GenomeNet

Database: Pfam
Entry: Saf-Nte_pilin
LinkDB: Saf-Nte_pilin
Original site: Saf-Nte_pilin 
#=GF ID   Saf-Nte_pilin
#=GF AC   PF09460.9
#=GF DE   Saf-pilin pilus formation protein
#=GF AU   Coggill P
#=GF SE   pdb_2co1
#=GF GA   25.00 25.00;
#=GF TC   28.20 56.10;
#=GF NC   22.70 21.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 26740544 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF WK   Saf_pilin_N-terminal_extension
#=GF RN   [1]
#=GF RM   16793551
#=GF RT   Donor-strand exchange in chaperone-assisted pilus assembly
#=GF RT   proceeds through a concerted beta strand displacement mechanism. 
#=GF RA   Remaut H, Rose RJ, Hannan TJ, Hultgren SJ, Radford SE, Ashcroft
#=GF RA   AE, Waksman G; 
#=GF RL   Mol Cell. 2006;22:831-842.
#=GF DR   INTERPRO; IPR018569;
#=GF CC   This domain consists of the adjacent Saf-Nte and Saf-pilin
#=GF CC   chains of the pilus-forming complex. Pilus assembly in
#=GF CC   Gram-negative bacteria involves a Donor-strand exchange
#=GF CC   mechanism between the C- and the N-termini of this domain. The
#=GF CC   C-terminal subunit forms an incomplete Ig-fold which is then
#=GF CC   complemented by the 10-18 residue N-terminus of another,
#=GF CC   incoming, pilus subunit which is not involved in the Ig-fold.
#=GF CC   The N-terminus sequences contain a motif of alternating
#=GF CC   hydrophobic residues that occupy the P2 to P5 binding pockets in
#=GF CC   the groove of the first pilus subunit [1].
#=GF SQ   3
#=GS Q8ZRK4_SALTY/27-170      AC Q8ZRK4.1
#=GS Q8ZRK4_SALTY/27-170      DR PDB; 2CNZ A; 22-144;
#=GS Q8ZRK4_SALTY/27-170      DR PDB; 2CO7 A; 20-144;
#=GS Q8ZRK4_SALTY/27-170      DR PDB; 2CO3 A; 1-142;
#=GS Q8ZRK4_SALTY/27-170      DR PDB; 2CO1 A; 22-144;
#=GS Q8ZRK4_SALTY/27-170      DR PDB; 2CNZ B; 1-20;
#=GS Q8ZRK4_SALTY/27-170      DR PDB; 2CNY A; 22-144;
#=GS Q8ZRK4_SALTY/27-170      DR PDB; 3CRF A; 22-144;
#=GS Q8ZRK4_SALTY/27-170      DR PDB; 3CRF C; 1-19;
#=GS Q8ZRK4_SALTY/27-170      DR PDB; 2CO3 B; 1-143;
#=GS Q8ZRK4_SALTY/27-170      DR PDB; 2CO4 A; 22-144;
#=GS Q8ZRK4_SALTY/27-170      DR PDB; 3CRE A; 22-144;
#=GS Q8ZRK4_SALTY/27-170      DR PDB; 2CO1 B; 1-20;
#=GS Q8ZRK4_SALTY/27-170      DR PDB; 3CRE B; 1-144;
#=GS Q8ZRK4_SALTY/27-170      DR PDB; 2CO6 A; 22-144;
#=GS Q8ZRK4_SALTY/27-170      DR PDB; 3CRE C; 1-19;
#=GS Q8ZRK4_SALTY/27-170      DR PDB; 2CNY B; 1-20;
#=GS Q8ZRK4_SALTY/27-170      DR PDB; 2CO2 B; 4-19;
#=GS Q8ZRK4_SALTY/27-170      DR PDB; 2CO4 B; 1-20;
#=GS Q8ZRK4_SALTY/27-170      DR PDB; 2CO2 A; 23-143;
#=GS Q8ZRK4_SALTY/27-170      DR PDB; 3CRF B; 1-144;
#=GS A0A0T9XWY3_SALET/23-165  AC A0A0T9XWY3.1
#=GS A0A0T7RPB5_SALET/23-164  AC A0A0T7RPB5.1
Q8ZRK4_SALTY/27-170                 GSFLPNSEQQKSVDIVFSSPQDLTVSLIPVSGLKAGKNAPSAKIAKLVVNSTTLKEFGVRGISN..NVVDSTGTAWRVAGKNTGKEIGVGLSSDSLRRSDSTEKWNGVNWMTFNSNDTLDIVLTGPAQNVTADTYPITLDVVGYQP.
#=GR Q8ZRK4_SALTY/27-170      SS    -EEEEEEEEEEEEEEEEBSTTSEEEEEEE-TTBBSEE--TT-EEEEEEEESSS-SEEEEEEESS..EESSTTSSEEEEE-TTT--EEEEEE-HHHHHT-SEEEEETTEEEEEEESSEEEEEEE-SSS-EE-SEEEEEEEEEEEEE-.
A0A0T9XWY3_SALET/23-165             GSLVPNTSTGVSADVNFSNPGQLQAQLTPVSGLVAGPHKGDEAIAVLSVS-GSSKQYVVTGDYSkpETVGNDSDVWTVTGK-SGNTIKVTFGGVACANKGSLVDGASHKWWVYNMTDKIAVKLSG-SQTVKADTYPVTLHIAEYQ-a
A0A0T7RPB5_SALET/23-164             GSIVAGSEQQSSVDIGFISPQLLSVTFAQVPNLAAGRFKGNAEIATIAVSSSSAKQFAIAADFN..ALNLYNGDTWTIRGKNTGKGIIVYFYGEAAKPQGSV-SYNGHQWFIYNINDKLGIKLAGD-QNIPADVFPMTVNIAAYQ-a
#=GC SS_cons                        -EEEEEEEEEEEEEEEEBSTTSEEEEEEE-TTBBSEE--TT-EEEEEEEESSS-SEEEEEEESS..EESSTTSSEEEEE-TTT--EEEEEE-HHHHHT-SEEEEETTEEEEEEESSEEEEEEE-SSS-EE-SEEEEEEEEEEEEE-.
#=GC seq_cons                       GSlVPNSEQQsSVDIsFSSPQpLoVoLsPVSGLsAG+aKGsAcIAsLuVSSoSuKQFuVsGDaN..slVsssGDsWTVsGKNTGKsItVsFuG-As+spGSl.caNGHpWalYNhNDKLuIKLoGsuQNVsADTYPlTLcIAuYQ.A
//
DBGET integrated database retrieval system