELLKRIYDKLMIRATDEIDMSKEINQKNVRTLEEW.ENGKNPYESKEVTA.....
F6KWD6_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLTVLFALHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTDEIDMTKEINQKNVRTLEEW.ENGKNPYEPKEVTA.....
G8FNI7_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYGIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEMDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
A0FJ14_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKERVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q9DSG7_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPANALDMSKEFNQKNIKTLDEW.KSGKNPYEPSEVTA.....
H6SWU1_9REOV/1-155                 ..........................s---------...----------TLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLIVQSTGEIDMTKEINQKNVKTLEEW.ESGRNPYESKEVTA.....
E7CBM4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDSLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
E7ECR5_9REOV/8-180                 .........................ik--VLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
C7EWT1_9REOV/1-166                 .enatsinetfveevynmtlsyfehnv---------...------------------.I.VMRYF...PF..LASILTIVFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITAFNCVMRLFGSKTEMVSDDRLDALASKIVTQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMKK-NDIDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
F5AY56_9REOV/8-180                 .........................ik--VLADLNY...TLSVITLMNDTLDSIIQD.P.GMAYF...PY..IAAVLTVLFTLHKASIPTMKIALKTSKCSYKMIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
N0ABM0_9REOV/1-165                 ...........................--------Y...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCVVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLLVRSTDEIDMTKEINQKNVKTLEEW.ESGKNPYEPKEVTA.....
B5KFX5_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVQSAGEIDMTKGINQKNVKTLEEW.ESGRNPYEPKEVTA.....
R4I385_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLIVQSTGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
NSP4_ROTHD/1-173                   ...........................MEKLTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLTVLFALHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTDEIDMTKEINQKNVRTLEEW.ENGKNPYEPKEVTA.....
Q8JXI2_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLIIKPVDKIDMSQEFNQKHFKTLNEW.AEGENPYEPKEVTA.....
J7HUM4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFALHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
G1FVL7_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDSVDMMKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
I2CMS0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDAIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
E7CBP0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
H9MZM6_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
L0C9B4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASILTVLFTLHKASIPTMKIALKTSKCSYKVIKCCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIIKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
H9MZN7_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
E3W588_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSILQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
B2Z9T7_9REOV/1-124                 ...........................---------...------------------.-.-----...--..--------------SIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
G1CDD1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFALHKASIPTMKIALKTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEVEQQMDRIVKEMRRQLEMIEKLTTREIEQVELLKRIHDKLATRPVDVIDMSKEFNQKNVRTLDEW.ESGKNPYEPSEVTA.....
E9KPE3_9REOV/1-172                 ...........................-DKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
F5CRE4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPADIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
H9ZIN2_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVIKYCMVTVINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLITRPVDAIDMSKEFNQKNIRTLDEW.ESGKNPYEPTEVTA.....
B5ATM4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIVKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
B0ZSY9_9REOV/3-155                 .............vynmtlsyfeqnvi---------...------------------.-.IMKYF...PF..LASILTIMFTAWKMGKSTLKVTKTVAGSGYKVVRVVVITVFNCIMRLFGSKTEMVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKM-TKNDVDMSFETNKKE---YEKW.I--KDPYQPT----ravs.
E7ECR9_9REOV/8-180                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
G9DAQ1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIITIINTLLKLAGYKEQVATKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRILDNLITRPVDIVDMTKEFNQKNVKTLDEW.ENGKNPYEPIEVTA.....
M1KAX8_9REOV/1-173                 ...........................MDKLTDLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ENGKNPYEPSEVTA.....
B7TAE0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPADIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
A0A023T4J6_9REOV/1-173             ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTVINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLAVRPVDVIDMSKEINQKNIRTLDEW.ESGKNPYEPSEVTA.....
F5C6R6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
M1PQS5_9REOV/1-138                 ...........................MEKLTDLNY...TLSVITLMNNTLHTILED.P.GMAYF...PY..IASVLMVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVR----------------------.--------------s....
S5S0T9_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.EDGKNPYEPIEVTA.....
A0A024CG54_9REOV/1-173             ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNVKTLDEW.ENGKNPYEPIEVIA.....
P87709_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCTVTIINTLLKLAGYKEQVTTKDEIEQQMDRIIKEMRRQLEMIDKLTTREIEQVELLKRIYDKLITRPVDVLDMSKEFNQKNIKTLDEW.KSGKNPYEPSEVTA.....
M1JSR5_9REOV/1-173                 ...........................MDKLTDLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q3LRM9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTVINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVTRPVDAIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
K0II81_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITGPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
E7CBG4_9REOV/1-165                 ...........................--------Y...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGCKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
I3QD95_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKMVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRTVDEIDMTKEINQKNVRTLEEW.ENGRNPYEPKEVTA.....
A0A023UIZ0_9REOV/1-129             ..........................t---------...------------------.-.-----...--..----------LHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNVKTLDEW.ESGKNPYEPIEVTA.....
E7CBH9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKELNQKNIKTLDEW.ESGKNPYEPIEVTA.....
F1JZT9_9REOV/2-167                 ......................menvc-----TINV...TL-VDEVYKMTLRYFEHNvI.IMKYF...PF..IASILTIIFTAWKMGRSTLKVTKTVGGSRYKVIKVVIVTIFNCVLRIFGSKAEIVPEDKMDVMASIILMHIDEQVKVNEQLRKRELEQVKLLADIYELLKYKTEGNI--CSETNKKG---YETW.--GLDPYQP-----travt
A9CQ69_9REOV/1-165                 ...........................--------Y...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
A0A023UGM0_9REOV/1-139             ...........................---------...------------------.-.-----...-Y..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
Q8QY59_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQGELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYDPIEVTA.....
P87722_9REOV/1-162                 ...........................--------Y...TLNVITLMNDTLHSIIQD.P.GMAYF...TY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLE---.....
B2Z9T4_9REOV/1-127                 ..........................t---------...------------------.-.-----...--..----------LHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQFTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLIIRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEV--.....
Q4G5Z7_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTLKIALKTSKCSYKVIKYCMVTVINTLLKLAGYKEQVTTNDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVTRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q4G677_9REOV/1-173                 ...........................MDKLADLNS...TLSMITLVNDTLHSIIPN.S.GVTYF...PY..VASVLTILFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIINALLKLAGFKGQVTTNDEIEKQMDRVVKEMQRQLEMIDKLTTREIEQVELLKRIYDKLMVKNVDAIDMSKEFNQKNIRTMDEW.ESGRNPYEPSEVTA.....
Q77P48_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPANALDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
D5J9W1_9REOV/1-173                 ...........................MDKLVDLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTIINTLLKLAGYKEHVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLAVRPVDAIDMSKEINQKNIRTLDEW.ESGKNPYEPSEVTA.....
D7SC33_9REOV/1-133                 ...........................---------...------------------.-.-----...--..-----TVLFTLLKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDSLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
E2J370_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
P87716_9REOV/1-162                 ...........................--------Y...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMMRSIGEIDMTKEINQKNVRTLEEW.ESGKNPYEPKE---.....
C1K3I1_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
F6JTI2_9REOV/1-173                 ...........................MKKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYEEQITNKDEIEKQIDRVVKEMRRQLEMIDKLTTREIEQVELLRRIYDKLLVQPIDGVDMTKEINQKNIRTLEEW.ENGKNPYEPKEVTA.....
C1K3H6_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
C1K3J5_9REOV/1-166                 .enatsinetfveevynmtlsyfehnv---------...------------------.I.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITMFNCVMRLFGSKTEMVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
A0A024CFR4_9REOV/1-173             ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLKEW.ESGKNPYEPKEVTA.....
L7UZX4_9REOV/1-173                 ...........................MDKLADLNY...TMNVITLMNDTLHTIIED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDRLTTREIEQVELLKRIHDMLIIKPIEKIDMSKEFNQKQFKTLDEW.TDGENPYKPKEVTA.....
Q9IU44_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCTVSIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLITRPVDVLDMSKEFNQKNIKTLDEW.KSGKNPYEPSEVTA.....
Q9IVG6_9REOV/1-134                 ...........................---------...------------HSIIQD.P.GMAYF...LY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVNVIDMSKEFNQKNIKT----.--------------.....
M4ZVL4_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFALHKASIPTMKIALKTSKCSYRVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDRLVTQPTDGVDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
D1GHF6_9REOV/1-173                 ...........................MDKLAGLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKCCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLIIKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
B6E4V8_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCIVTIINTLLNLAGYKEQVTTKDEIEQQMDRIVKEMRCQLEMIDKLTTREIEQVELLKRIHDKLVVRPVDAIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
E0YLJ1_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDETDMTKEINQKNVKTLEEW.ESGKNPYEPKEVTA.....
E7CBJ4_9REOV/4-176                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCTVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLITRPVDVLDMSKEFNQKNIKTLDEW.KSGKNPYEPSEVTA.....
Q9PYC9_9REOV/1-173                 ...........................MEKLTDLNY...TSSVITLMNNTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQFEMIDKLTTREIEQVELLKRIHDKLMVRATDEIDMTKEINQKNVRTLEEW.ENGKNPYEPKEVTA.....
G0YWF7_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVVRPIDAIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
L0CAR1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPIDVIDMSKEFNQKNIKTLDEW.ESGKNPYKPSEVTA.....
C1K3K4_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTVWKMGKSTLKVTKTVTGSGYKVVRVVVITMFNCVMRLFGSKTEMVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
B2Z9V7_9REOV/1-127                 ..........................t---------...------------------.-.-----...--..----------LHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEV--.....
E2J322_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E0YLI1_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
S5S2P5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIITIINTLLKLAGHKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
G1FW19_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTINMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
B2BMA6_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRPTDEIDMTKEINQKNVKTLEEW.ESGKNPYEPKEVTA.....
F5C662_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
C7EWT3_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITMFNCVMRLFGSKTEMVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
A9ZP22_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINPHIKVAGYKEQGGTKDVIEQQMVRIVKEMRRQQETKDELTTCEIDQVELLKRIHDNLITSPVAVIDMTKEFNQKNIKTLDEW.ESGNKPYEPIEVTA.....
S5S0T4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
E2G6L3_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIRSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
F5C4S1_9REOV/1-173                 ...........................MDKLADLNY...TLRVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
F5C712_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLNEW.ENGKNPYEPIEVTA.....
NSP4_ROTRA/1-173                   ...........................MDKLTDLNY...TLSVITLMNSTLHAILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVIKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVIREMRRQLEMIDKLTTREIEQVELLRRIYDRLTVRKTDEIDMSKEINQKNIRTLDEW.ENGKNPYEPSEVTA.....
A0A024CFK3_9REOV/1-173             ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLYEW.ESGKNPYEPIEVTA.....
Q2XPN6_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GIAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRPTDEIDMTKEINQKNVKTLEEW.ESGKNPYEPKEVTA.....
E0XH95_9REOV/1-160                 ...........................---------...----ITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVTRPADVIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
E7CBL3_9REOV/1-170                 ..........................f----TDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
Q8QY56_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMARIVKEMRRHLEMIDKLTTREIEQVEWLKRIHDNLITRSVNVIDISKQFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E7CBI7_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
C1K3I7_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVTQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
G0YWF5_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVAGPIDAIDMSKEFNQKNIRTLDEW.ENGKNPYEPSEVTA.....
V5LFP9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTNDEIERQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPADIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
V9VK07_9REOV/10-182                ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
E7CBG2_9REOV/1-171                 ...........................--KLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
F5C5K9_9REOV/1-173                 ...........................MDKLADLNY...TLRVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
C7EWT9_9REOV/1-166                 .enatsinetfveevynmtlsyfehnv---------...------------------.I.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
S5RLJ3_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
E3W527_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDRLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
E2J2S6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTRDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
D3JIR1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKIIKYCMLTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRPVDVIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
A0A024CG50_9REOV/1-173             ...........................MDKLADLNY...TLSVITLMNDTLHSILQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINALLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
C7EWR1_9REOV/1-167                 ...........................MENATSVNE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITVFNCVMRLFGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
H9MZM4_9REOV/1-170                 ..........................f----TDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDETDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
M5AFF2_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLIVQSTGEIDMTKEINQKNVKTLEEW.ENGRNPYEPKEVTA.....
M4ZUC3_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSADEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
R9ZPQ0_9REOV/1-129                 ..........................t---------...------------------.-.-----...--..----------LHKASIPTMKIALKTSKCSYKVVKYCIVAIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSICEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
B0ZSW6_9REOV/2-153                 .............vynmtlgyfehnai---------...------------------.-.IMKYF...PF..LASILTIIFTAWKMGRSTLKVTKTVAGSGYKAIKVVIVTIFNCILRMFGSKAEIVPEDKMDVMASKILKQIDEQVKVIEQLTKRELEQVKLLADIYELLKYKSEGSIS--SETNKKA---YETW.--SKDPYQPT----ravs.
A0A024CI44_9REOV/1-173             ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCMVTVINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLVVRPFDAIDMSKEINQKNIRTLDEW.ESGKNPYEPSEVTA.....
Q2VC45_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIHD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
C1K3K5_9REOV/1-167                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITMFNCVMRLFGSKTEMVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMK-KDEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
A0FL79_ROTHU/1-173                 ...........................MDKLADLNY...PLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
E7CBG1_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIIREMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
M1KIS3_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ENGKNPYEPAEVTA.....
E7CBH8_9REOV/1-171                 ...........................--KLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
E3W453_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSNEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
K4N0J0_9REOV/6-178                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E9KPD9_9REOV/1-172                 ...........................-EKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIERQMDRVVKEMRRQLEMINKLTTREIEQVELLKRIHDKLMVRPTDEIDMTKEINQKNVKTLEEW.ESGKNPYETKEVTA.....
F5C5U1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDSVDMMKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
G1DH79_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLRSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIRYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDITKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
C7EWS7_9REOV/5-162                 ........tfveevynmtlsyfehnvi---------...------------------.-.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITMFNCVMRLFGSKTEVVSDDRLDALASKIVTQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMKK-NEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
Q4G679_9REOV/1-125                 ...........................---------...------------------.-.-----...--..-------------ASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLTLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTGEIDMAKEINQKNVRTLEEW.EDGKNPYESKEVTA.....
H9N1C5_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFMLHKASIPTMKIALKTSKCSYKMVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRTVDEIDMTKEINQKNVRTLEEW.ENGRNPYEPKEVTA.....
G1FVY2_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLVTRPVEVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
I3RPT6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDRLTTREIEQVELLKRIHDNLIIRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
M1PD00_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTXLED.S.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIRTADEMDMTKEINQKNVRTLKEW.ENGKNPYEPKEVTA.....
Q98VJ9_9REOV/2-174                 ...........................MEKLTDLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASLPTMKIALKTSRCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDMLIATSVDKIDMTQEFNQKHFKTLNEW.AEGENPYKPREVTA.....
H9MZN2_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
B2CQB6_9REOV/1-173                 ...........................MAKLCDLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRCQLEMIDKLTTREIEQVELLKRIHDKLVVRPVDAIDMSKEFNQKNIRTLDEW.ESGKNPYEPSEVTA.....
Q4G670_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
M1GTB4_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEVRRQLEMIDKLTTREIEQVELLKRIYDKLIVLSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
E0YLK1_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNGTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKDQITTKDEIEKQMDRVIKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
Q4G676_9REOV/1-173                 ...........................MDKFADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
X4XXI1_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNVKTLDEW.ENGKNPYEPIEVTA.....
B7ZGV3_9REOV/1-155                 ...........................-----DLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSRCSYKVIKYCIVSIFNTLLKLAGYEEQIATKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLIIKPVDKIDMSQEFNQRQFKTLTEW.--------------v....
B7ZGW1_9REOV/1-154                 ...........................-----DLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLIVRPTDEIDMTKEINQKNVKTLEEW.--------------.....
F5C467_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
M1KIY0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKCCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
F1JZU0_9REOV/2-167                 ......................menvc-----TINV...TL-VDEVYKMTLRYFEHNvI.IMKYF...PF..IASILTIIFTAWKMGRSTLKVTKTVGGSRYKVIKVVIVTIFNCVLRIFGSKAEIVPEDKMDVMASIILMHIDEQVKVNEQLRKRELEQVKLLADIYELLKYKTEGNI--CSETNKKG---YETW.--GLDPYQP-----travt
K9ZTF0_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLTIRTADEIDMTKEINQKNVRTLKEW.ENGKNPYEPKEVTA.....
H2DF32_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIMQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKELNQKNIKTLDEW.ENGKNPYEPIEVTA.....
F5C4N5_9REOV/1-173                 ...........................MDKLADLNY...TLRVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
Q6L5X9_9REOV/1-173                 ...........................MEKLPDLNY...TLGVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFMLHKASIPTMKIALETSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRAADEIDMTKEINQKNVKTLEEW.ENGKNPYEPKEVTA.....
Q2VC34_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIERQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRPTDEIDMTKEINQKNVKTLEEW.ESGKNPYETKEVTA.....
A8JYK3_9REOV/1-154                 ...........................---------...----------TLHTILEE.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVQSAGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
P87710_9REOV/1-162                 ...........................--------Y...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKCCIVTIINTLLKLAGYKEHVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPVDVIDMSKEFNQKNIKTLNEW.ESGKNPYEPLE---.....
H9MZL4_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
E9NME5_9REOV/1-171                 ...........................--KLTDLNY...TLSVITLMNDTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEMEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSNSEIDMTKEINQKNVRTLEEW.ESGKNPYEPREVTA.....
I6ZLR3_9REOV/1-115                 ...........................---------...-------MNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIEKLTTREIEQVELLKRNY----------------------------.--------------.....
D0UD32_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDAIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
A0FJ12_9REOV/1-163                 ...........................---------...-LSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
B0ZSZ3_9REOV/4-170                 ...........................MENATSINE...TF-VEEVYNMTLSYFEHNvI.IMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITMFNCVMRLFGSKTEVVSDDRLDALASKIVTQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMKK-NEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
R9QVA9_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKVALKTSKCSYKVVKYCIVTIFNTLLKSAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRTTDEIDMTKEMNQKNVKTLEEW.ESGRNPYEPKEVTA.....
C0J9W5_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDRLMVRPIDEIDMTKEINQKNIKTIEEW.GNGKNPYEPKEVTA.....
A4L5S1_9REOV/1-171                 ...........................--KLADLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSRCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDMMITKPVDKIDMSQEFNQKHFKTLNEW.AEGENPYESKEVTA.....
E2J346_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
I3RPU4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDRLTTREIEQVELLKRIHDNLIIRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
A0A024CFG2_9REOV/1-173             ...........................MEKLTDLNY...TLSVITLMNDTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEMEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVRSTGEIDMTKEINQKNVRTLEEW.ESGKNPYEPREVTA.....
B0LWB6_9REOV/1-170                 ...........................---LADLNT...TLSVITLVNDTLHSIIPS.S.GMAYF...PY..IASVLTILFTLHKASVPTMKIALKTSKCSYKVIKYCIVTIINALLKLAGFKGQVTTNDEIEKQMDRVVKEMQRQLKMIDKLTTREIEQVELLKRIYDKLMVKNVDAIDMSKEFNQKNIRTLDEW.ENGRNPYEPSEVTA.....
A7VJE9_9REOV/1-173                 ...........................MDKLTDLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPVNALDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q4G660_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPADVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
F1JZT8_9REOV/2-167                 menvstinetlvdevykmtlryfehnv---------...------------------.I.IMKYF...PF..IASILTIIFTAWKMGRSTLKVTKTVAGSRYKVIKVVIVTIFNCVLRIFGSKAEIVPEDKMDVMASIILMQIDEQVKVNEQLRKRELEQVKLLADIYELLKYKTEGNI--CSETNKKG---YETW.--GKDPYQPT----ravs.
D5HMU0_9REOV/1-173                 ...........................MDKLADLNY...TLSVITFMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
F5C5W7_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPIDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
J9QAW7_9REOV/8-180                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMIRTVDEIDMTKEINQKNVRTLEEW.ENGKNPYEPKEVTA.....
H9MZQ6_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q86353_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...TY..IASVLTVLFTLHKASIPAMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKCIYDNLITRPVNVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q4G638_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
M1KGW3_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALRTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVARPVDAIDMSKEFNQKNIRTLDEW.ENGKNPYEPSEVTA.....
E2ICT0_9REOV/7-179                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDSVDMMKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
M1PYQ7_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNDTLHTILED.S.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMIRTADEMDMTKEINQKNVRTLKEW.ENGKNPYEPKEVTA.....
A4KAG9_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCMVTVINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLIIRPVDAIDMSKEFNQKNVKTLDEW.ESGKNPYEPSEVTA.....
Q006K8_9REOV/1-173                 ...........................MGKLTDLNY...TLSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVREMRRQLEMIDKLTTREIEQVELLKRVHDMLILKPVDKIDMSQEINQKHFKTLNEW.AEGENPYEPKEVTA.....
K0I7R4_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTMLED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIDMTKEINQKNVRTLEEW.ESGRNPYEPKEVTA.....
X2FR92_9REOV/1-173                 ...........................MEKLADLNY...TLGVITLLNDTLHNTLEE.P.GMVYF...PY..IVSALTVLFTMHKASLPAMKLAMRTSQCSYRIIKRVVVTLINTLLRLGGYNDYLTDKDETEKQINRVVKELRQQLTMIEKLTTREIEQVELLKRIYDMMIVRHDSEIDMSKETNQKAFKTLHDW.KNDRSYDDNTEVI-a....
U3Q5E8_9REOV/1-173                 ...........................MEKLTDLNY...TMSVITLMNDTLHTIMED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVSIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDMLIIKPVDKIDMSQEFNQKHFKTLNEW.AEGENPYEPKEVTA.....
U3M047_9REOV/1-173                 ...........................MEKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKASKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
D7SC35_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDSLITRPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
C7EWS5_9REOV/1-166                 .enatsinetfveevynmtlsyfehnv---------...------------------.I.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVTGSGYKVVRVVVITMFNCVMRLFGSKTEVVSDDRLDALASKIVTQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMKK-NEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
X2FQU0_9REOV/1-173                 ...........................MEKLADLNY...TLGVITLLNDTIHNILEE.P.GMVYF...PY..IVSALTVLFTMHKASLPAMKLAMRTSQCSYRIIKRVVVTLINTLLRLGGYNDYLTDKDETEKQINRVVKELRQQLTMIEKLTTREIEQVELLKRIYDMMIVRHDSEIDMSKETNQKAFKTLHDW.KNDRSXDDNTEVI-a....
Q1G1T3_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
H9MZP6_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVNTKDEIEQQMDRIVKEMRRQLEMINKLTTREIEQVELLKRIHDNLITRPADIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
E7CBM9_9REOV/1-165                 ...........................--------Y...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
D7SC50_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHFIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLVTRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
G3BFZ1_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
B0ZSZ0_9REOV/2-154                 ............vynmtlsyfeqnvil---------...------------------.-.-MKYF...PF..LASILTIMFTAWKMGKSTLKVTKTVAGSGYKVVRVVVITVFNCIMRLFGSKTEMVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKM-TKSDVDMSFETNKKE---YEKW.I--KDPYQPT----ravs.
U3GRA7_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTVFNTLLRLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLIVQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
C1K3J2_9REOV/1-166                 ..............enatsinetfvee---------...------VYNMTLSYFEHNaI.VMKYF...PF..LASILTIAFTAWKMGKSTLKVTKTVAGSGYKVVRVVVITVFNCMMRLLGSKTEVVSDDRLDALASKIVAQIAEQVKVIEQLTKRELEQVKLLADIYEMLKMKK-NEVDMSFETNKKE---YEKW.M--KDPYQPT----ravs.
Q77M68_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPANALDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
C3U213_9REOV/14-186                ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLIARPVDVIDMTKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
D1GG75_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKHCMVTIINTLLKLAGYKEQVTNKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKSIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ENGKNPYESSEVTA.....
X2G3K7_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLYKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
I3RPT7_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDRLTTREIEQVELLKRIHDNLIIRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
D3JPT0_9REOV/1-172                 ...........................-EKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLMVRPTDEIDMAKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
B0LWB2_9REOV/1-172                 ...........................-DKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTLKIALRTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLIIRPADVIDMSKEFNQKNIRTLDEW.ENGKNPYEPSEVTA.....
H9MZL2_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
E5FPY0_9REOV/1-173                 ...........................MEKLTDLNY...TLSVIXLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMVQSIGEIXMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
T1RPZ0_9REOV/1-166                 ...........................MENVTTINE...TL-VEEVYNITLGYFEHNvI.IMKYF...PF..LASILTILFTAWKMGSSTLKVTKTVAGSGYKVIKVVIVTIFNCILRIFGSKTEIVPEDKMDIMASKILKQIDEQVKVIEQLTKRELEQVKLLADIYELLKYKN--EETTSSGINKKAYDT---W.N--KDPYQP-----travs
Q9E3V7_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYSIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPANALDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q9IU43_9REOV/1-173                 ...........................MEKFTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTILNTLLKLAGYKEQITTKDEMEKQMDRVVKEMKRQLEMIDKLTTREIEQVELLTRIYDKLIVRSTDEIDMTKEINQKNVRTLEEW.ESGKNPYEPKEVTA.....
Q4G635_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTLKIALKTSKCSYKVIKYCMVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDKLVTRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
V5W9D2_9REOV/1-173                 ...........................MEKLTDLNY...TLSVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLVVRSTDGIDMTKEINQKNVKTLEEW.ESGKNPYEPREVTA.....
V5IX13_9REOV/1-173                 ...........................MKKLTDIKY...TLSVITLMNDTLHSIIQD.P.GMAYI...PY..IASVLTVLFTLHIASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIVDMTKEFNQMNVKTLDEW.ENGKNPYEPIEVTA.....
X2G3E4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYKPSEVTA.....
F5CRF6_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPADIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
Q4G601_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASLPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVNTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRTVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
Q5KR58_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
Q76SA7_9REOV/1-162                 ...........................--------Y...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITKPANALDMSKEFNQKNIKTLDEW.ESGKNPYEPSE---.....
R4I446_9REOV/1-162                 ...........................---------...--SVITLMNSTLHTILED.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDKLTTREIEQVELLKRIYDKLMMQSIGEIDMTKEINQKNVKTLEEW.ESGRNPYEPKEVTA.....
Q98VL4_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDIIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
R4I3P2_9REOV/1-164                 ...........................---------...TLSVLTLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIYDNLITRPVDIVDMTKEFNQKNIKTLDEW.ESGKNPYEPIEVTA.....
O11983_9REOV/1-173                 ...........................MEKLADLNY...TLGVITLMNDTLHNILEE.P.GMVYF...PY..IASALTVLFTMHKASLPAMKLAMRTSQCSYRIIKRVVVTLVNTLLRLGGYNDYLTDKDETEKQINRVVKELRQQLAMIEKLTTREIEQVELLKRIYDMMVVCRDREIDMSKETNRKAFKTLHDW.GSDRNYDDNTDVI-a....
Q4G671_9REOV/1-173                 ...........................MDKLADLNY...TLNVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYTVIKYCIVTIINTLLKLAGYKEQATTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLITRPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPLEVTA.....
R9ZR89_9REOV/1-129                 ..........................t---------...------------------.-.-----...--..----------LHKASIPTMKIALKTSKCSYKVVKYCIVTIFNTLLKLAGYKEQITTKDEIEKQMDRVVKEMRRQLEMIDRLTTREIEQVELLKRIHDMLIIKPIEKIDMSKEFNQKQFKTLDEW.TDGENPYKPKEVTA.....
F5CRJ7_9REOV/1-173                 ...........................MDKLADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIVNTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDNLITRPVDTIDMTKEFNQKNIKTLDEW.ENGKNPYEPIEVTA.....
F1JZU2_9REOV/2-167                 menvstinetlvdevykmtlryfehnv---------...------------------.I.IMKYF...PF..IASILTIIFTAWKMGRSTLKVTKTVAGSRYKVIKVVIVTIFNCVLRIFGSKAEIVPEDKMDVMASIILMQIDEQVKVNEQLRKRELEQVKLLADIYELLKYKTEGNI--CSETNKKG---YETW.--GKDPYQPT----ravs.
H9MZP3_9REOV/1-170                 ...........................---LADLNY...TLSVITLMNDTLHSIIQD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIINTLLKLAGYKEQVTTKDEIEQQMDRIVKEMRRQLDMIDKLTTREIEQVELLKRIHDNLIAKPVDVIDMSKEFNQKNIKTLDEW.ESGKNPYEPSEVTA.....
#=GC SS_cons                       ...........................XXXXXXXXX...XXXXXXXXXXXXXXXXXX.X.XXXXX...XX..XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTXXXXXXXXXXXXXXXXXXXXXX.XXXXXXXXXXXXXX.....
#=GC seq_cons                      ...........................M-KLsDLNY...TLSVITLMN-TLHoIlpD.P.GMAYF...PY..IASVLTVLFTLHKASIPTMKIALKTSKCSYKVIKYCIVTIlNTLLKLAGYKEQVTTKDEIEpQMDRIVKEMRRQLEMIDKLTTREIEQVELLKRIHDpLIsRslDhIDMoKEFNQKNlKTL-EW.ESGKNPYEPpEVTA.....
//
DBGET integrated database retrieval system