GenomeNet

Database: Pfam
Entry: SepQ
LinkDB: SepQ
Original site: SepQ 
#=GF ID   SepQ
#=GF AC   PF06622.8
#=GF DE   SepQ protein
#=GF AU   Moxon SJ
#=GF SE   Pfam-B_21060 (release 10.0)
#=GF GA   22.70 22.70;
#=GF TC   698.20 698.00;
#=GF NC   21.40 20.40;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 11927849 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF DR   INTERPRO; IPR009532;
#=GF CC   This family consists of several enterobacterial SepQ proteins
#=GF CC   from Escherichia coli and Citrobacter rodentium. The function of
#=GF CC   this family is unclear.
#=GF SQ   1
#=GS D2TKF2_CITRI/1-305  AC D2TKF2.1
D2TKF2_CITRI/1-305             MKPLNSQSNMKINDFYLPLLPVIGIGRLYITSEGHACHAYFREVSGNGFRFTLAYSGYEGCFWVSEEQLIQWCHELFPYSDSRLIPEDTIKLMLLWAIHATLPEDDASVDDVQFTTLNKDIYPVIENNNGKNRLNVIILETTVQSLQYLINDNWQLVPHSNTLFFDGYIAPGWTDYPITKLSIGDSLRLYHVDDSQERKCWLVINNPLATVKLSDNNLSVTDVQAADPLCIISNETVMNRIYCAIGTINVDIHKLRNLKKDDTIGSVGYHLFGGGRLIRNNTIIAYGTIIKINEDFYFNISVVCD
#=GC seq_cons                  MKPLNSQSNMKINDFYLPLLPVIGIGRLYITSEGHACHAYFREVSGNGFRFTLAYSGYEGCFWVSEEQLIQWCHELFPYSDSRLIPEDTIKLMLLWAIHATLPEDDASVDDVQFTTLNKDIYPVIENNNGKNRLNVIILETTVQSLQYLINDNWQLVPHSNTLFFDGYIAPGWTDYPITKLSIGDSLRLYHVDDSQERKCWLVINNPLATVKLSDNNLSVTDVQAADPLCIISNETVMNRIYCAIGTINVDIHKLRNLKKDDTIGSVGYHLFGGGRLIRNNTIIAYGTIIKINEDFYFNISVVCD
//
DBGET integrated database retrieval system