GenomeNet

Database: Pfam
Entry: Sigma_1s
LinkDB: Sigma_1s
Original site: Sigma_1s 
#=GF ID   Sigma_1s
#=GF AC   PF02454.14
#=GF DE   Sigma 1s protein
#=GF AU   Mian N, Bateman A
#=GF SE   Pfam-B_2133 (release 5.4)
#=GF GA   20.10 20.10;
#=GF TC   21.50 167.20;
#=GF NC   19.80 18.80;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   2398530
#=GF RT   Sequence diversity in S1 genes and S1 translation products of 11
#=GF RT   serotype 3 reovirus strains. 
#=GF RA   Dermody TS, Nibert ML, Bassel-Duby R, Fields BN; 
#=GF RL   J Virol 1990;64:4842-4850.
#=GF DR   INTERPRO; IPR003478;
#=GF CC   The reoviral gene S1 encodes for haemagglutinin (sigma 1
#=GF CC   protein), an outer capsid protein and a major factor in
#=GF CC   determining virus-host cell interactions. Sigma 1s is one of two
#=GF CC   translation products of the S1 gene.
#=GF SQ   1
#=GS SIG1S_REOVL/1-115  AC P07938.1
SIG1S_REOVL/1-115             MAPS-QKKSRKSRNKSRSTLMISGLPILNSTDLEDRLLTSAIASQPLSQDWVRWIIDLWVSRVRSRNYLTQVARTLRAYPHWVTESMLSNHELTVWIRSRLISLDEHPLWRQMLEA
#=GC seq_cons                 MAPS.QKKSRKSRNKSRSTLMISGLPILNSTDLEDRLLTSAIASQPLSQDWVRWIIDLWVSRVRSRNYLTQVARTLRAYPHWVTESMLSNHELTVWIRSRLISLDEHPLWRQMLEA
//
DBGET integrated database retrieval system