GenomeNet

Database: Pfam
Entry: SopE_GEF
LinkDB: SopE_GEF
Original site: SopE_GEF 
#=GF ID   SopE_GEF
#=GF AC   PF07487.9
#=GF DE   SopE GEF domain
#=GF AU   Finn RD, Moxon SJ
#=GF SE   Pfam-B_18665 (release 7.8)
#=GF GA   20.00 20.00;
#=GF TC   20.70 23.30;
#=GF NC   19.80 19.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 80369284 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF RN   [1]
#=GF RM   12093730
#=GF RT   Structural basis for the reversible activation of a Rho protein
#=GF RT   by the bacterial toxin SopE. 
#=GF RA   Buchwald G, Friebel A, Galan JE, Hardt WD, Wittinghofer A,
#=GF RA   Scheffzek K; 
#=GF RL   EMBO J 2002;21:3286-3295.
#=GF DR   INTERPRO; IPR016019;
#=GF DR   SCOP; 1gzs; fa;
#=GF CC   This family represents the C-terminal guanine nucleotide
#=GF CC   exchange factor (GEF) domain of SopE. Salmonella typhimurium
#=GF CC   employs a type III secretion system to inject bacterial toxins
#=GF CC   into the host cell cytosol. These toxins transiently activate
#=GF CC   Rho family GTP-binding protein-dependent signaling cascades to
#=GF CC   induce cytoskeletal rearrangements. SopE, can activate Cdc42, an
#=GF CC   essential component of the host cellular signaling cascade, in a
#=GF CC   Dbl-like fashion despite its lack of sequence similarity to
#=GF CC   Dbl-like proteins, the Rho-specific eukaryotic guanine
#=GF CC   nucleotide exchange factors [1].
#=GF SQ   1313
#=GS X4KHU7_SALEN/76-240      AC X4KHU7.1
#=GS X3RSG7_SALEN/76-240      AC X3RSG7.1
#=GS V1G2C7_SALCE/76-240      AC V1G2C7.1
#=GS A0A018QLT3_SALET/76-240  AC A0A018QLT3.1
#=GS X3KRY5_SALEN/76-240      AC X3KRY5.1
#=GS B4SV96_SALNS/76-240      AC B4SV96.1
#=GS G7T4C3_SALPS/76-240      AC G7T4C3.1
#=GS L6TN71_SALEN/76-240      AC L6TN71.1
#=GS A0A018XI45_SALET/76-240  AC A0A018XI45.1
#=GS L6RD57_SALEN/76-240      AC L6RD57.1
#=GS X2VF73_SALEN/76-240      AC X2VF73.1
#=GS V2J0A1_SALAN/76-240      AC V2J0A1.1
#=GS A0A058SWR0_SALET/76-240  AC A0A058SWR0.1
#=GS X4IVH2_SALEN/76-240      AC X4IVH2.1
#=GS X2VS28_SALEN/76-240      AC X2VS28.1
#=GS X4TZK5_SALEN/76-240      AC X4TZK5.1
#=GS S5MX23_SALBN/1-154       AC S5MX23.1
#=GS X3MCG9_SALEN/76-240      AC X3MCG9.1
#=GS L6BLG6_SALEN/76-240      AC L6BLG6.1
#=GS J1SZQ4_SALEN/76-240      AC J1SZQ4.1
#=GS V0JF46_SALET/76-240      AC V0JF46.1
#=GS L6MWE7_SALEN/76-240      AC L6MWE7.1
#=GS L6GSH7_SALEN/76-240      AC L6GSH7.1
#=GS U1K1P8_SALMU/76-240      AC U1K1P8.1
#=GS X3G4V5_SALEN/76-240      AC X3G4V5.1
#=GS S5SQU8_SALNE/1-154       AC S5SQU8.1
#=GS E7ZJ98_SALMO/76-240      AC E7ZJ98.1
#=GS N1IU79_SALET/1-154       AC N1IU79.1
#=GS X3MQT8_SALEN/76-240      AC X3MQT8.1
#=GS X3BY64_SALEN/76-240      AC X3BY64.1
#=GS I9EN88_SALNE/76-240      AC I9EN88.1
#=GS X4NCF3_SALEN/76-240      AC X4NCF3.1
#=GS V7T675_SALTM/76-240      AC V7T675.1
#=GS A0A024AS92_SALEN/76-240  AC A0A024AS92.1
#=GS I9ZRK7_SALNE/76-240      AC I9ZRK7.1
#=GS X3MQ01_SALEN/76-240      AC X3MQ01.1
#=GS I9DN18_SALNE/1-154       AC I9DN18.1
#=GS V1VLW2_SALSE/76-240      AC V1VLW2.1
#=GS I6A8A8_BURTH/134-289     AC I6A8A8.1
#=GS H7E9C7_SALHO/76-240      AC H7E9C7.1
#=GS G9ULR3_SALMO/76-240      AC G9ULR3.1
#=GS L6NKT8_SALEN/76-240      AC L6NKT8.1
#=GS V3Z673_SALET/76-240      AC V3Z673.1
#=GS SOPE_SALTI/76-240        AC Q9RPM6.3
#=GS V0NHS2_SALNE/76-240      AC V0NHS2.1
#=GS U6XP90_SALNE/76-240      AC U6XP90.1
#=GS N0XTF9_SALET/1-154       AC N0XTF9.1
#=GS X3ULZ7_SALEN/76-177      AC X3ULZ7.1
#=GS V1WFB1_SALMU/76-240      AC V1WFB1.1
#=GS X5A413_SALAN/76-240      AC X5A413.1
#=GS V0LTS2_SALET/76-240      AC V0LTS2.1
#=GS L6EYJ3_SALEN/76-240      AC L6EYJ3.1
#=GS V3Y1U4_SALET/76-240      AC V3Y1U4.1
#=GS I9IFJ0_SALNE/76-240      AC I9IFJ0.1
#=GS I2KTT8_BURPE/85-245      AC I2KTT8.1
#=GS S3EVK5_SALPT/76-240      AC S3EVK5.1
#=GS S4IZ82_SALDU/76-240      AC S4IZ82.1
#=GS X5AAN5_SALEN/76-240      AC X5AAN5.1
#=GS K5AUL2_SALET/76-240      AC K5AUL2.1
#=GS L6LV74_SALEN/1-154       AC L6LV74.1
#=GS W1M387_BURPE/85-245      AC W1M387.1
#=GS E8NNS3_SALET/76-240      AC E8NNS3.1
#=GS K8UWC4_SALTM/76-240      AC K8UWC4.1
#=GS X3LMP7_SALEN/76-240      AC X3LMP7.1
#=GS L6BQ74_SALEN/76-240      AC L6BQ74.1
#=GS L5WT99_SALEN/76-240      AC L5WT99.1
#=GS X3WS83_SALEN/76-240      AC X3WS83.1
#=GS X3CWU8_SALEN/76-240      AC X3CWU8.1
#=GS X5BC19_SALET/76-240      AC X5BC19.1
#=GS L5Z7I8_SALEN/76-240      AC L5Z7I8.1
#=GS X3KKD8_SALEN/76-240      AC X3KKD8.1
#=GS V0FN08_SALMS/76-240      AC V0FN08.1
#=GS A0A018UD08_SALET/76-240  AC A0A018UD08.1
#=GS C0Q2Y0_SALPC/1-154       AC C0Q2Y0.1
#=GS V0PG03_SALNE/76-240      AC V0PG03.1
#=GS G9W4I1_SALET/76-240      AC G9W4I1.1
#=GS X4RJT6_SALEN/76-240      AC X4RJT6.1
#=GS A0A023MS24_SALEN/76-240  AC A0A023MS24.1
#=GS J1KYP0_SALEN/76-240      AC J1KYP0.1
#=GS E7Z204_SALMO/76-240      AC E7Z204.1
#=GS I9KVB3_SALNE/76-145      AC I9KVB3.1
#=GS J2BPA9_SALEN/76-240      AC J2BPA9.1
#=GS X4GKR7_SALEN/76-240      AC X4GKR7.1
#=GS X3Q3A3_SALEN/76-240      AC X3Q3A3.1
#=GS V1IDW8_SALET/76-240      AC V1IDW8.1
#=GS X2R9D9_SALEN/76-240      AC X2R9D9.1
#=GS BOPE_BURTA/86-247        AC Q2T704.1
#=GS L9S2P1_SALEN/76-240      AC L9S2P1.1
#=GS J2DLZ9_SALEN/76-240      AC J2DLZ9.1
#=GS N0XE88_SALET/1-154       AC N0XE88.1
#=GS V7IQX1_SALET/76-240      AC V7IQX1.1
#=GS X4EES2_SALEN/76-240      AC X4EES2.1
#=GS X2LPK3_SALEN/76-210      AC X2LPK3.1
#=GS V1KHG7_SALET/76-240      AC V1KHG7.1
#=GS SOPE_SALPA/76-240        AC Q5PFI5.3
#=GS V1SEU2_SALET/76-240      AC V1SEU2.1
#=GS X4X8R3_SALEN/76-240      AC X4X8R3.1
#=GS E8AWE9_SALMO/76-240      AC E8AWE9.1
#=GS X3D077_SALEN/76-240      AC X3D077.1
#=GS X4PQ79_SALEN/76-240      AC X4PQ79.1
#=GS V1M049_SALET/76-240      AC V1M049.1
#=GS U3SHA1_SALTM/76-240      AC U3SHA1.1
#=GS V0D9J2_SALET/76-240      AC V0D9J2.1
#=GS X2ZM08_SALEN/76-240      AC X2ZM08.1
#=GS V2G8Z7_SALET/76-240      AC V2G8Z7.1
#=GS X2SA48_SALEN/76-240      AC X2SA48.1
#=GS V7RXT4_SALET/76-240      AC V7RXT4.1
#=GS L6GWB5_SALEN/76-240      AC L6GWB5.1
#=GS X4WJL6_SALEN/76-240      AC X4WJL6.1
#=GS L9QAQ4_SALGL/76-240      AC L9QAQ4.1
#=GS X4VWU7_SALEN/76-240      AC X4VWU7.1
#=GS U6Q6M8_SALET/76-240      AC U6Q6M8.1
#=GS N0N259_SALET/1-154       AC N0N259.1
#=GS V1U4N9_SALSE/76-240      AC V1U4N9.1
#=GS U6X2Y7_SALNE/76-240      AC U6X2Y7.1
#=GS B5N8F9_SALET/76-240      AC B5N8F9.1
#=GS X3M1K1_SALEN/76-240      AC X3M1K1.1
#=GS L5W2W3_SALPU/76-240      AC L5W2W3.1
#=GS L6C3B0_SALEN/76-240      AC L6C3B0.1
#=GS X3W3Q7_SALEN/76-240      AC X3W3Q7.1
#=GS A0A018X379_SALET/1-161   AC A0A018X379.1
#=GS L6QCH1_SALEN/76-240      AC L6QCH1.1
#=GS W6T2L8_SALET/76-240      AC W6T2L8.1
#=GS E8CNV7_SALMO/76-240      AC E8CNV7.1
#=GS X4NS29_SALEN/76-240      AC X4NS29.1
#=GS L6AB96_SALEN/76-240      AC L6AB96.1
#=GS V2IYL9_SALDZ/76-240      AC V2IYL9.1
#=GS L9T5F1_SALEN/76-240      AC L9T5F1.1
#=GS W8U3B0_YEREN/1-126       AC W8U3B0.1
#=GS N1H3G2_SALET/1-154       AC N1H3G2.1
#=GS X4LDJ7_SALEN/76-240      AC X4LDJ7.1
#=GS X4SM63_SALEN/76-240      AC X4SM63.1
#=GS X4K043_SALEN/76-240      AC X4K043.1
#=GS X2PJ67_SALEN/76-240      AC X2PJ67.1
#=GS A0A018XCL3_SALET/76-240  AC A0A018XCL3.1
#=GS X2PV90_SALEN/76-240      AC X2PV90.1
#=GS E8F7S4_SALMO/76-240      AC E8F7S4.1
#=GS V1YQD1_SALET/76-240      AC V1YQD1.1
#=GS G5QHW8_SALRU/1-154       AC G5QHW8.1
#=GS X3IMK8_SALEN/76-240      AC X3IMK8.1
#=GS F2FUD0_SALGL/76-240      AC F2FUD0.1
#=GS N0ILX3_SALET/1-154       AC N0ILX3.1
#=GS A0A018PYI4_SALET/76-240  AC A0A018PYI4.1
#=GS Q8GCQ5_SALET/63-213      AC Q8GCQ5.1
#=GS X4L7J3_SALEN/76-240      AC X4L7J3.1
#=GS V2LYQ0_SALET/76-240      AC V2LYQ0.1
#=GS X2QWX9_SALEN/76-240      AC X2QWX9.1
#=GS V7UKB3_SALET/76-240      AC V7UKB3.1
#=GS L6UAB2_SALEN/76-240      AC L6UAB2.1
#=GS E8D5F6_SALMO/76-240      AC E8D5F6.1
#=GS X2N7L2_SALEN/76-237      AC X2N7L2.1
#=GS X4RUQ5_SALEN/76-240      AC X4RUQ5.1
#=GS V1YE86_SALET/76-240      AC V1YE86.1
#=GS V7TL99_SALET/76-240      AC V7TL99.1
#=GS K4ZNU4_SALET/76-240      AC K4ZNU4.1
#=GS L6DE43_SALEN/76-240      AC L6DE43.1
#=GS E7XR11_SALMO/76-240      AC E7XR11.1
#=GS I0NCV8_SALET/76-240      AC I0NCV8.1
#=GS L6AAE2_SALEN/76-240      AC L6AAE2.1
#=GS U1JAN6_SALET/76-240      AC U1JAN6.1
#=GS U6QN89_SALET/76-240      AC U6QN89.1
#=GS X3DCG1_SALEN/76-240      AC X3DCG1.1
#=GS L6ZHK7_SALEN/76-240      AC L6ZHK7.1
#=GS L9QJH6_SALDU/76-240      AC L9QJH6.1
#=GS J1VA85_SALEN/76-240      AC J1VA85.1
#=GS V0PV47_SALNE/1-164       AC V0PV47.1
#=GS X2S9T3_SALEN/76-240      AC X2S9T3.1
#=GS L6X473_SALEN/76-240      AC L6X473.1
#=GS A0A018VTL1_SALET/22-182  AC A0A018VTL1.1
#=GS X2QHJ6_SALEN/76-240      AC X2QHJ6.1
#=GS L9Q598_SALDU/76-240      AC L9Q598.1
#=GS L5XU61_SALEN/76-240      AC L5XU61.1
#=GS X3SXM4_SALEN/76-240      AC X3SXM4.1
#=GS N0Z4C3_SALET/1-154       AC N0Z4C3.1
#=GS T2PUN4_SALEN/76-240      AC T2PUN4.1
#=GS S5HN37_SALET/76-245      AC S5HN37.1
#=GS L5WSC8_SALEN/76-240      AC L5WSC8.1
#=GS N0RZ22_SALET/1-154       AC N0RZ22.1
#=GS X4LJR7_SALEN/76-240      AC X4LJR7.1
#=GS N0JJV6_SALET/1-154       AC N0JJV6.1
#=GS Q8GCP8_SALET/63-213      AC Q8GCP8.1
#=GS L6H1I5_SALEN/76-240      AC L6H1I5.1
#=GS L7AN78_SALET/76-240      AC L7AN78.1
#=GS I9GNV6_SALNE/76-240      AC I9GNV6.1
#=GS X3CAT3_SALEN/76-240      AC X3CAT3.1
#=GS L6C495_SALEN/76-240      AC L6C495.1
#=GS X3Z1D4_SALEN/76-240      AC X3Z1D4.1
#=GS S5H9I4_SALTM/76-240      AC S5H9I4.1
#=GS B5PH60_SALET/76-240      AC B5PH60.1
#=GS J2B3Z0_SALEN/76-240      AC J2B3Z0.1
#=GS A0A018ZQS0_SALET/25-185  AC A0A018ZQS0.1
#=GS K0QGZ9_SALNE/76-240      AC K0QGZ9.1
#=GS B5R218_SALEP/76-240      AC B5R218.1
#=GS X4P0G8_SALEN/76-240      AC X4P0G8.1
#=GS A0A017RJS8_SALET/76-240  AC A0A017RJS8.1
#=GS R0EMA3_SALHO/76-240      AC R0EMA3.1
#=GS L6K081_SALEN/76-240      AC L6K081.1
#=GS X2Y3T9_SALEN/76-240      AC X2Y3T9.1
#=GS X4AKU2_SALEN/76-240      AC X4AKU2.1
#=GS L5WHL9_SALEN/76-240      AC L5WHL9.1
#=GS L6R5X8_SALEN/76-240      AC L6R5X8.1
#=GS X3F4M0_SALEN/76-240      AC X3F4M0.1
#=GS A0A018Z0E2_SALET/76-240  AC A0A018Z0E2.1
#=GS V1QV38_SALPT/76-240      AC V1QV38.1
#=GS J2CRN4_SALEN/76-240      AC J2CRN4.1
#=GS L6UW33_SALEN/76-240      AC L6UW33.1
#=GS I0MNR1_SALET/76-240      AC I0MNR1.1
#=GS X4K5C7_SALEN/76-240      AC X4K5C7.1
#=GS J1TR74_SALEN/76-240      AC J1TR74.1
#=GS K5AIL7_SALET/1-164       AC K5AIL7.1
#=GS X4WFU0_SALEN/76-240      AC X4WFU0.1
#=GS L6YK68_SALEN/76-240      AC L6YK68.1
#=GS X4L9A2_SALEN/76-240      AC X4L9A2.1
#=GS I9M2C8_SALNE/76-240      AC I9M2C8.1
#=GS S4J7Q0_SALEN/76-240      AC S4J7Q0.1
#=GS H0L505_SALMO/76-240      AC H0L505.1
#=GS B7CYY6_BURPE/85-245      AC B7CYY6.1
#=GS L6P3H0_SALEN/76-240      AC L6P3H0.1
#=GS N0V975_SALET/1-154       AC N0V975.1
#=GS L5XJ68_SALEN/76-240      AC L5XJ68.1
#=GS Q8GCQ0_SALET/63-213      AC Q8GCQ0.1
#=GS V7SU93_SALET/76-240      AC V7SU93.1
#=GS X4J060_SALEN/76-240      AC X4J060.1
#=GS G5PM24_SALET/1-154       AC G5PM24.1
#=GS A0A024ARU6_SALEN/76-240  AC A0A024ARU6.1
#=GS X4B418_SALEN/76-240      AC X4B418.1
#=GS E8DJN1_SALMO/1-154       AC E8DJN1.1
#=GS E8FS57_SALMO/76-240      AC E8FS57.1
#=GS I0M0G6_SALET/76-240      AC I0M0G6.1
#=GS X2NAG6_SALEN/1-154       AC X2NAG6.1
#=GS V1YCP3_SALET/76-240      AC V1YCP3.1
#=GS X4FWI4_SALEN/76-240      AC X4FWI4.1
#=GS B5CHF0_SALET/28-192      AC B5CHF0.1
#=GS X3M6X3_SALEN/76-240      AC X3M6X3.1
#=GS X2SZD4_SALEN/76-240      AC X2SZD4.1
#=GS X4W8M7_SALEN/76-240      AC X4W8M7.1
#=GS V1XIR6_SALMS/76-240      AC V1XIR6.1
#=GS L6E4V3_SALEN/76-240      AC L6E4V3.1
#=GS X2U605_SALEN/76-240      AC X2U605.1
#=GS N0U6C2_SALET/1-154       AC N0U6C2.1
#=GS M3LKV2_SALNE/76-240      AC M3LKV2.1
#=GS V1EE56_SALET/76-240      AC V1EE56.1
#=GS X3NMV7_SALEN/76-240      AC X3NMV7.1
#=GS X2SB13_SALEN/76-240      AC X2SB13.1
#=GS X4BT71_SALEN/76-240      AC X4BT71.1
#=GS A0A018RL61_SALET/76-240  AC A0A018RL61.1
#=GS SOPE_SALHO/76-240        AC Q8VSR2.3
#=GS L5ZA47_SALEN/76-240      AC L5ZA47.1
#=GS X2S0W5_SALEN/76-240      AC X2S0W5.1
#=GS V1WTV6_SALET/76-240      AC V1WTV6.1
#=GS G9TZH6_SALMO/76-240      AC G9TZH6.1
#=GS X3BUR7_SALEN/76-240      AC X3BUR7.1
#=GS L6ELC8_SALEN/76-240      AC L6ELC8.1
#=GS E7VUB4_SALMO/76-240      AC E7VUB4.1
#=GS Q8GCP7_SALET/63-213      AC Q8GCP7.1
#=GS S5GZ23_SALET/1-164       AC S5GZ23.1
#=GS X2X4Y1_SALEN/76-240      AC X2X4Y1.1
#=GS A0A017QQU3_SALET/1-136   AC A0A017QQU3.1
#=GS B4TY24_SALSV/28-192      AC B4TY24.1
#=GS N0LNM5_SALET/1-154       AC N0LNM5.1
#=GS L6PKM0_SALEN/76-240      AC L6PKM0.1
#=GS M3KTF9_SALNE/76-240      AC M3KTF9.1
#=GS U6WH72_SALTM/76-240      AC U6WH72.1
#=GS A0A018VJS8_SALET/24-188  AC A0A018VJS8.1
#=GS X4AG37_SALEN/76-240      AC X4AG37.1
#=GS L6WHI8_SALEN/76-240      AC L6WHI8.1
#=GS X4Q2Z1_SALEN/76-240      AC X4Q2Z1.1
#=GS K5A539_SALET/76-240      AC K5A539.1
#=GS L6E4T3_SALEN/76-240      AC L6E4T3.1
#=GS BOPE_BURM9/85-245        AC A2S1Q7.1
#=GS H6P2C2_SALTI/1-163       AC H6P2C2.1
#=GS I2KQI1_BURPE/85-245      AC I2KQI1.1
#=GS X2Z524_SALEN/76-240      AC X2Z524.1
#=GS J1PFR6_SALEN/76-240      AC J1PFR6.1
#=GS X4DVV5_SALEN/76-240      AC X4DVV5.1
#=GS V2B578_SALET/76-240      AC V2B578.1
#=GS X2Y450_SALEN/76-240      AC X2Y450.1
#=GS J1JVL4_SALEN/76-240      AC J1JVL4.1
#=GS V2B946_SALET/76-240      AC V2B946.1
#=GS M7E904_BURPE/85-245      AC M7E904.1
#=GS N1FEZ3_SALET/1-154       AC N1FEZ3.1
#=GS V0PVP0_SALNE/76-240      AC V0PVP0.1
#=GS A0A038E5Y8_SALTM/76-240  AC A0A038E5Y8.1
#=GS X4FBA6_SALEN/76-240      AC X4FBA6.1
#=GS X2YG81_SALEN/76-240      AC X2YG81.1
#=GS X2TU81_SALEN/76-240      AC X2TU81.1
#=GS V7QKR0_SALET/76-240      AC V7QKR0.1
#=GS S4JEM6_SALEN/1-154       AC S4JEM6.1
#=GS N0TIE6_SALET/1-154       AC N0TIE6.1
#=GS L6EHM1_SALEN/76-240      AC L6EHM1.1
#=GS I2M7Y8_BURPE/85-245      AC I2M7Y8.1
#=GS H6P6R8_SALTI/1-154       AC H6P6R8.1
#=GS X3VG60_SALEN/76-240      AC X3VG60.1
#=GS V8MBK0_SALIN/76-240      AC V8MBK0.1
#=GS L5YJ03_SALEN/76-240      AC L5YJ03.1
#=GS X3FSE6_SALEN/76-240      AC X3FSE6.1
#=GS L6W4X9_SALEN/76-240      AC L6W4X9.1
#=GS B5NV77_SALET/1-154       AC B5NV77.1
#=GS L6HQB0_SALEN/76-240      AC L6HQB0.1
#=GS T2PMQ3_SALEN/1-154       AC T2PMQ3.1
#=GS J1Y3U0_SALEN/76-240      AC J1Y3U0.1
#=GS X0NUS6_SALET/76-240      AC X0NUS6.1
#=GS A0A018T2A4_SALET/76-240  AC A0A018T2A4.1
#=GS L6RQM6_SALEN/76-240      AC L6RQM6.1
#=GS X3YBZ4_SALEN/76-240      AC X3YBZ4.1
#=GS V2JH48_SALET/78-242      AC V2JH48.1
#=GS N1DVG5_SALET/1-154       AC N1DVG5.1
#=GS X4DF70_SALEN/76-240      AC X4DF70.1
#=GS X2VF09_SALEN/76-240      AC X2VF09.1
#=GS X3GH01_SALEN/76-240      AC X3GH01.1
#=GS A0A018YAB4_SALET/76-240  AC A0A018YAB4.1
#=GS N0ZTZ8_SALET/1-154       AC N0ZTZ8.1
#=GS J2FPL2_SALEN/76-240      AC J2FPL2.1
#=GS X3ZVB1_SALEN/76-240      AC X3ZVB1.1
#=GS V2AMS2_SALDE/76-240      AC V2AMS2.1
#=GS X5APR3_SALET/76-240      AC X5APR3.1
#=GS S4IWZ9_SALEN/76-240      AC S4IWZ9.1
#=GS A0A018WGD0_SALET/25-185  AC A0A018WGD0.1
#=GS I9IPV6_SALNE/76-240      AC I9IPV6.1
#=GS L6PMY3_SALEN/76-240      AC L6PMY3.1
#=GS L6WVM9_SALEN/76-240      AC L6WVM9.1
#=GS V1LV38_SALET/76-240      AC V1LV38.1
#=GS V1YV24_SALET/76-240      AC V1YV24.1
#=GS X3UI25_SALEN/76-240      AC X3UI25.1
#=GS V7RH57_SALET/76-240      AC V7RH57.1
#=GS N0H6X9_SALET/1-154       AC N0H6X9.1
#=GS X2QK03_SALEN/76-240      AC X2QK03.1
#=GS X3BLN8_SALEN/76-240      AC X3BLN8.1
#=GS N1CZL5_SALET/1-154       AC N1CZL5.1
#=GS A0A018PYC9_SALET/76-240  AC A0A018PYC9.1
#=GS X3BR67_SALEN/76-240      AC X3BR67.1
#=GS G5P806_SALET/1-154       AC G5P806.1
#=GS T2QHC9_SALEN/1-154       AC T2QHC9.1
#=GS B5FTF5_SALDC/76-240      AC B5FTF5.1
#=GS V2ABN0_SALET/76-240      AC V2ABN0.1
#=GS V2DRE6_SALET/76-240      AC V2DRE6.1
#=GS V1M1W3_SALSE/76-240      AC V1M1W3.1
#=GS N1HYV8_SALET/1-154       AC N1HYV8.1
#=GS L6AUV6_SALEN/76-240      AC L6AUV6.1
#=GS V1FGQ8_SALTM/76-240      AC V1FGQ8.1
#=GS X4CHK1_SALEN/76-240      AC X4CHK1.1
#=GS X2U6P6_SALEN/76-240      AC X2U6P6.1
#=GS X3PCI7_SALEN/76-240      AC X3PCI7.1
#=GS I0MGS4_SALET/76-240      AC I0MGS4.1
#=GS X2WBE2_SALEN/76-240      AC X2WBE2.1
#=GS V2AFL1_SALET/3-82        AC V2AFL1.1
#=GS X3FGP7_SALEN/76-240      AC X3FGP7.1
#=GS N0Q9V2_SALET/1-154       AC N0Q9V2.1
#=GS N0VXN6_SALET/1-154       AC N0VXN6.1
#=GS S3EJC7_SALPT/76-240      AC S3EJC7.1
#=GS X3QK94_SALEN/76-240      AC X3QK94.1
#=GS V1RD23_SALPT/76-240      AC V1RD23.1
#=GS V3XDI3_SALET/76-240      AC V3XDI3.1
#=GS X2LK35_SALEN/1-134       AC X2LK35.1
#=GS X4KWW0_SALEN/76-240      AC X4KWW0.1
#=GS H0NAM8_SALET/76-240      AC H0NAM8.1
#=GS X3JEH9_SALEN/76-240      AC X3JEH9.1
#=GS U1RCA4_SALEN/76-240      AC U1RCA4.1
#=GS V1M331_SALSE/76-240      AC V1M331.1
#=GS X2VYQ2_SALEN/76-240      AC X2VYQ2.1
#=GS X2RXP1_SALEN/76-240      AC X2RXP1.1
#=GS J1WAN7_SALEN/76-240      AC J1WAN7.1
#=GS K8US92_SALTM/76-240      AC K8US92.1
#=GS X3B5G3_SALEN/76-240      AC X3B5G3.1
#=GS V8MP40_SALIN/76-240      AC V8MP40.1
#=GS N0SJ56_SALET/1-154       AC N0SJ56.1
#=GS B5R1Z8_SALEP/76-240      AC B5R1Z8.1
#=GS X3S4Q8_SALEN/76-240      AC X3S4Q8.1
#=GS V1RGV0_SALET/16-180      AC V1RGV0.1
#=GS S4HT36_SALDU/76-240      AC S4HT36.1
#=GS E8EM19_SALMO/76-240      AC E8EM19.1
#=GS A0A018U0P0_SALET/76-240  AC A0A018U0P0.1
#=GS X4M1Q7_SALEN/76-240      AC X4M1Q7.1
#=GS Q8GCQ6_SALET/63-213      AC Q8GCQ6.1
#=GS A9K527_BURML/85-245      AC A9K527.1
#=GS L6ZI19_SALEN/76-240      AC L6ZI19.1
#=GS U5V164_BURPE/85-245      AC U5V164.1
#=GS X4M9B3_SALEN/76-240      AC X4M9B3.1
#=GS N0H0B1_SALET/1-154       AC N0H0B1.1
#=GS S4JTI5_SALEN/76-240      AC S4JTI5.1
#=GS V0I835_SALSE/1-154       AC V0I835.1
#=GS L6ELF4_SALEN/76-240      AC L6ELF4.1
#=GS X4CPJ0_SALEN/76-240      AC X4CPJ0.1
#=GS V1Q4D5_SALET/76-240      AC V1Q4D5.1
#=GS X2TNK4_SALEN/76-240      AC X2TNK4.1
#=GS A0A019A6V9_SALET/47-211  AC A0A019A6V9.1
#=GS B5PH67_SALET/76-240      AC B5PH67.1
#=GS X3CMP9_SALEN/76-240      AC X3CMP9.1
#=GS L6J2I9_SALEN/76-240      AC L6J2I9.1
#=GS X3EU12_SALEN/1-100       AC X3EU12.1
#=GS X4HV76_SALEN/76-240      AC X4HV76.1
#=GS I0N1R7_SALET/76-240      AC I0N1R7.1
#=GS L6W757_SALEN/76-240      AC L6W757.1
#=GS V1U326_SALET/76-240      AC V1U326.1
#=GS W4MPB7_SALET/76-240      AC W4MPB7.1
#=GS X2MVD2_SALEN/76-225      AC X2MVD2.1
#=GS S4K350_SALEN/76-240      AC S4K350.1
#=GS L6FVH6_SALEN/76-240      AC L6FVH6.1
#=GS V0JZX8_SALET/76-240      AC V0JZX8.1
#=GS L6RDD9_SALEN/1-154       AC L6RDD9.1
#=GS N0PKW2_SALET/1-154       AC N0PKW2.1
#=GS A0A018V456_SALET/76-240  AC A0A018V456.1
#=GS L6WFN2_SALEN/76-240      AC L6WFN2.1
#=GS S5NE67_BURPE/85-245      AC S5NE67.1
#=GS A0A018SR09_SALET/1-164   AC A0A018SR09.1
#=GS S3E691_SALPT/76-240      AC S3E691.1
#=GS X4ISG4_SALEN/76-240      AC X4ISG4.1
#=GS L6T7B2_SALEN/76-240      AC L6T7B2.1
#=GS X3YB41_SALEN/76-240      AC X3YB41.1
#=GS X3JPJ2_SALEN/76-240      AC X3JPJ2.1
#=GS G5L858_SALET/1-154       AC G5L858.1
#=GS H8LXL2_SALTM/1-164       AC H8LXL2.1
#=GS A0A018SVV0_SALET/76-240  AC A0A018SVV0.1
#=GS I9K9B5_SALNE/76-240      AC I9K9B5.1
#=GS L6K056_SALEN/76-240      AC L6K056.1
#=GS V0BMZ0_SALET/76-240      AC V0BMZ0.1
#=GS S4M1R5_SALEN/76-240      AC S4M1R5.1
#=GS L6PA41_SALEN/76-240      AC L6PA41.1
#=GS A0A018NCL3_SALET/76-240  AC A0A018NCL3.1
#=GS Q9AH24_SALDZ/1-97        AC Q9AH24.1
#=GS V0H850_SALET/76-240      AC V0H850.1
#=GS G9VGE4_SALMO/76-240      AC G9VGE4.1
#=GS H0MZT8_SALMO/76-240      AC H0MZT8.1
#=GS X3HYE0_SALEN/76-240      AC X3HYE0.1
#=GS X4EK70_SALEN/76-240      AC X4EK70.1
#=GS B5Q9W6_SALVI/76-240      AC B5Q9W6.1
#=GS A0A018Q0R3_SALET/76-240  AC A0A018Q0R3.1
#=GS X3CJK1_SALEN/76-240      AC X3CJK1.1
#=GS N0AP44_BURTH/87-244      AC N0AP44.1
#=GS X4VID6_SALEN/76-240      AC X4VID6.1
#=GS I9GSX2_SALNE/76-240      AC I9GSX2.1
#=GS G9T4W1_SALMO/76-240      AC G9T4W1.1
#=GS E8X9B5_SALT4/76-240      AC E8X9B5.1
#=GS A0A018YRL9_SALET/25-185  AC A0A018YRL9.1
#=GS A0A038D790_SALET/76-240  AC A0A038D790.1
#=GS L6PI31_SALEN/76-240      AC L6PI31.1
#=GS M4LPR7_SALET/76-240      AC M4LPR7.1
#=GS L6ABC2_SALEN/76-240      AC L6ABC2.1
#=GS X2R7C3_SALEN/76-240      AC X2R7C3.1
#=GS V7SGR4_SALTM/76-240      AC V7SGR4.1
#=GS X4HZP8_SALEN/76-240      AC X4HZP8.1
#=GS L9SI28_SALEN/76-240      AC L9SI28.1
#=GS C4I6J6_BURPE/85-245      AC C4I6J6.1
#=GS I0MSD2_SALET/76-240      AC I0MSD2.1
#=GS L6EYH0_SALEN/76-240      AC L6EYH0.1
#=GS N0Q0S4_SALET/1-154       AC N0Q0S4.1
#=GS W6B9P0_BURTH/86-247      AC W6B9P0.1
#=GS BOPE_BURM7/85-245        AC A3MCH6.1
#=GS X3N0X3_SALEN/76-240      AC X3N0X3.1
#=GS J1N7Y2_SALEN/76-240      AC J1N7Y2.1
#=GS K7Q1T5_BURPE/85-245      AC K7Q1T5.1
#=GS V1JZ17_SALET/76-240      AC V1JZ17.1
#=GS X2ZVW0_SALEN/76-240      AC X2ZVW0.1
#=GS X2KJH9_SALET/76-240      AC X2KJH9.1
#=GS L6UWE6_SALEN/76-240      AC L6UWE6.1
#=GS Q8GCP9_SALET/63-213      AC Q8GCP9.1
#=GS X5BV42_SALAB/76-240      AC X5BV42.1
#=GS V0FC37_SALET/76-240      AC V0FC37.1
#=GS X3IPK8_SALEN/76-240      AC X3IPK8.1
#=GS N1B0U7_SALET/1-154       AC N1B0U7.1
#=GS J0FG73_SALNE/1-150       AC J0FG73.1
#=GS U6UCG5_SALET/76-240      AC U6UCG5.1
#=GS V7WKU8_SALET/76-240      AC V7WKU8.1
#=GS V0MT45_SALNE/76-240      AC V0MT45.1
#=GS X4JB17_SALEN/76-240      AC X4JB17.1
#=GS L5YTC3_SALEN/76-240      AC L5YTC3.1
#=GS V1JWQ7_SALTM/76-240      AC V1JWQ7.1
#=GS B2HCG9_BURPE/85-245      AC B2HCG9.1
#=GS X2PJE9_SALEN/76-240      AC X2PJE9.1
#=GS X3QFW0_SALEN/76-240      AC X3QFW0.1
#=GS X3TPH2_SALEN/76-240      AC X3TPH2.1
#=GS V1RR74_SALPU/76-240      AC V1RR74.1
#=GS Q99Q83_SALBN/1-97        AC Q99Q83.1
#=GS X3WV74_SALEN/76-240      AC X3WV74.1
#=GS S4JWA9_SALEN/1-154       AC S4JWA9.1
#=GS L6YD29_SALEN/81-245      AC L6YD29.1
#=GS A0A018QPX3_SALET/76-240  AC A0A018QPX3.1
#=GS J1N7V0_SALEN/76-240      AC J1N7V0.1
#=GS V0NBL7_SALNE/76-240      AC V0NBL7.1
#=GS I0MCF1_SALET/1-164       AC I0MCF1.1
#=GS L6YFS0_SALEN/76-240      AC L6YFS0.1
#=GS L6K9R8_SALEN/76-240      AC L6K9R8.1
#=GS I9EZG9_SALNE/76-240      AC I9EZG9.1
#=GS V0GCD7_SALPU/76-240      AC V0GCD7.1
#=GS L6HX28_SALEN/76-240      AC L6HX28.1
#=GS I9H5R7_SALNE/76-240      AC I9H5R7.1
#=GS X4B360_SALEN/76-240      AC X4B360.1
#=GS S5I2F8_SALET/76-240      AC S5I2F8.1
#=GS X3P6E5_SALEN/76-240      AC X3P6E5.1
#=GS X4X597_SALEN/76-240      AC X4X597.1
#=GS SOPE_SALGL/76-240        AC Q8VSQ6.3
#=GS X7RJY6_SALTI/76-240      AC X7RJY6.1
#=GS V0EH67_SALET/76-240      AC V0EH67.1
#=GS U6Z1U6_SALTM/76-240      AC U6Z1U6.1
#=GS U6V6D0_SALET/76-240      AC U6V6D0.1
#=GS L5XT27_SALEN/76-240      AC L5XT27.1
#=GS L6RRW5_SALEN/76-240      AC L6RRW5.1
#=GS X3X297_SALEN/76-240      AC X3X297.1
#=GS X4MLH8_SALEN/76-240      AC X4MLH8.1
#=GS M9XQN2_SALTM/76-240      AC M9XQN2.1
#=GS L5Z7K8_SALEN/76-240      AC L5Z7K8.1
#=GS S4J1K7_SALEN/76-240      AC S4J1K7.1
#=GS X3XHS5_SALEN/76-240      AC X3XHS5.1
#=GS R7RKH3_SALET/76-240      AC R7RKH3.1
#=GS N0KGD6_SALET/1-154       AC N0KGD6.1
#=GS V1FFM4_SALTM/76-240      AC V1FFM4.1
#=GS X4HEZ0_SALEN/76-240      AC X4HEZ0.1
#=GS L6ZWL5_SALEN/76-240      AC L6ZWL5.1
#=GS A0A021WVA3_SALET/76-240  AC A0A021WVA3.1
#=GS V7X1C8_SALTM/76-240      AC V7X1C8.1
#=GS L9QB04_SALDU/75-239      AC L9QB04.1
#=GS G5MHA9_SALET/1-154       AC G5MHA9.1
#=GS M3K3B4_SALNE/76-240      AC M3K3B4.1
#=GS L5ZA69_SALEN/76-240      AC L5ZA69.1
#=GS B4TKI8_SALHS/76-240      AC B4TKI8.1
#=GS J2FCP3_SALEN/76-240      AC J2FCP3.1
#=GS V2KTL3_SALET/76-128      AC V2KTL3.1
#=GS X3ZDE9_SALEN/76-240      AC X3ZDE9.1
#=GS X3B961_SALEN/76-240      AC X3B961.1
#=GS A0A018UQE4_SALET/33-197  AC A0A018UQE4.1
#=GS J2G896_SALEN/76-240      AC J2G896.1
#=GS J0E8R7_SALNE/2-72        AC J0E8R7.1
#=GS V1GJ47_SALET/76-240      AC V1GJ47.1
#=GS L6IU52_SALEN/76-240      AC L6IU52.1
#=GS V1XD62_SALMS/76-240      AC V1XD62.1
#=GS SOPE_SALDU/76-240        AC O06949.3
#=GS SOPE2_SALPA/76-240       AC Q5PHN0.3
#=GS V0FJH5_SALET/76-240      AC V0FJH5.1
#=GS N0TL18_SALET/1-154       AC N0TL18.1
#=GS B4A164_SALNE/76-240      AC B4A164.1
#=GS U1RD99_SALEN/76-240      AC U1RD99.1
#=GS H0M187_SALMO/76-240      AC H0M187.1
#=GS K5AKP6_SALET/76-240      AC K5AKP6.1
#=GS Q9AH23_SALHO/1-97        AC Q9AH23.1
#=GS V0P9N9_SALNE/1-87        AC V0P9N9.1
#=GS I0M139_SALET/1-164       AC I0M139.1
#=GS L6QCJ4_SALEN/76-240      AC L6QCJ4.1
#=GS X3TCJ3_SALEN/76-240      AC X3TCJ3.1
#=GS N0IY38_SALET/1-154       AC N0IY38.1
#=GS L6ARZ0_SALEN/76-240      AC L6ARZ0.1
#=GS X2V2R3_SALEN/76-240      AC X2V2R3.1
#=GS V0LP12_SALET/76-240      AC V0LP12.1
#=GS R0EM52_SALHO/76-240      AC R0EM52.1
#=GS X3HME2_SALEN/76-240      AC X3HME2.1
#=GS M3JMH6_SALNE/76-240      AC M3JMH6.1
#=GS V2HDR5_SALET/76-240      AC V2HDR5.1
#=GS V2B060_SALET/76-240      AC V2B060.1
#=GS X4MAX1_SALEN/76-240      AC X4MAX1.1
#=GS N0UU66_SALET/1-154       AC N0UU66.1
#=GS U6TYH1_SALET/76-240      AC U6TYH1.1
#=GS X3SLD4_SALEN/76-240      AC X3SLD4.1
#=GS N0R1K1_SALET/1-154       AC N0R1K1.1
#=GS S5GU30_SALET/76-240      AC S5GU30.1
#=GS G5Q1J1_SALMO/1-154       AC G5Q1J1.1
#=GS L6HPT1_SALEN/76-240      AC L6HPT1.1
#=GS V0MVW4_SALNE/76-240      AC V0MVW4.1
#=GS X3ASZ8_SALEN/76-240      AC X3ASZ8.1
#=GS X2T407_SALEN/76-240      AC X2T407.1
#=GS X3T9Q9_SALEN/76-240      AC X3T9Q9.1
#=GS L6R953_SALEN/1-164       AC L6R953.1
#=GS B5P6N1_SALET/76-240      AC B5P6N1.1
#=GS J1SIE8_SALEN/76-240      AC J1SIE8.1
#=GS E9A164_SALET/76-240      AC E9A164.1
#=GS X3WPG4_SALEN/76-240      AC X3WPG4.1
#=GS X4FE63_SALEN/76-240      AC X4FE63.1
#=GS X4PD22_SALEN/76-240      AC X4PD22.1
#=GS X4ELZ1_SALEN/76-240      AC X4ELZ1.1
#=GS J0E226_SALNE/76-240      AC J0E226.1
#=GS X3W1L1_SALEN/76-240      AC X3W1L1.1
#=GS V2C8V4_SALET/76-240      AC V2C8V4.1
#=GS L6ZX27_SALEN/76-240      AC L6ZX27.1
#=GS V1IZ92_SALMU/76-240      AC V1IZ92.1
#=GS I2KRQ4_BURPE/85-245      AC I2KRQ4.1
#=GS X3AWJ5_SALEN/76-240      AC X3AWJ5.1
#=GS X3R8R2_SALEN/76-240      AC X3R8R2.1
#=GS X3VPC0_SALEN/76-240      AC X3VPC0.1
#=GS A0A018W2B2_SALET/76-240  AC A0A018W2B2.1
#=GS I0MH80_SALET/76-240      AC I0MH80.1
#=GS V2CPC1_SALET/76-240      AC V2CPC1.1
#=GS L6MK53_SALEN/76-240      AC L6MK53.1
#=GS J1J803_SALEN/76-240      AC J1J803.1
#=GS A0A018U6B2_SALET/76-240  AC A0A018U6B2.1
#=GS X4RHD2_SALEN/76-240      AC X4RHD2.1
#=GS A0A018ZD37_SALET/76-240  AC A0A018ZD37.1
#=GS S4K0X1_SALEN/76-240      AC S4K0X1.1
#=GS X4FV49_SALEN/76-240      AC X4FV49.1
#=GS N1HX89_SALET/1-154       AC N1HX89.1
#=GS X5MZC6_SALET/76-240      AC X5MZC6.1
#=GS X2Q553_SALEN/76-240      AC X2Q553.1
#=GS L6G5S9_SALEN/76-240      AC L6G5S9.1
#=GS V0CHE4_SALET/76-240      AC V0CHE4.1
#=GS I0AA05_SALET/59-223      AC I0AA05.1
#=GS L6KHE7_SALEN/76-240      AC L6KHE7.1
#=GS BOPE_BURP6/85-245        AC A3NLC8.1
#=GS X4JN21_SALEN/76-240      AC X4JN21.1
#=GS A0A018RVH4_SALET/22-183  AC A0A018RVH4.1
#=GS D0ZK57_SALT1/76-240      AC D0ZK57.1
#=GS X4TCA4_SALEN/76-240      AC X4TCA4.1
#=GS S3G9Z2_SALPT/76-240      AC S3G9Z2.1
#=GS X3XSI5_SALEN/76-240      AC X3XSI5.1
#=GS I9PZ90_SALNE/76-240      AC I9PZ90.1
#=GS X3AC54_SALEN/76-240      AC X3AC54.1
#=GS L6AR63_SALEN/76-240      AC L6AR63.1
#=GS X4DQF8_SALEN/76-240      AC X4DQF8.1
#=GS V1X819_SALMS/76-240      AC V1X819.1
#=GS X4J3L4_SALEN/76-240      AC X4J3L4.1
#=GS E7Y214_SALMO/76-240      AC E7Y214.1
#=GS A0A018R712_SALET/76-240  AC A0A018R712.1
#=GS X3LA02_SALEN/76-240      AC X3LA02.1
#=GS L6ILX2_SALEN/76-240      AC L6ILX2.1
#=GS X3IBS1_SALEN/76-240      AC X3IBS1.1
#=GS A0A018UE51_SALET/86-250  AC A0A018UE51.1
#=GS X4V6F0_SALEN/76-240      AC X4V6F0.1
#=GS V1MAR7_SALSE/76-240      AC V1MAR7.1
#=GS L6UCT6_SALEN/76-240      AC L6UCT6.1
#=GS V4GFX7_SALON/76-240      AC V4GFX7.1
#=GS X2ZQV3_SALEN/76-240      AC X2ZQV3.1
#=GS G5REK8_SALET/1-154       AC G5REK8.1
#=GS G9TH69_SALMO/76-240      AC G9TH69.1
#=GS I9D2R5_SALNE/76-240      AC I9D2R5.1
#=GS X4MJM0_SALEN/76-240      AC X4MJM0.1
#=GS B5NIZ3_SALET/76-240      AC B5NIZ3.1
#=GS A0A018ZGT9_SALET/56-216  AC A0A018ZGT9.1
#=GS L6Y4L3_SALEN/76-240      AC L6Y4L3.1
#=GS X3WUR6_SALEN/76-240      AC X3WUR6.1
#=GS X3XUF5_SALEN/76-240      AC X3XUF5.1
#=GS X3ZJ30_SALEN/76-240      AC X3ZJ30.1
#=GS J2ATR9_SALEN/76-240      AC J2ATR9.1
#=GS J0D7R3_SALNE/76-240      AC J0D7R3.1
#=GS X3UK35_SALEN/76-240      AC X3UK35.1
#=GS V2I8M2_SALET/76-240      AC V2I8M2.1
#=GS V0LAQ1_SALET/76-240      AC V0LAQ1.1
#=GS L6ILS9_SALEN/76-240      AC L6ILS9.1
#=GS V0NWR2_SALNE/76-240      AC V0NWR2.1
#=GS V9Z1U9_BURPE/85-245      AC V9Z1U9.1
#=GS S3EMC7_SALPT/76-240      AC S3EMC7.1
#=GS A0A018ZH07_SALET/1-164   AC A0A018ZH07.1
#=GS A0A018NFP8_SALET/76-240  AC A0A018NFP8.1
#=GS K8S8B1_SALTM/76-240      AC K8S8B1.1
#=GS X4JYQ2_SALEN/76-240      AC X4JYQ2.1
#=GS X4SZY9_SALEN/76-240      AC X4SZY9.1
#=GS V1UMF9_SALMO/76-240      AC V1UMF9.1
#=GS V0C1X4_SALET/76-240      AC V0C1X4.1
#=GS X3ZIM9_SALEN/76-240      AC X3ZIM9.1
#=GS L6KH79_SALEN/76-240      AC L6KH79.1
#=GS U4MBV0_SALTM/76-240      AC U4MBV0.1
#=GS A0A018T0C4_SALET/76-240  AC A0A018T0C4.1
#=GS X3LDS3_SALEN/76-240      AC X3LDS3.1
#=GS J1H3W7_SALEN/76-240      AC J1H3W7.1
#=GS W0PZA0_BURPE/85-245      AC W0PZA0.1
#=GS C4AWI0_BURML/85-245      AC C4AWI0.1
#=GS V6YT12_SALET/76-240      AC V6YT12.1
#=GS I2LZ17_BURPE/85-245      AC I2LZ17.1
#=GS L6L4B1_SALEN/76-240      AC L6L4B1.1
#=GS V1KBT3_SALTH/76-240      AC V1KBT3.1
#=GS A0A018VA89_SALET/76-240  AC A0A018VA89.1
#=GS V0J1J1_SALET/76-240      AC V0J1J1.1
#=GS X3GIR0_SALEN/76-240      AC X3GIR0.1
#=GS U6W3W3_SALTM/76-240      AC U6W3W3.1
#=GS A0A017RN95_SALET/76-236  AC A0A017RN95.1
#=GS V1HLK6_SALET/76-240      AC V1HLK6.1
#=GS V0P099_SALNE/1-154       AC V0P099.1
#=GS L9SMZ9_SALEN/76-240      AC L9SMZ9.1
#=GS C4K8Y0_HAMD5/307-476     AC C4K8Y0.1
#=GS U6YLQ2_SALTM/76-240      AC U6YLQ2.1
#=GS X3QQ32_SALEN/76-240      AC X3QQ32.1
#=GS L7AFA4_SALEN/76-240      AC L7AFA4.1
#=GS K8S6L0_SALTM/76-240      AC K8S6L0.1
#=GS L6UVS7_SALEN/76-240      AC L6UVS7.1
#=GS SOPE_SALET/76-240        AC Q7BD17.3
#=GS X4S7C6_SALEN/76-240      AC X4S7C6.1
#=GS X4CUS6_SALEN/76-240      AC X4CUS6.1
#=GS N1BND3_SALET/1-154       AC N1BND3.1
#=GS E7WG14_SALMO/76-240      AC E7WG14.1
#=GS L6YNS2_SALEN/76-240      AC L6YNS2.1
#=GS V1GWQ3_SALHO/76-240      AC V1GWQ3.1
#=GS A0A018YF86_SALET/76-240  AC A0A018YF86.1
#=GS X3SB01_SALEN/76-240      AC X3SB01.1
#=GS V0R777_SALNE/76-240      AC V0R777.1
#=GS L6TMT1_SALEN/76-240      AC L6TMT1.1
#=GS V0PX30_SALNE/76-240      AC V0PX30.1
#=GS B5FTH6_SALDC/76-240      AC B5FTH6.1
#=GS X4QRH6_SALEN/76-240      AC X4QRH6.1
#=GS N0YIM1_SALET/1-154       AC N0YIM1.1
#=GS H7E9H1_SALHO/76-240      AC H7E9H1.1
#=GS E8CHC5_SALMO/76-240      AC E8CHC5.1
#=GS V1RPM0_SALET/76-240      AC V1RPM0.1
#=GS X4D6Q3_SALEN/76-240      AC X4D6Q3.1
#=GS K5AWE2_SALET/76-240      AC K5AWE2.1
#=GS V1TUR9_SALET/1-134       AC V1TUR9.1
#=GS N1D932_SALET/1-154       AC N1D932.1
#=GS S5GYR0_SALET/76-240      AC S5GYR0.1
#=GS X4IHC8_SALEN/76-240      AC X4IHC8.1
#=GS J1TR94_SALEN/76-240      AC J1TR94.1
#=GS U6TFQ6_SALET/76-240      AC U6TFQ6.1
#=GS L6CLA4_SALEN/76-240      AC L6CLA4.1
#=GS L5ZMB8_SALEN/76-240      AC L5ZMB8.1
#=GS X2SRG5_SALEN/76-240      AC X2SRG5.1
#=GS W0MN55_BURPE/85-245      AC W0MN55.1
#=GS U6YL42_SALTM/76-240      AC U6YL42.1
#=GS L6CZ59_SALEN/76-240      AC L6CZ59.1
#=GS X4C1F3_SALEN/76-240      AC X4C1F3.1
#=GS X2XJJ5_SALEN/76-240      AC X2XJJ5.1
#=GS X3Y6H7_SALEN/76-240      AC X3Y6H7.1
#=GS X2NI59_SALEN/76-240      AC X2NI59.1
#=GS X3V1W4_SALEN/76-240      AC X3V1W4.1
#=GS V3YRH2_SALNE/76-240      AC V3YRH2.1
#=GS X2MCH6_SALEN/43-117      AC X2MCH6.1
#=GS N0VGE9_SALET/1-154       AC N0VGE9.1
#=GS V2GGV0_SALET/76-240      AC V2GGV0.1
#=GS A9MNG9_SALAR/76-240      AC A9MNG9.1
#=GS V1Z6K7_SALET/76-240      AC V1Z6K7.1
#=GS L9SN73_SALEN/76-240      AC L9SN73.1
#=GS N0NUZ4_SALET/1-154       AC N0NUZ4.1
#=GS V1PB89_SALET/76-240      AC V1PB89.1
#=GS X3QT59_SALEN/76-240      AC X3QT59.1
#=GS X2UQY9_SALEN/76-240      AC X2UQY9.1
#=GS V1NII9_SALRU/76-240      AC V1NII9.1
#=GS L6G539_SALEN/76-240      AC L6G539.1
#=GS N0YDB8_SALET/1-154       AC N0YDB8.1
#=GS A0A018U7W3_SALET/33-197  AC A0A018U7W3.1
#=GS V2P1L4_SALET/76-240      AC V2P1L4.1
#=GS G4C2J0_SALIN/76-240      AC G4C2J0.1
#=GS Q7P1B7_CHRVO/84-241      AC Q7P1B7.1
#=GS U6QZN3_SALET/76-240      AC U6QZN3.1
#=GS X4Q5V3_SALEN/76-240      AC X4Q5V3.1
#=GS L6XLL1_SALEN/76-240      AC L6XLL1.1
#=GS V2DBX7_SALBE/76-240      AC V2DBX7.1
#=GS X3PCC7_SALEN/76-240      AC X3PCC7.1
#=GS X3K7S7_SALEN/76-240      AC X3K7S7.1
#=GS A0A018V7I9_SALET/25-189  AC A0A018V7I9.1
#=GS V5VV69_SALET/76-240      AC V5VV69.1
#=GS X4QVH6_SALEN/76-240      AC X4QVH6.1
#=GS V5S0B3_SALET/76-240      AC V5S0B3.1
#=GS X4T9T7_SALEN/76-240      AC X4T9T7.1
#=GS G5MXD7_SALET/76-240      AC G5MXD7.1
#=GS X4E2L0_SALEN/76-240      AC X4E2L0.1
#=GS J2DLX6_SALEN/76-240      AC J2DLX6.1
#=GS V1QZF6_SALET/76-240      AC V1QZF6.1
#=GS X2TP39_SALEN/76-240      AC X2TP39.1
#=GS F2FD43_SALDU/76-240      AC F2FD43.1
#=GS U6WX28_SALTM/76-240      AC U6WX28.1
#=GS X2WU50_SALEN/76-240      AC X2WU50.1
#=GS H0LQ33_SALMO/76-240      AC H0LQ33.1
#=GS L6MWC8_SALEN/76-240      AC L6MWC8.1
#=GS X3D5P1_SALEN/76-240      AC X3D5P1.1
#=GS X2Z5H9_SALEN/76-240      AC X2Z5H9.1
#=GS V1T3D4_SALON/76-240      AC V1T3D4.1
#=GS K8UFI3_SALTM/76-240      AC K8UFI3.1
#=GS S5UQU6_SALPU/76-240      AC S5UQU6.1
#=GS L6AUM1_SALEN/76-240      AC L6AUM1.1
#=GS N0ZFN6_SALET/1-154       AC N0ZFN6.1
#=GS V1IHI2_SALVI/76-240      AC V1IHI2.1
#=GS T2K8I4_SALTM/76-240      AC T2K8I4.1
#=GS A0A019A6X6_SALET/76-240  AC A0A019A6X6.1
#=GS X2NDS4_SALEN/37-98       AC X2NDS4.1
#=GS L9RS08_SALEN/76-240      AC L9RS08.1
#=GS V7TE98_SALET/76-240      AC V7TE98.1
#=GS X3MWK3_SALEN/76-240      AC X3MWK3.1
#=GS A0A018RIG1_SALET/76-240  AC A0A018RIG1.1
#=GS L6MK76_SALEN/76-240      AC L6MK76.1
#=GS V7SJ72_SALET/76-240      AC V7SJ72.1
#=GS V0PLH2_SALNE/76-240      AC V0PLH2.1
#=GS X3XLY5_SALEN/76-240      AC X3XLY5.1
#=GS X2W547_SALEN/76-240      AC X2W547.1
#=GS L7AC08_SALEN/76-240      AC L7AC08.1
#=GS A0A018P9T9_SALET/76-240  AC A0A018P9T9.1
#=GS V1WQY4_SALET/76-240      AC V1WQY4.1
#=GS X4TMB2_SALEN/76-240      AC X4TMB2.1
#=GS E8AL65_SALMO/76-240      AC E8AL65.1
#=GS X2P6D6_SALEN/76-240      AC X2P6D6.1
#=GS B4TRG6_SALSV/76-240      AC B4TRG6.1
#=GS C0Y4G4_BURPE/85-245      AC C0Y4G4.1
#=GS V0MYZ0_SALNE/76-240      AC V0MYZ0.1
#=GS V2KBT2_SALET/76-240      AC V2KBT2.1
#=GS X4A1S4_SALEN/76-240      AC X4A1S4.1
#=GS J2BN58_SALEN/76-240      AC J2BN58.1
#=GS V0QVE1_SALSE/76-240      AC V0QVE1.1
#=GS V1PNK9_SALET/76-240      AC V1PNK9.1
#=GS X3YI76_SALEN/76-240      AC X3YI76.1
#=GS C6U6E4_BURPE/85-245      AC C6U6E4.1
#=GS A0A018TJT9_SALET/76-240  AC A0A018TJT9.1
#=GS V2NNH4_SALET/76-240      AC V2NNH4.1
#=GS G5RUB3_SALET/28-192      AC G5RUB3.1
#=GS J1WAL2_SALEN/76-240      AC J1WAL2.1
#=GS X4G1C3_SALEN/76-240      AC X4G1C3.1
#=GS X4SVV1_SALEN/76-240      AC X4SVV1.1
#=GS L6M5L4_SALEN/76-240      AC L6M5L4.1
#=GS V1MZA8_SALET/76-240      AC V1MZA8.1
#=GS V7XIN4_SALET/76-240      AC V7XIN4.1
#=GS X4CBW5_SALEN/76-240      AC X4CBW5.1
#=GS C5NAW6_BURML/85-245      AC C5NAW6.1
#=GS X3WDQ8_SALEN/1-164       AC X3WDQ8.1
#=GS V1QH86_SALET/76-240      AC V1QH86.1
#=GS C9X6N1_SALTD/76-240      AC C9X6N1.1
#=GS V2DI74_SALBE/76-240      AC V2DI74.1
#=GS L6QZ04_SALEN/76-240      AC L6QZ04.1
#=GS X3AFP7_SALEN/76-240      AC X3AFP7.1
#=GS N0K171_SALET/1-154       AC N0K171.1
#=GS X3PST1_SALEN/76-240      AC X3PST1.1
#=GS L6WX95_SALEN/76-240      AC L6WX95.1
#=GS V0NVS0_SALNE/76-240      AC V0NVS0.1
#=GS X3K7Q5_SALEN/76-240      AC X3K7Q5.1
#=GS E8BAM8_SALMO/76-240      AC E8BAM8.1
#=GS N0L9G2_SALET/1-154       AC N0L9G2.1
#=GS V7VEY5_SALMO/76-240      AC V7VEY5.1
#=GS J2B3W2_SALEN/76-240      AC J2B3W2.1
#=GS X4FEK6_SALEN/76-240      AC X4FEK6.1
#=GS I9WGV5_SALNE/76-240      AC I9WGV5.1
#=GS Q8GCQ4_SALET/63-213      AC Q8GCQ4.1
#=GS V7WZ77_SALMS/76-240      AC V7WZ77.1
#=GS X2TBC9_SALEN/76-240      AC X2TBC9.1
#=GS V0MGF9_SALNE/76-240      AC V0MGF9.1
#=GS V2GXJ2_SALET/76-240      AC V2GXJ2.1
#=GS G5NPG9_SALET/76-240      AC G5NPG9.1
#=GS X2X9P9_SALEN/76-240      AC X2X9P9.1
#=GS V1EHU9_SALET/76-240      AC V1EHU9.1
#=GS X2ZDC2_SALEN/76-240      AC X2ZDC2.1
#=GS L6GXJ2_SALEN/76-240      AC L6GXJ2.1
#=GS L6XDB1_SALEN/76-240      AC L6XDB1.1
#=GS C5ZUR9_BURPE/85-245      AC C5ZUR9.1
#=GS A0A018YLG5_SALET/76-240  AC A0A018YLG5.1
#=GS A0A038DXQ8_SALTM/76-240  AC A0A038DXQ8.1
#=GS X4GDK9_SALEN/76-240      AC X4GDK9.1
#=GS X3GWH7_SALEN/76-240      AC X3GWH7.1
#=GS X4A1R1_SALEN/76-240      AC X4A1R1.1
#=GS E8GZZ2_SALMO/76-240      AC E8GZZ2.1
#=GS K8TL47_SALTM/76-240      AC K8TL47.1
#=GS X4YAT8_SALEN/76-240      AC X4YAT8.1
#=GS X2WTQ9_SALEN/76-240      AC X2WTQ9.1
#=GS I9FH43_SALNE/76-240      AC I9FH43.1
#=GS N0WYH4_SALET/1-154       AC N0WYH4.1
#=GS I9GED6_SALNE/76-240      AC I9GED6.1
#=GS SOPE_SALHA/76-240        AC Q8VPM1.3
#=GS X4TAI6_SALEN/76-240      AC X4TAI6.1
#=GS V0BEF6_SALET/76-240      AC V0BEF6.1
#=GS N1HC52_SALET/1-154       AC N1HC52.1
#=GS S4JVG6_SALEN/1-154       AC S4JVG6.1
#=GS V7YEP3_SALEN/76-240      AC V7YEP3.1
#=GS T1YIK3_SALET/76-240      AC T1YIK3.1
#=GS V0Q0Q2_SALNE/1-154       AC V0Q0Q2.1
#=GS E8GGB5_SALMO/76-240      AC E8GGB5.1
#=GS B5BEC1_SALPK/76-240      AC B5BEC1.1
#=GS E8A3Z4_SALMO/76-240      AC E8A3Z4.1
#=GS X3STY6_SALEN/76-240      AC X3STY6.1
#=GS V2K932_SALET/76-240      AC V2K932.1
#=GS L9SI50_SALEN/76-240      AC L9SI50.1
#=GS E1WG92_SALTS/76-240      AC E1WG92.1
#=GS V2PP69_SALET/76-240      AC V2PP69.1
#=GS X3SSA7_SALEN/76-240      AC X3SSA7.1
#=GS L5WHJ5_SALEN/76-240      AC L5WHJ5.1
#=GS V7IM51_SALET/1-159       AC V7IM51.1
#=GS W6C258_BURTH/86-247      AC W6C258.1
#=GS I9K7Y1_SALNE/76-240      AC I9K7Y1.1
#=GS H5VMC3_SALSE/76-240      AC H5VMC3.1
#=GS A0A018XBG0_SALET/1-160   AC A0A018XBG0.1
#=GS L9REA1_SALEN/76-240      AC L9REA1.1
#=GS L5ZPU3_SALEN/76-240      AC L5ZPU3.1
#=GS X5NBI8_SALET/76-240      AC X5NBI8.1
#=GS L6RYN5_SALEN/76-240      AC L6RYN5.1
#=GS A0A038EUZ3_SALTM/76-240  AC A0A038EUZ3.1
#=GS N0M2E3_SALET/1-154       AC N0M2E3.1
#=GS A0A018TR07_SALET/1-164   AC A0A018TR07.1
#=GS M7RWW7_SALDU/76-240      AC M7RWW7.1
#=GS X3LAU4_SALEN/76-240      AC X3LAU4.1
#=GS N0KRJ8_SALET/1-154       AC N0KRJ8.1
#=GS S4HIW3_SALEN/1-154       AC S4HIW3.1
#=GS A0A018PR93_SALET/76-240  AC A0A018PR93.1
#=GS J1PFU3_SALEN/76-240      AC J1PFU3.1
#=GS X3LN47_SALEN/76-240      AC X3LN47.1
#=GS I9ZSZ7_SALNE/76-240      AC I9ZSZ7.1
#=GS X3FF74_SALEN/76-240      AC X3FF74.1
#=GS L6G9H9_SALEN/76-240      AC L6G9H9.1
#=GS V2NBW5_SALET/1-99        AC V2NBW5.1
#=GS V1WXM4_SALMU/76-240      AC V1WXM4.1
#=GS V2ABX0_SALET/76-240      AC V2ABX0.1
#=GS E8BMP7_SALMO/76-240      AC E8BMP7.1
#=GS X3K7Y6_SALEN/76-240      AC X3K7Y6.1
#=GS X4SXC0_SALEN/76-240      AC X4SXC0.1
#=GS X4UUS6_SALEN/76-240      AC X4UUS6.1
#=GS L6TA42_SALEN/76-240      AC L6TA42.1
#=GS L9R4H7_SALEN/76-240      AC L9R4H7.1
#=GS X4HRW8_SALEN/76-240      AC X4HRW8.1
#=GS X4PZE9_SALEN/76-240      AC X4PZE9.1
#=GS M3M4R7_SALNE/76-240      AC M3M4R7.1
#=GS X3F738_SALEN/76-240      AC X3F738.1
#=GS X3NHE0_SALEN/76-240      AC X3NHE0.1
#=GS H1RHJ8_SALMO/76-240      AC H1RHJ8.1
#=GS V1IQH0_SALMU/76-240      AC V1IQH0.1
#=GS G9V4V0_SALMO/76-240      AC G9V4V0.1
#=GS X3WLQ5_SALEN/76-240      AC X3WLQ5.1
#=GS N1AMN5_SALET/1-154       AC N1AMN5.1
#=GS X3P0F1_SALEN/76-240      AC X3P0F1.1
#=GS X3APR6_SALEN/76-240      AC X3APR6.1
#=GS L6CL80_SALEN/76-240      AC L6CL80.1
#=GS N1CLN3_SALET/1-154       AC N1CLN3.1
#=GS X2WNB1_SALEN/76-240      AC X2WNB1.1
#=GS U6Z119_SALTM/76-240      AC U6Z119.1
#=GS X3UPT7_SALEN/76-240      AC X3UPT7.1
#=GS V1NNG7_SALET/76-240      AC V1NNG7.1
#=GS X4GJG7_SALEN/76-240      AC X4GJG7.1
#=GS L5WSB0_SALEN/76-240      AC L5WSB0.1
#=GS X4TYC5_SALEN/76-240      AC X4TYC5.1
#=GS L6PHF8_SALEN/76-240      AC L6PHF8.1
#=GS A8EPM1_BURPE/85-245      AC A8EPM1.1
#=GS L5YJ25_SALEN/76-240      AC L5YJ25.1
#=GS X3V695_SALEN/76-240      AC X3V695.1
#=GS N1GRB4_SALET/1-154       AC N1GRB4.1
#=GS L6YY12_SALEN/76-240      AC L6YY12.1
#=GS V1KPB1_SALET/76-240      AC V1KPB1.1
#=GS E8E1G2_SALMO/76-240      AC E8E1G2.1
#=GS L6CZ35_SALEN/76-240      AC L6CZ35.1
#=GS A5XL56_BURML/85-245      AC A5XL56.1
#=GS A0A018XKE6_SALET/76-240  AC A0A018XKE6.1
#=GS B0G0X4_SALET/13-133      AC B0G0X4.1
#=GS T2Q382_SALEN/1-154       AC T2Q382.1
#=GS V1T4X3_SALON/76-240      AC V1T4X3.1
#=GS A0A018PGS0_SALET/1-164   AC A0A018PGS0.1
#=GS B3YGU0_SALET/1-154       AC B3YGU0.1
#=GS I1WUB3_BURP2/85-245      AC I1WUB3.1
#=GS X4XSI8_SALEN/76-240      AC X4XSI8.1
#=GS B5P0W3_SALET/76-240      AC B5P0W3.1
#=GS B5F3N6_SALA4/1-154       AC B5F3N6.1
#=GS V0HJN7_SALET/76-240      AC V0HJN7.1
#=GS X4N055_SALEN/76-240      AC X4N055.1
#=GS B5R8S6_SALG2/76-240      AC B5R8S6.1
#=GS L6YXY9_SALEN/76-240      AC L6YXY9.1
#=GS Q57NF3_SALCH/76-240      AC Q57NF3.1
#=GS X3XXD3_SALEN/76-240      AC X3XXD3.1
#=GS B5MSK9_SALET/76-240      AC B5MSK9.1
#=GS X3H914_SALEN/76-240      AC X3H914.1
#=GS N1F2M5_SALET/1-154       AC N1F2M5.1
#=GS A0A018XAW5_SALET/25-185  AC A0A018XAW5.1
#=GS L6RXT6_SALEN/76-240      AC L6RXT6.1
#=GS X4HMF1_SALEN/76-240      AC X4HMF1.1
#=GS S5IDI6_SALET/76-240      AC S5IDI6.1
#=GS X2PEW7_SALEN/76-240      AC X2PEW7.1
#=GS X2VFI2_SALEN/76-240      AC X2VFI2.1
#=GS V2DSL7_SALET/76-240      AC V2DSL7.1
#=GS X3V7Q1_SALEN/76-240      AC X3V7Q1.1
#=GS N0UFT7_SALET/1-154       AC N0UFT7.1
#=GS N0NJ72_SALET/1-154       AC N0NJ72.1
#=GS K8VR53_SALTM/76-240      AC K8VR53.1
#=GS V0KBD0_SALET/76-240      AC V0KBD0.1
#=GS H0LLM7_SALMO/1-154       AC H0LLM7.1
#=GS E7ZBH9_SALMO/76-240      AC E7ZBH9.1
#=GS A0A018WW41_SALET/76-240  AC A0A018WW41.1
#=GS A0A018TZ49_SALET/76-240  AC A0A018TZ49.1
#=GS V0NUD8_SALNE/76-240      AC V0NUD8.1
#=GS N0C059_SALTI/1-154       AC N0C059.1
#=GS N0JDA9_SALET/1-154       AC N0JDA9.1
#=GS X3REA8_SALEN/76-240      AC X3REA8.1
#=GS E7VQW4_SALMO/76-240      AC E7VQW4.1
#=GS A0A023SQL9_SALTM/76-240  AC A0A023SQL9.1
#=GS K5AUX6_SALET/76-240      AC K5AUX6.1
#=GS K8TNE5_SALTM/76-240      AC K8TNE5.1
#=GS V1EHG8_SALET/76-240      AC V1EHG8.1
#=GS V1FVR4_SALET/76-240      AC V1FVR4.1
#=GS E8EAN9_SALMO/76-240      AC E8EAN9.1
#=GS L6SYS4_SALEN/76-240      AC L6SYS4.1
#=GS J2CRR2_SALEN/76-240      AC J2CRR2.1
#=GS V3YPQ1_SALET/76-240      AC V3YPQ1.1
#=GS V1KCM9_SALET/76-240      AC V1KCM9.1
#=GS X3GBM3_SALEN/76-240      AC X3GBM3.1
#=GS N1BF40_SALET/1-154       AC N1BF40.1
#=GS N0PBA4_SALET/1-154       AC N0PBA4.1
#=GS L6FVJ6_SALEN/76-240      AC L6FVJ6.1
#=GS A0A018V411_SALET/76-240  AC A0A018V411.1
#=GS X4BAH1_SALEN/76-240      AC X4BAH1.1
#=GS N0WEJ0_SALET/1-154       AC N0WEJ0.1
#=GS L5Y0M2_SALEN/76-240      AC L5Y0M2.1
#=GS V1GR46_SALCE/76-240      AC V1GR46.1
#=GS X4BZF4_SALEN/76-240      AC X4BZF4.1
#=GS E1WJI8_SALTS/76-240      AC E1WJI8.1
#=GS X3DYK4_SALEN/76-240      AC X3DYK4.1
#=GS L6VMI2_SALEN/76-240      AC L6VMI2.1
#=GS V0G4X3_SALET/1-154       AC V0G4X3.1
#=GS X3EC72_SALEN/76-240      AC X3EC72.1
#=GS X4EEJ1_SALEN/76-240      AC X4EEJ1.1
#=GS X3IBT2_SALEN/76-240      AC X3IBT2.1
#=GS BOPE_BURMA/85-245        AC Q62B14.1
#=GS V1PEW3_SALET/1-154       AC V1PEW3.1
#=GS I9Y9U6_SALNE/76-240      AC I9Y9U6.1
#=GS X4ZN65_SALEN/76-240      AC X4ZN65.1
#=GS L6W9Y3_SALEN/76-240      AC L6W9Y3.1
#=GS X3Q387_SALEN/76-240      AC X3Q387.1
#=GS J2BPD7_SALEN/76-240      AC J2BPD7.1
#=GS L5YT97_SALEN/76-240      AC L5YT97.1
#=GS X4XHB3_SALEN/76-240      AC X4XHB3.1
#=GS E7WUB3_SALMO/76-240      AC E7WUB3.1
#=GS L5ZPW8_SALEN/76-240      AC L5ZPW8.1
#=GS V1PPL9_SALET/76-240      AC V1PPL9.1
#=GS BOPE_BURP1/85-245        AC Q3JL30.1
#=GS V2KN19_SALET/76-240      AC V2KN19.1
#=GS X4RGC7_SALEN/76-240      AC X4RGC7.1
#=GS X3ETE6_SALEN/76-236      AC X3ETE6.1
#=GS X3E3X1_SALEN/76-240      AC X3E3X1.1
#=GS L6ZBJ1_SALEN/76-240      AC L6ZBJ1.1
#=GS X3FBU9_SALEN/76-240      AC X3FBU9.1
#=GS L6TND9_SALEN/76-240      AC L6TND9.1
#=GS J1I2C2_SALEN/76-240      AC J1I2C2.1
#=GS V5VK77_SALET/76-240      AC V5VK77.1
#=GS X4UNQ1_SALEN/76-240      AC X4UNQ1.1
#=GS L6GT60_SALEN/76-240      AC L6GT60.1
#=GS V3Y783_SALET/76-240      AC V3Y783.1
#=GS V5KQ61_SALTH/76-240      AC V5KQ61.1
#=GS V3YAL8_SALET/76-240      AC V3YAL8.1
#=GS X2N752_SALEN/9-106       AC X2N752.1
#=GS J1Y3W6_SALEN/76-240      AC J1Y3W6.1
#=GS X3QXS8_SALEN/76-240      AC X3QXS8.1
#=GS V7RD62_SALET/76-240      AC V7RD62.1
#=GS L9QEU4_SALDU/76-240      AC L9QEU4.1
#=GS N1A8X0_SALET/1-154       AC N1A8X0.1
#=GS E7WJY1_SALMO/76-240      AC E7WJY1.1
#=GS L9R9Z6_SALEN/76-240      AC L9R9Z6.1
#=GS X4GTK1_SALEN/76-240      AC X4GTK1.1
#=GS V7W049_SALET/76-240      AC V7W049.1
#=GS N1ECQ3_SALET/1-154       AC N1ECQ3.1
#=GS X4EZA0_SALEN/76-240      AC X4EZA0.1
#=GS V6YTW2_SALET/76-245      AC V6YTW2.1
#=GS X3GWW4_SALEN/76-240      AC X3GWW4.1
#=GS V5ZKD6_SALET/76-240      AC V5ZKD6.1
#=GS J1NSZ9_SALEN/76-240      AC J1NSZ9.1
#=GS L6SL60_SALEN/76-240      AC L6SL60.1
#=GS L6EHJ9_SALEN/76-240      AC L6EHJ9.1
#=GS A0A018RWW5_SALET/76-121  AC A0A018RWW5.1
#=GS B5CDN9_SALET/76-240      AC B5CDN9.1
#=GS A0A023MRX8_SALEN/76-240  AC A0A023MRX8.1
#=GS SOPE_SALTM/76-240        AC O52623.3
#=GS SOPE_SALTM/76-240        DR PDB; 1GZS B; 78-240;
#=GS SOPE_SALTM/76-240        DR PDB; 1GZS D; 78-240;
#=GS X3JVZ2_SALEN/76-240      AC X3JVZ2.1
#=GS X2UDM7_SALEN/76-240      AC X2UDM7.1
#=GS X3FZB6_SALEN/76-240      AC X3FZB6.1
#=GS M4LN61_SALET/76-240      AC M4LN61.1
#=GS X4LQX5_SALEN/76-240      AC X4LQX5.1
#=GS X4KBU8_SALEN/76-240      AC X4KBU8.1
#=GS V0QIJ1_SALNE/76-240      AC V0QIJ1.1
#=GS M3LS52_SALNE/76-240      AC M3LS52.1
#=GS V0G9M8_SALPU/76-240      AC V0G9M8.1
#=GS B4TDY1_SALHS/76-240      AC B4TDY1.1
#=GS X2QLE2_SALEN/76-240      AC X2QLE2.1
#=GS V0BKB6_SALET/76-240      AC V0BKB6.1
#=GS J1NSX0_SALEN/76-240      AC J1NSX0.1
#=GS V4GAA9_SALET/76-240      AC V4GAA9.1
#=GS A0A038EFV9_SALTM/76-240  AC A0A038EFV9.1
#=GS N1C915_SALET/1-154       AC N1C915.1
#=GS J1SID2_SALEN/76-240      AC J1SID2.1
#=GS V2B556_SALHA/76-240      AC V2B556.1
#=GS V7U954_SALET/76-240      AC V7U954.1
#=GS X3UE00_SALEN/76-240      AC X3UE00.1
#=GS U6Y5Y1_SALTM/76-240      AC U6Y5Y1.1
#=GS L9QU23_SALGL/76-240      AC L9QU23.1
#=GS K8VE99_SALTM/76-240      AC K8VE99.1
#=GS L6S568_SALEN/76-240      AC L6S568.1
#=GS V7YPE7_SALET/76-240      AC V7YPE7.1
#=GS L6LLW0_SALEN/76-240      AC L6LLW0.1
#=GS I9ZSE8_SALNE/76-240      AC I9ZSE8.1
#=GS X2YSR8_SALEN/76-240      AC X2YSR8.1
#=GS X3S9G4_SALEN/76-240      AC X3S9G4.1
#=GS V0EQL1_SALET/76-240      AC V0EQL1.1
#=GS X3YL21_SALEN/76-240      AC X3YL21.1
#=GS F8VGD4_SALBC/76-240      AC F8VGD4.1
#=GS X3UAX2_SALEN/76-240      AC X3UAX2.1
#=GS X3U687_SALEN/76-240      AC X3U687.1
#=GS K8SNU8_SALTM/76-240      AC K8SNU8.1
#=GS V0I7M2_SALET/76-240      AC V0I7M2.1
#=GS V3YR24_SALET/76-240      AC V3YR24.1
#=GS X4H2Z9_SALEN/76-240      AC X4H2Z9.1
#=GS X2UW59_SALEN/76-240      AC X2UW59.1
#=GS X4F3R5_SALEN/76-240      AC X4F3R5.1
#=GS BOPE_BURP0/85-245        AC A3P6Z0.1
#=GS E7V6J8_SALMO/76-240      AC E7V6J8.1
#=GS X2NTA4_SALEN/76-240      AC X2NTA4.1
#=GS L6IA50_SALEN/76-240      AC L6IA50.1
#=GS X2NBC6_SALEN/76-126      AC X2NBC6.1
#=GS N1EQL2_SALET/1-154       AC N1EQL2.1
#=GS X3RYI6_SALEN/76-240      AC X3RYI6.1
#=GS V9YC57_BURPE/85-245      AC V9YC57.1
#=GS H0MEM4_SALMO/76-240      AC H0MEM4.1
#=GS V2MYT0_SALET/76-240      AC V2MYT0.1
#=GS L6J2F5_SALEN/76-240      AC L6J2F5.1
#=GS A0A017QZ51_SALET/76-240  AC A0A017QZ51.1
#=GS L9S2X5_SALEN/76-240      AC L9S2X5.1
#=GS L6H1L2_SALEN/76-240      AC L6H1L2.1
#=GS X3GN53_SALEN/76-240      AC X3GN53.1
#=GS S3FBX3_SALPT/76-240      AC S3FBX3.1
#=GS A8KGF6_BURPE/85-245      AC A8KGF6.1
#=GS X2LR18_SALEN/7-82        AC X2LR18.1
#=GS V0IPE6_SALNE/76-240      AC V0IPE6.1
#=GS X4VV19_SALEN/76-240      AC X4VV19.1
#=GS X4J839_SALEN/76-240      AC X4J839.1
#=GS N0WS30_SALET/1-154       AC N0WS30.1
#=GS X3X164_SALEN/76-240      AC X3X164.1
#=GS L9TNX8_SALEN/76-240      AC L9TNX8.1
#=GS X3YUZ3_SALEN/76-240      AC X3YUZ3.1
#=GS N0SVL2_SALET/1-154       AC N0SVL2.1
#=GS N1G144_SALET/1-154       AC N1G144.1
#=GS H8M6F6_SALTM/1-154       AC H8M6F6.1
#=GS L6VGD8_SALEN/76-240      AC L6VGD8.1
#=GS I9VIF3_SALNE/76-240      AC I9VIF3.1
#=GS L6K7M1_SALEN/76-240      AC L6K7M1.1
#=GS S5GWM0_SALET/76-240      AC S5GWM0.1
#=GS A0A018QBH9_SALET/76-240  AC A0A018QBH9.1
#=GS X4BFU0_SALEN/76-240      AC X4BFU0.1
#=GS V1YWB8_SALET/76-211      AC V1YWB8.1
#=GS J1W580_SALEN/76-240      AC J1W580.1
#=GS E7UZH6_SALTM/76-240      AC E7UZH6.1
#=GS V7X3M7_SALET/76-240      AC V7X3M7.1
#=GS W9FB78_SALVI/76-240      AC W9FB78.1
#=GS E8G9V7_SALMO/76-240      AC E8G9V7.1
#=GS V7VH19_SALMO/76-240      AC V7VH19.1
#=GS V0D323_SALET/76-240      AC V0D323.1
#=GS A0A018NVW2_SALET/76-240  AC A0A018NVW2.1
#=GS X4N314_SALEN/76-240      AC X4N314.1
#=GS X2P2B9_SALEN/76-240      AC X2P2B9.1
#=GS K8TRH6_SALTM/76-240      AC K8TRH6.1
#=GS B5BHA1_SALPK/76-240      AC B5BHA1.1
#=GS X3A7I2_SALEN/76-240      AC X3A7I2.1
#=GS V1I248_SALVI/1-154       AC V1I248.1
#=GS X3NN20_SALEN/76-240      AC X3NN20.1
#=GS V2JH50_SALET/76-171      AC V2JH50.1
#=GS V1WCB7_SALMS/76-240      AC V1WCB7.1
#=GS X4P4E9_SALEN/76-240      AC X4P4E9.1
#=GS A0A018Q0A1_SALET/76-240  AC A0A018Q0A1.1
#=GS A0A018SBX5_SALET/76-240  AC A0A018SBX5.1
#=GS A0A018T8P0_SALET/56-216  AC A0A018T8P0.1
#=GS L6P5V5_SALEN/76-240      AC L6P5V5.1
#=GS A0A018X5E5_SALET/25-185  AC A0A018X5E5.1
#=GS L7AV43_SALET/76-240      AC L7AV43.1
#=GS X4D1A5_SALEN/76-240      AC X4D1A5.1
#=GS A0A018RN22_SALET/1-53    AC A0A018RN22.1
#=GS S4HSH0_SALEN/1-154       AC S4HSH0.1
#=GS G5QYS9_SALSE/76-240      AC G5QYS9.1
#=GS N0RBY7_SALET/1-154       AC N0RBY7.1
#=GS E8DQS6_SALMO/76-240      AC E8DQS6.1
#=GS J2ATP1_SALEN/76-240      AC J2ATP1.1
#=GS V3WND6_SALET/76-240      AC V3WND6.1
#=GS X3KEH7_SALEN/76-240      AC X3KEH7.1
#=GS V7QZ17_SALET/76-240      AC V7QZ17.1
#=GS V0KNL3_SALET/76-240      AC V0KNL3.1
#=GS I9HXT2_SALNE/76-240      AC I9HXT2.1
#=GS J1SC26_SALEN/76-240      AC J1SC26.1
#=GS L6KVQ8_SALEN/76-240      AC L6KVQ8.1
#=GS A0A038ESG3_SALTM/76-240  AC A0A038ESG3.1
#=GS N0MFI6_SALET/1-154       AC N0MFI6.1
#=GS X4NSB9_SALEN/76-240      AC X4NSB9.1
#=GS V0MME2_SALET/76-240      AC V0MME2.1
#=GS BOPE_BURPS/85-245        AC Q63K41.1
#=GS BOPE_BURPS/85-245        DR PDB; 2JOL A; 85-245;
#=GS BOPE_BURPS/85-245        DR PDB; 2JOK A; 85-245;
#=GS X4SYP2_SALEN/76-240      AC X4SYP2.1
#=GS I0MPI3_SALET/76-240      AC I0MPI3.1
#=GS V1ELZ6_SALET/76-240      AC V1ELZ6.1
#=GS L7B5E1_SALET/76-240      AC L7B5E1.1
#=GS X4R7H2_SALEN/76-240      AC X4R7H2.1
#=GS X3PWI5_SALEN/76-240      AC X3PWI5.1
#=GS I0MVL5_SALET/1-164       AC I0MVL5.1
#=GS L5XIP5_SALEN/76-240      AC L5XIP5.1
#=GS W9UCX0_BURPE/85-247      AC W9UCX0.1
#=GS B5R8U7_SALG2/76-240      AC B5R8U7.1
#=GS X4KVA3_SALEN/76-240      AC X4KVA3.1
#=GS M7RR53_SALDU/76-240      AC M7RR53.1
#=GS A0A017R7Y3_SALET/76-104  AC A0A017R7Y3.1
#=GS L6LV94_SALEN/76-240      AC L6LV94.1
#=GS L6SYU3_SALEN/76-240      AC L6SYU3.1
#=GS X3CTK5_SALEN/76-240      AC X3CTK5.1
#=GS L6DEA5_SALEN/76-240      AC L6DEA5.1
#=GS A0A018RQT4_SALET/76-240  AC A0A018RQT4.1
#=GS V2PQG7_SALET/76-240      AC V2PQG7.1
#=GS F5ZSD1_SALTU/76-240      AC F5ZSD1.1
#=GS N1IFU5_SALET/1-154       AC N1IFU5.1
#=GS K0QM48_SALNE/76-240      AC K0QM48.1
#=GS A0A018UZL5_SALET/76-237  AC A0A018UZL5.1
#=GS J1KYQ9_SALEN/76-240      AC J1KYQ9.1
#=GS L6UY66_SALEN/76-240      AC L6UY66.1
#=GS V0DAE4_SALET/76-240      AC V0DAE4.1
#=GS N0S3Z0_SALET/1-154       AC N0S3Z0.1
#=GS X2Y406_SALEN/76-240      AC X2Y406.1
#=GS X2YKN2_SALEN/76-240      AC X2YKN2.1
#=GS L6M6S6_SALEN/76-240      AC L6M6S6.1
#=GS X4WKN7_SALEN/76-240      AC X4WKN7.1
#=GS V2MTD1_SALET/76-138      AC V2MTD1.1
#=GS X3JJB9_SALEN/76-240      AC X3JJB9.1
#=GS V3Y5S0_SALET/76-240      AC V3Y5S0.1
#=GS L6RD33_SALEN/76-240      AC L6RD33.1
#=GS G5M2I8_SALET/1-54        AC G5M2I8.1
#=GS S3E3V4_SALPT/76-240      AC S3E3V4.1
#=GS B1H8L5_BURPE/85-245      AC B1H8L5.1
#=GS X2PWT0_SALEN/76-240      AC X2PWT0.1
#=GS G9UAH5_SALMO/76-240      AC G9UAH5.1
#=GS N0QQ86_SALET/1-154       AC N0QQ86.1
#=GS V0J0S0_SALSE/76-240      AC V0J0S0.1
#=GS X3H9R0_SALEN/76-240      AC X3H9R0.1
#=GS X4J0F2_SALEN/76-240      AC X4J0F2.1
#=GS V2FDN5_SALET/76-240      AC V2FDN5.1
#=GS X3HQZ9_SALEN/76-240      AC X3HQZ9.1
#=GS X3R999_SALEN/76-240      AC X3R999.1
#=GS I0A7U3_SALET/1-163       AC I0A7U3.1
#=GS V2FVG3_SALET/1-154       AC V2FVG3.1
#=GS X2XWM9_SALEN/76-240      AC X2XWM9.1
#=GS E7XBM2_SALMO/76-240      AC E7XBM2.1
#=GS W6C4T4_BURTH/86-247      AC W6C4T4.1
#=GS SOPE2_SALTY/76-240       AC Q7CQD4.3
#=GS SOPE2_SALTY/76-240       DR PDB; 1R9K A; 76-240;
#=GS SOPE2_SALTY/76-240       DR PDB; 1R6E A; 76-240;
#=GS X5NTF6_SALTM/76-240      AC X5NTF6.1
#=GS S3FF11_SALPT/76-240      AC S3FF11.1
#=GS B5Q0R6_SALHA/76-240      AC B5Q0R6.1
#=GS N0C0H2_SALTI/76-240      AC N0C0H2.1
#=GS L6VML4_SALEN/76-240      AC L6VML4.1
#=GS E8XII0_SALT4/76-240      AC E8XII0.1
#=GS L6BLE4_SALEN/76-240      AC L6BLE4.1
#=GS A0A018P241_SALET/76-240  AC A0A018P241.1
#=GS X4PH30_SALEN/76-240      AC X4PH30.1
#=GS X2X0R0_SALEN/76-240      AC X2X0R0.1
#=GS X2V2X5_SALEN/76-240      AC X2V2X5.1
#=GS X3M3V2_SALEN/76-240      AC X3M3V2.1
#=GS L6IA25_SALEN/76-240      AC L6IA25.1
#=GS X3J1G5_SALEN/76-240      AC X3J1G5.1
#=GS B5C323_SALET/1-154       AC B5C323.1
#=GS N1DNB4_SALET/1-154       AC N1DNB4.1
#=GS S4J1H0_SALEN/1-154       AC S4J1H0.1
#=GS SOPE_SALEE/76-240        AC Q8VSR1.3
#=GS X4H5P4_SALEN/76-240      AC X4H5P4.1
#=GS V0F6Z9_SALET/76-240      AC V0F6Z9.1
#=GS X2SZJ9_SALEN/76-240      AC X2SZJ9.1
#=GS L9T6Q4_SALEN/76-240      AC L9T6Q4.1
#=GS X2RNF7_SALEN/76-240      AC X2RNF7.1
#=GS X3TM10_SALEN/76-240      AC X3TM10.1
#=GS A0A017QYX5_SALET/76-240  AC A0A017QYX5.1
#=GS V7VEN4_SALET/76-240      AC V7VEN4.1
#=GS L9SI56_SALEN/76-240      AC L9SI56.1
#=GS V1E2D3_SALET/76-240      AC V1E2D3.1
#=GS A0A017QPS1_SALET/76-240  AC A0A017QPS1.1
#=GS K5APP9_SALET/76-240      AC K5APP9.1
#=GS X4XKQ3_SALEN/76-240      AC X4XKQ3.1
#=GS J1H3Y9_SALEN/76-240      AC J1H3Y9.1
#=GS L6G9F9_SALEN/76-240      AC L6G9F9.1
#=GS B5PP30_SALHA/76-240      AC B5PP30.1
#=GS X4IPN6_SALEN/76-240      AC X4IPN6.1
#=GS V7UEB7_SALET/76-240      AC V7UEB7.1
#=GS X2MF87_SALEN/76-240      AC X2MF87.1
#=GS X2XL35_SALEN/76-240      AC X2XL35.1
#=GS A0A018N877_SALET/76-240  AC A0A018N877.1
#=GS V2G073_SALET/76-240      AC V2G073.1
#=GS A0A018ZV43_SALET/76-240  AC A0A018ZV43.1
#=GS X4TLR2_SALEN/76-240      AC X4TLR2.1
#=GS J0ENN9_SALNE/76-240      AC J0ENN9.1
#=GS G7T498_SALPS/76-240      AC G7T498.1
#=GS A9MV49_SALPB/76-240      AC A9MV49.1
#=GS A0A018RNE0_SALET/1-154   AC A0A018RNE0.1
#=GS X2MB07_SALEN/76-240      AC X2MB07.1
#=GS F2FD63_SALDU/76-240      AC F2FD63.1
#=GS L6LLV3_SALEN/76-240      AC L6LLV3.1
#=GS X3DV11_SALEN/76-240      AC X3DV11.1
#=GS V0M1H9_SALNE/76-240      AC V0M1H9.1
#=GS L6TMQ6_SALEN/76-240      AC L6TMQ6.1
#=GS A5J440_BURML/85-245      AC A5J440.1
#=GS S5UF99_SALPU/76-240      AC S5UF99.1
#=GS N0HRD2_SALET/1-154       AC N0HRD2.1
#=GS L6BQJ9_SALEN/76-240      AC L6BQJ9.1
#=GS X4AE69_SALEN/76-240      AC X4AE69.1
#=GS X4U5P3_SALEN/76-240      AC X4U5P3.1
#=GS J2FPI5_SALEN/76-240      AC J2FPI5.1
#=GS X4Q653_SALEN/76-240      AC X4Q653.1
#=GS X4WH61_SALEN/76-240      AC X4WH61.1
#=GS E7YJ62_SALMO/76-240      AC E7YJ62.1
#=GS E7Y9W8_SALMO/76-240      AC E7Y9W8.1
#=GS X3IYM5_SALEN/76-240      AC X3IYM5.1
#=GS L6PA11_SALEN/76-240      AC L6PA11.1
#=GS A0A023N211_SALMO/76-240  AC A0A023N211.1
#=GS V2L384_SALET/23-192      AC V2L384.1
#=GS L6NKV9_SALEN/76-240      AC L6NKV9.1
#=GS B5N453_SALET/76-240      AC B5N453.1
#=GS X3W8R8_SALEN/76-240      AC X3W8R8.1
#=GS U6UVN2_SALET/76-240      AC U6UVN2.1
#=GS X4CJK2_SALEN/76-240      AC X4CJK2.1
#=GS U6XH03_SALNE/76-240      AC U6XH03.1
#=GS X2LYN8_SALEN/76-223      AC X2LYN8.1
#=GS N1GA26_SALET/1-154       AC N1GA26.1
#=GS X4NFN3_SALEN/76-240      AC X4NFN3.1
#=GS A0A018WYY7_SALET/76-240  AC A0A018WYY7.1
#=GS S5IDW3_SALET/76-240      AC S5IDW3.1
#=GS F2FUB4_SALGL/76-240      AC F2FUB4.1
#=GS V3YQJ2_SALNE/76-240      AC V3YQJ2.1
#=GS X4X7M2_SALEN/76-240      AC X4X7M2.1
#=GS N0MNM5_SALET/1-154       AC N0MNM5.1
#=GS X5BV23_SALAB/76-240      AC X5BV23.1
#=GS X3YVU5_SALEN/76-222      AC X3YVU5.1
#=GS V0HK02_SALNE/76-240      AC V0HK02.1
#=GS G5S9U0_SALET/1-154       AC G5S9U0.1
#=GS V1Q2U6_SALET/76-240      AC V1Q2U6.1
#=GS L6HX51_SALEN/76-240      AC L6HX51.1
#=GS L6IVW6_SALEN/76-240      AC L6IVW6.1
#=GS U6VW34_SALTM/76-240      AC U6VW34.1
#=GS A4LPF0_BURPE/85-245      AC A4LPF0.1
#=GS E8FDS1_SALMO/76-240      AC E8FDS1.1
#=GS X5N358_SALET/76-240      AC X5N358.1
#=GS A0A019A3Q8_SALET/86-250  AC A0A019A3Q8.1
#=GS W9FIE8_SALVI/76-240      AC W9FIE8.1
#=GS G5LMV4_SALET/1-54        AC G5LMV4.1
#=GS T2QFL4_SALEN/76-240      AC T2QFL4.1
#=GS I9M5K6_SALNE/76-240      AC I9M5K6.1
#=GS X3DHV8_SALEN/76-240      AC X3DHV8.1
#=GS V1PG67_SALET/76-240      AC V1PG67.1
#=GS O58135_PYRHO/35-148      AC O58135.1
#=GS V1GXE9_SALHO/76-240      AC V1GXE9.1
#=GS X4IUP3_SALEN/76-240      AC X4IUP3.1
#=GS V2KX57_SALET/86-250      AC V2KX57.1
#=GS E8A7J2_SALMO/76-240      AC E8A7J2.1
#=GS A0A018NU73_SALET/76-240  AC A0A018NU73.1
#=GS W8JRW9_BURPE/85-245      AC W8JRW9.1
#=GS X3Q3P8_SALEN/76-240      AC X3Q3P8.1
#=GS X4MWV1_SALEN/76-240      AC X4MWV1.1
#=GS X2NEZ5_SALEN/76-240      AC X2NEZ5.1
#=GS N0I548_SALET/1-154       AC N0I548.1
#=GS X2QYL4_SALEN/76-240      AC X2QYL4.1
#=GS S5HSP6_SALET/76-240      AC S5HSP6.1
X4KHU7_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3RSG7_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1G2C7_SALCE/76-240                 ..................................AVVTSKIVKDFMLQKLNSLDIKGNASKDPAYARQTCESILSAVYSNNKDHCCKLLISK.G.....ISITP.FLKELGEAAQKAGLP.GEIKN.GVFTPGGAGANPFVAPLLASASVKYP.HMFINH..SQQVSFK...AYAERLIMKEVTPLFNEGAMPSPQQFQLTVESIANKYLQNVS...............................................................
A0A018QLT3_SALET/76-240             ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
X3KRY5_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
B4SV96_SALNS/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
G7T4C3_SALPS/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIPN--tp.............................................................
L6TN71_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A018XI45_SALET/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6RD57_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X2VF73_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V2J0A1_SALAN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYGNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A058SWR0_SALET/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQKAS...............................................................
X4IVH2_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X2VS28_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X4TZK5_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
S5MX23_SALBN/1-154                  ..................................-----------MLQKLNELDIKSHASKDPSYARQTCEAILSAQYSNNKDKYCRLLINQ.G.....LSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFITPLVSSASIKYP.YIFINH..NQQTSFK...AYAEKLIMEEVTPLFKEQNLPTPQQFHLTLENIASKHIQNT-r..............................................................
X3MCG9_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L6BLG6_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
J1SZQ4_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V0JF46_SALET/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQKASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQNT-p..............................................................
L6MWE7_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6GSH7_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
U1K1P8_SALMU/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X3G4V5_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
S5SQU8_SALNE/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
E7ZJ98_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N1IU79_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3MQT8_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3BY64_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
I9EN88_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
X4NCF3_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V7T675_SALTM/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A024AS92_SALEN/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
I9ZRK7_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGTASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
X3MQ01_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
I9DN18_SALNE/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
V1VLW2_SALSE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVAPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
I6A8A8_BURTH/134-289                .................fvdeavkqvahartpei-------------------------RQDAKFGRQVYEATLCAIFSEAKDRFCMDPATRaG.....NARPA.FVKALGEAACATGLP.GADKQ.GVFTPSGAGTNPLYAE----------.------..-------...------------------------------------------irqradtlmgaelaarpeyrelqpyarqqaidlvasalpaersdalarfrqtvqtldatyrra
H7E9C7_SALHO/76-240                 ..................................AVLTNKVVKEFMLQTLNDMDIRGNASKDPAYASQTREAILSAVYSKNKDQCCKLLISK.G.....INIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLVSSANSKYP.HMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECVMPTPQQFHLILENIANKYIQNT-p..............................................................
G9ULR3_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6NKT8_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V3Z673_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
SOPE_SALTI/76-240                   ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
V0NHS2_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
U6XP90_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
N0XTF9_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3ULZ7_SALEN/76-177                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLI--------.------..-------...------------------------------------------...............................................................
V1WFB1_SALMU/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X5A413_SALAN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYGNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V0LTS2_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6EYJ3_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V3Y1U4_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
I9IFJ0_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
I2KTT8_BURPE/85-245                 ..............irhfvdeavkqvahartpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
S3EVK5_SALPT/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNVGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
S4IZ82_SALDU/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X5AAN5_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
K5AUL2_SALET/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
L6LV74_SALEN/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
W1M387_BURPE/85-245                 ..............irhfvdeavkqvahartpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIRLRAD----.------..-------...------------------------------------------tlmgaelaarpeyrelqpyarqqaidlvanalaaersntlvefrqtvqtleatyrraaq....
E8NNS3_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
K8UWC4_SALTM/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3LMP7_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6BQ74_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L5WT99_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3WS83_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X3CWU8_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X5BC19_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
L5Z7I8_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X3KKD8_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V0FN08_SALMS/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A018UD08_SALET/76-240             ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
C0Q2Y0_SALPC/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
V0PG03_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
G9W4I1_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITS.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4RJT6_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A023MS24_SALEN/76-240             ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
J1KYP0_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
E7Z204_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
I9KVB3_SALNE/76-145                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.F--------------.-----.--------------------------.------..-------...------------------------------------------perdr..........................................................
J2BPA9_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4GKR7_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X3Q3A3_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1IDW8_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVAPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
X2R9D9_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
BOPE_BURTA/86-247                   ...............rhfvdeavkqvahartpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIAALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIRLRADTLMG.AELAAR..PEYRELQ...SYARQQAID---------------------------------lvanalpgersntlaefrqtvqtleatyrraaqda............................
L9S2P1_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
J2DLZ9_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
N0XE88_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V7IQX1_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4EES2_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2LPK3_SALEN/76-210                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMX---------------------------------xdg............................................................
V1KHG7_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
SOPE_SALPA/76-240                   ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNVGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
V1SEU2_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4X8R3_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
E8AWE9_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3D077_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4PQ79_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1M049_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFDKGALPTPQQFQLTIENIANKHLQNAS...............................................................
U3SHA1_SALTM/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V0D9J2_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2ZM08_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V2G8Z7_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2SA48_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V7RXT4_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQKAS...............................................................
L6GWB5_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4WJL6_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L9QAQ4_SALGL/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIPN--tp.............................................................
X4VWU7_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
U6Q6M8_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N0N259_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1U4N9_SALSE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVAPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
U6X2Y7_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
B5N8F9_SALET/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQNT-p..............................................................
X3M1K1_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L5W2W3_SALPU/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6C3B0_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X3W3Q7_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A018X379_SALET/1-161              .................................m--LTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQ---...............................................................
L6QCH1_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
W6T2L8_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
E8CNV7_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4NS29_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L6AB96_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V2IYL9_SALDZ/76-240                 .................................s-VLTNKIVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSSVYSNHKDQCCKLLVNK.G.....GSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPAGAGTNPFVVPLISSASTKYP.HMFTNY..NQQVSFK...AYAEKIIMKEVTSLFNERSMQTPQQFQLTVENIANKYLQNAS...............................................................
L9T5F1_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
W8U3B0_YEREN/1-126                  .................................m---------------------------------------LASVYSNKKDVFCKEMISK.G.....IDISG.YLKDVGAAALQAGLE.GKIDNnDTFIPTGAGANPFVTAVISSAQLKFP.LVFLNK..NQQGFFK...QYAEKKISCEVGKICKDNGFISPVEFGVMLDKIASRYL----ls.............................................................
N1H3G2_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4LDJ7_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4SM63_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X4K043_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X2PJ67_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
A0A018XCL3_SALET/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2PV90_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
E8F7S4_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1YQD1_SALET/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQNT-p..............................................................
G5QHW8_SALRU/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVAPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3IMK8_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
F2FUD0_SALGL/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N0ILX3_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A018PYI4_SALET/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
Q8GCQ5_SALET/63-213                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFIAPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQL--------------...............................................................
X4L7J3_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V2LYQ0_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2QWX9_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V7UKB3_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQKAS...............................................................
L6UAB2_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
E8D5F6_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2N7L2_SALEN/76-237                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTXXVFV---------------rlllwktiknrh...................................................
X4RUQ5_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V1YE86_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V7TL99_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQKAS...............................................................
K4ZNU4_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6DE43_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
E7XR11_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
I0NCV8_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6AAE2_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
U1JAN6_SALET/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
U6QN89_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3DCG1_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6ZHK7_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L9QJH6_SALDU/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
J1VA85_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V0PV47_SALNE/1-164                  .................................m--LTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
X2S9T3_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6X473_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
A0A018VTL1_SALET/22-182             ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYI----...............................................................
X2QHJ6_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L9Q598_SALDU/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L5XU61_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X3SXM4_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
N0Z4C3_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
T2PUN4_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
S5HN37_SALET/76-245                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.GivskgIDMAP.FLKEIGEAAQNAGLP.GATKN.DIFTPSGAGANPFITPLITSAYNKYP.HMFTSQ..HQKASFN...IYAEKIIMKEVAPLFNECAMPTPQQFQLILENIANKYIQNT-p..............................................................
L5WSC8_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
N0RZ22_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4LJR7_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
N0JJV6_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
Q8GCP8_SALET/63-213                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEGAPLFNECAMPTPQQFQL--------------...............................................................
L6H1I5_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L7AN78_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
I9GNV6_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3CAT3_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L6C495_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3Z1D4_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
S5H9I4_SALTM/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
B5PH60_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
J2B3Z0_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A018ZQS0_SALET/25-185             ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYI----...............................................................
K0QGZ9_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
B5R218_SALEP/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4P0G8_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A017RJS8_SALET/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
R0EMA3_SALHO/76-240                 ..................................AVLTNKVVKEFMLQTLNDMDIIGNASKDPAYASQTREAILSAVYSKNKDQCCKLLISK.G.....INIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLVSSANSKYP.HMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECVMPTPQQFHLILENIANKYIQNT-p..............................................................
L6K081_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2Y3T9_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X4AKU2_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L5WHL9_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L6R5X8_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3F4M0_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
A0A018Z0E2_SALET/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1QV38_SALPT/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
J2CRN4_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L6UW33_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
I0MNR1_SALET/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
X4K5C7_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
J1TR74_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
K5AIL7_SALET/1-164                  .................................m--LTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
X4WFU0_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6YK68_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X4L9A2_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
I9M2C8_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
S4J7Q0_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
H0L505_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
B7CYY6_BURPE/85-245                 ..............irhfvdeavkqvahartpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
L6P3H0_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N0V975_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L5XJ68_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
Q8GCQ0_SALET/63-213                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQL--------------...............................................................
V7SU93_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQKAS...............................................................
X4J060_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
G5PM24_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A024ARU6_SALEN/76-240             ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X4B418_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
E8DJN1_SALMO/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
E8FS57_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
I0M0G6_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2NAG6_SALEN/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1YCP3_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4FWI4_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
B5CHF0_SALET/28-192                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3M6X3_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X2SZD4_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4W8M7_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1XIR6_SALMS/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L6E4V3_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X2U605_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N0U6C2_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
M3LKV2_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1EE56_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3NMV7_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X2SB13_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X4BT71_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
A0A018RL61_SALET/76-240             ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
SOPE_SALHO/76-240                   ..................................AVLTNKVVKEFMLQTLNDMDIIGNASKDPAYASQTREAILSAVYSKNKDQCCKLLISK.G.....INIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLVSSANSKYP.HMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECVMPTPQQFHLILENIANKYIQNT-p..............................................................
L5ZA47_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2S0W5_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1WTV6_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
G9TZH6_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3BUR7_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L6ELC8_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
E7VUB4_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
Q8GCP7_SALET/63-213                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQL--------------...............................................................
S5GZ23_SALET/1-164                  .................................m--LTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQNT-p..............................................................
X2X4Y1_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
A0A017QQU3_SALET/1-136              ..................................-----------------------------AYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
B4TY24_SALSV/28-192                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N0LNM5_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6PKM0_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
M3KTF9_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
U6WH72_SALTM/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A018VJS8_SALET/24-188             ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
X4AG37_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6WHI8_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4Q2Z1_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
K5A539_SALET/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
L6E4T3_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
BOPE_BURM9/85-245                   ..............irhfvdeavkqvahtrtpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
H6P2C2_SALTI/1-163                  ..................................--MTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
I2KQI1_BURPE/85-245                 ..............irhfvdeavkqvahtrtpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
X2Z524_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
J1PFR6_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4DVV5_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V2B578_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2Y450_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
J1JVL4_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V2B946_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQKAS...............................................................
M7E904_BURPE/85-245                 ..............irhfvdeavkqvahartpei-------------------------RQDAGFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
N1FEZ3_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V0PVP0_SALNE/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
A0A038E5Y8_SALTM/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4FBA6_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X2YG81_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2TU81_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V7QKR0_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQKAS...............................................................
S4JEM6_SALEN/1-154                  ..................................-----------MLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
N0TIE6_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6EHM1_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
I2M7Y8_BURPE/85-245                 ..............irhfvdeavkqvahartpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
H6P6R8_SALTI/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.REIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
X3VG60_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V8MBK0_SALIN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
L5YJ03_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3FSE6_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6W4X9_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
B5NV77_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
L6HQB0_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
T2PMQ3_SALEN/1-154                  ..................................-----------MLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
J1Y3U0_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X0NUS6_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPMPQQFQLTIENIANKYLQNAS...............................................................
A0A018T2A4_SALET/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6RQM6_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X3YBZ4_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V2JH48_SALET/78-242                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N1DVG5_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4DF70_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2VF09_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X3GH01_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
A0A018YAB4_SALET/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N0ZTZ8_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
J2FPL2_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3ZVB1_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V2AMS2_SALDE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINY..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X5APR3_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
S4IWZ9_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A018WGD0_SALET/25-185             ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYI----...............................................................
I9IPV6_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6PMY3_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6WVM9_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V1LV38_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
V1YV24_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3UI25_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V7RH57_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N0H6X9_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2QK03_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3BLN8_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N1CZL5_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A018PYC9_SALET/76-240             ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
X3BR67_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
G5P806_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....NSITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
T2QHC9_SALEN/1-154                  ..................................-----------MLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
B5FTF5_SALDC/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V2ABN0_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
V2DRE6_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1M1W3_SALSE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVAPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
N1HYV8_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6AUV6_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1FGQ8_SALTM/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4CHK1_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2U6P6_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X3PCI7_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
I0MGS4_SALET/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
X2WBE2_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V2AFL1_SALET/3-82                   ............................yllqvg----------------------------------------------------------.-.....-----.---------------.-----.-------QGRILLSSPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
X3FGP7_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
N0Q9V2_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N0VXN6_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
S3EJC7_SALPT/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNVGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
X3QK94_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1RD23_SALPT/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V3XDI3_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2LK35_SALEN/1-134                  ................................mx---------------------------------XTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4KWW0_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
H0NAM8_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3JEH9_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
U1RCA4_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1M331_SALSE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVAPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2VYQ2_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2RXP1_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
J1WAN7_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
K8US92_SALTM/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3B5G3_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V8MP40_SALIN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
N0SJ56_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
B5R1Z8_SALEP/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X3S4Q8_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1RGV0_SALET/16-180                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
S4HT36_SALDU/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
E8EM19_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A018U0P0_SALET/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4M1Q7_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
Q8GCQ6_SALET/63-213                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEDVPLFNECAMPTPQQFQL--------------...............................................................
A9K527_BURML/85-245                 ..............irhfvdeavkqvahtrtpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
L6ZI19_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
U5V164_BURPE/85-245                 ..............irhfvdeavkqvahtrtpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
X4M9B3_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N0H0B1_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
S4JTI5_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V0I835_SALSE/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVAPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6ELF4_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X4CPJ0_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V1Q4D5_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
X2TNK4_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
A0A019A6V9_SALET/47-211             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
B5PH67_SALET/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X3CMP9_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6J2I9_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X3EU12_SALEN/1-100                  ..................................----------------------------------------------------------.-.....-----.-MKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4HV76_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
I0N1R7_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6W757_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1U326_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....NSITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
W4MPB7_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2MVD2_SALEN/76-225                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTXX------------------rlp............................................................
S4K350_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6FVH6_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V0JZX8_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6RDD9_SALEN/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N0PKW2_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A018V456_SALET/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6WFN2_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
S5NE67_BURPE/85-245                 ..............irhfvdeavkqvahartpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
A0A018SR09_SALET/1-164              .................................m--LTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQNT-p..............................................................
S3E691_SALPT/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNVGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
X4ISG4_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKXXXXXVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6T7B2_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3YB41_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X3JPJ2_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
G5L858_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
H8LXL2_SALTM/1-164                  .................................m--LTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQNT-p..............................................................
A0A018SVV0_SALET/76-240             ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
I9K9B5_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6K056_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V0BMZ0_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
S4M1R5_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6PA41_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
A0A018NCL3_SALET/76-240             ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
Q9AH24_SALDZ/1-97                   ..................................---------------------------DPAYARQTCEAILSSVYSNHKDQCCKLLVNK.G.....GSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPAGAGTNPFVVPLISSASTKYP.HMFTNY..NQQVSFK...A-----------------------------------------...............................................................
V0H850_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
G9VGE4_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
H0MZT8_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3HYE0_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4EK70_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
B5Q9W6_SALVI/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
A0A018Q0R3_SALET/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3CJK1_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
N0AP44_BURTH/87-244                 ................hfvdeavkqvahartpei-------------------------RQDAKFGRQVYEATLCAIFSEAKDRFCMDPATRaG.....NARPA.FVKALGDAACATGLP.GADKQ.GVFTPSGAGTNPLYAEI---------.------..-------...------------------------------------------rqradtlmgaelaarpeyrelqpyarqqaidlvasalpaersdalarfrqtvqtldatyrraa
X4VID6_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
I9GSX2_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
G9T4W1_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
E8X9B5_SALT4/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A018YRL9_SALET/25-185             ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYI----...............................................................
A0A038D790_SALET/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6PI31_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
M4LPR7_SALET/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQNT-p..............................................................
L6ABC2_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2R7C3_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V7SGR4_SALTM/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X4HZP8_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L9SI28_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
C4I6J6_BURPE/85-245                 ..............irhfvdeavkqvahartpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIRLRAD----.------..-------...------------------------------------------tlmgaelaarpeyrelqpyarqqaidlvanalaaersntlvefrqtvqtleatyrraaq....
I0MSD2_SALET/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
L6EYH0_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
N0Q0S4_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
W6B9P0_BURTH/86-247                 ...............rhfvdeavkqvahtrtpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIAALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIRLRAD----.------..-------...------------------------------------------tlmgaelaarpayrelqsyarqqaidlvanalpgersntlaefrqtvqtleatyrraaqda..
BOPE_BURM7/85-245                   ..............irhfvdeavkqvahtrtpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
X3N0X3_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
J1N7Y2_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
K7Q1T5_BURPE/85-245                 ..............irhfvdeavkqvahartpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
V1JZ17_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2ZVW0_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X2KJH9_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6UWE6_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
Q8GCP9_SALET/63-213                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVAPLFNECAMPTPQQFQL--------------...............................................................
X5BV42_SALAB/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V0FC37_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3IPK8_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N1B0U7_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
J0FG73_SALNE/1-150                  ..................................---------------LNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
U6UCG5_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
V7WKU8_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQKAS...............................................................
V0MT45_SALNE/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
X4JB17_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L5YTC3_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V1JWQ7_SALTM/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
B2HCG9_BURPE/85-245                 ..............irhfvdeavkqvahartpei-------------------------RQDAGFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
X2PJE9_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3QFW0_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3TPH2_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1RR74_SALPU/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
Q99Q83_SALBN/1-97                   ..................................---------------------------DPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...A-----------------------------------------...............................................................
X3WV74_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
S4JWA9_SALEN/1-154                  ..................................-----------MLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L6YD29_SALEN/81-245                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A018QPX3_SALET/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
J1N7V0_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V0NBL7_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
I0MCF1_SALET/1-164                  .................................m--LTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQNT-p..............................................................
L6YFS0_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6K9R8_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
I9EZG9_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
V0GCD7_SALPU/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIPN--tp.............................................................
L6HX28_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
I9H5R7_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
X4B360_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
S5I2F8_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3P6E5_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4X597_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
SOPE_SALGL/76-240                   ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIPN--tp.............................................................
X7RJY6_SALTI/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
V0EH67_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
U6Z1U6_SALTM/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
U6V6D0_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
L5XT27_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6RRW5_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3X297_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4MLH8_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
M9XQN2_SALTM/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L5Z7K8_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
S4J1K7_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3XHS5_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
R7RKH3_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N0KGD6_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1FFM4_SALTM/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4HEZ0_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L6ZWL5_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
A0A021WVA3_SALET/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V7X1C8_SALTM/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L9QB04_SALDU/75-239                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
G5MHA9_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
M3K3B4_SALNE/76-240                 ..................................AVLTNKVVKDFMLQTLNNIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQNT-p..............................................................
L5ZA69_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
B4TKI8_SALHS/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
J2FCP3_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V2KTL3_SALET/76-128                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCK-----.-.....-----.---------------.-----.--------------------------.------..-------...------------------------------------------...............................................................
X3ZDE9_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3B961_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
A0A018UQE4_SALET/33-197             ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
J2G896_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
J0E8R7_SALNE/2-72                   .............................sfcrp----------------------------------------------------------.-.....-----.---------------.-----.---------------PSIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1GJ47_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNA-p..............................................................
L6IU52_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1XD62_SALMS/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
SOPE_SALDU/76-240                   ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFSPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
SOPE2_SALPA/76-240                  ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V0FJH5_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N0TL18_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
B4A164_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
U1RD99_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
H0M187_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
K5AKP6_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
Q9AH23_SALHO/1-97                   ..................................---------------------------DTAYARQTCEAMLSGVYSNNKDKYCNLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GETKN.DIFTPGGAGANPFVIPLIASASMTYP.HMFINH..SQQVSFK...A-----------------------------------------...............................................................
V0P9N9_SALNE/1-87                   ................................mr----------------------------------------------------------.-.....-----.------------GYL.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIEI----------lrisif.........................................................
I0M139_SALET/1-164                  .................................m--LTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQNT-p..............................................................
L6QCJ4_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X3TCJ3_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N0IY38_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6ARZ0_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2V2R3_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V0LP12_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
R0EM52_SALHO/76-240                 ..................................AILTNKIVKDFMLHKLNSLDIQGNASKDTAYARQTCEAMLSGVYSNNKDKYCNLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GETKN.DIFTPGGAGANPFVIPLIASASMTYP.HMFINH..SQQVSFK...AYAEKIIMKEVTPLFNERSMPTPQEFQLTVENIASKYLQDAS...............................................................
X3HME2_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
M3JMH6_SALNE/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V2HDR5_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V2B060_SALET/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
X4MAX1_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N0UU66_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
U6TYH1_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
X3SLD4_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N0R1K1_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
S5GU30_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
G5Q1J1_SALMO/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6HPT1_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V0MVW4_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3ASZ8_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X2T407_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X3T9Q9_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L6R953_SALEN/1-164                  .................................m--LTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
B5P6N1_SALET/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
J1SIE8_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
E9A164_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
X3WPG4_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X4FE63_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X4PD22_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4ELZ1_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
J0E226_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3W1L1_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V2C8V4_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
L6ZX27_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1IZ92_SALMU/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
I2KRQ4_BURPE/85-245                 ..............irhfvdeavkqvahtrtpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
X3AWJ5_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X3R8R2_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYXXXXXQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3VPC0_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A018W2B2_SALET/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
I0MH80_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V2CPC1_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6MK53_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
J1J803_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A018U6B2_SALET/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4RHD2_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
A0A018ZD37_SALET/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
S4K0X1_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4FV49_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N1HX89_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X5MZC6_SALET/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQNT-p..............................................................
X2Q553_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L6G5S9_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V0CHE4_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
I0AA05_SALET/59-223                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6KHE7_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
BOPE_BURP6/85-245                   ..............irhfvdeavkqvahartpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
X4JN21_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
A0A018RVH4_SALET/22-183             ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQ---...............................................................
D0ZK57_SALT1/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4TCA4_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
S3G9Z2_SALPT/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3XSI5_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
I9PZ90_SALNE/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X3AC54_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6AR63_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X4DQF8_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V1X819_SALMS/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4J3L4_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
E7Y214_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A018R712_SALET/76-240             ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
X3LA02_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L6ILX2_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3IBS1_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
A0A018UE51_SALET/86-250             ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQNT-p..............................................................
X4V6F0_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V1MAR7_SALSE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVAPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
L6UCT6_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V4GFX7_SALON/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
X2ZQV3_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
G5REK8_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
G9TH69_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
I9D2R5_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
X4MJM0_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
B5NIZ3_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A018ZGT9_SALET/56-216             ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYI----...............................................................
L6Y4L3_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X3WUR6_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3XUF5_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3ZJ30_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
J2ATR9_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
J0D7R3_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3UK35_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V2I8M2_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V0LAQ1_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6ILS9_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V0NWR2_SALNE/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
V9Z1U9_BURPE/85-245                 ..............irhfvdeavkqvahtrtpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
S3EMC7_SALPT/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A018ZH07_SALET/1-164              .................................m--LTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
A0A018NFP8_SALET/76-240             ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
K8S8B1_SALTM/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4JYQ2_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4SZY9_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1UMF9_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V0C1X4_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3ZIM9_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L6KH79_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPDGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
U4MBV0_SALTM/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIIMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A018T0C4_SALET/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3LDS3_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
J1H3W7_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
W0PZA0_BURPE/85-245                 ..............irhfvdeavkqvahtrtpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
C4AWI0_BURML/85-245                 ..............irhfvdeavkqvahtrtpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
V6YT12_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
I2LZ17_BURPE/85-245                 ..............irhfvdeavkqvahartpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
L6L4B1_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V1KBT3_SALTH/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A018VA89_SALET/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V0J1J1_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3GIR0_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
U6W3W3_SALTM/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A017RN95_SALET/76-236             ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYI----...............................................................
V1HLK6_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V0P099_SALNE/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L9SMZ9_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
C4K8Y0_HAMD5/307-476                ............alfnsellklskllklpegksi---------------------FDEAKYNQTTRNQLIDAGLASVYAQKIDDFKKKYGES.S.....ETGQK.FLFEIGKVCKENGVKcTQNKN.GTWVVNGAGAHPVIYPISQNIFTKFKmHLKLSN..NKTKMYDksiSYITNKVYKKTDELCKQENRITTSD-----------------lrsllddvekkvldgt...............................................
U6YLQ2_SALTM/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3QQ32_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L7AFA4_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
K8S6L0_SALTM/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6UVS7_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
SOPE_SALET/76-240                   ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
X4S7C6_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4CUS6_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N1BND3_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
E7WG14_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6YNS2_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V1GWQ3_SALHO/76-240                 ..................................AVLTNKVVKEFMLQTLNDMDIRGNASKDPAYASQTREAILSAVYSKNKDQCCKLLISK.G.....INIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLVSSANCKYP.HMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECVMPTPQQFHLILENIANKYIQNT-p..............................................................
A0A018YF86_SALET/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3SB01_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V0R777_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6TMT1_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V0PX30_SALNE/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
B5FTH6_SALDC/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4QRH6_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N0YIM1_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
H7E9H1_SALHO/76-240                 ..................................AVLTNKIVKDFMLHKLNSLDIQGNASKDTAYARQTCEAMLSGVYSNNKDKYCNLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GETKN.DIFTPGGAGANPFVIPLIASASMTYP.HMFINH..SQQVSFK...AYAEKIIMKEVTPLFNERSMPTPQEFQLTVENIASKYLQDAS...............................................................
E8CHC5_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1RPM0_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4D6Q3_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
K5AWE2_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1TUR9_SALET/1-134                  ..................................------------------------------YARQTCEAMYQPCTVIIKITVVNYSSVK.G.....-SVYP.LLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVAPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
N1D932_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
S5GYR0_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4IHC8_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
J1TR94_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
U6TFQ6_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
L6CLA4_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L5ZMB8_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X2SRG5_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
W0MN55_BURPE/85-245                 ..............irhfvdeavkqvahtrtpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
U6YL42_SALTM/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6CZ59_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4C1F3_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X2XJJ5_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3Y6H7_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X2NI59_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3V1W4_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V3YRH2_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2MCH6_SALEN/43-117                 ...........vhgikdfiiccgykgyvikeyfa----------------------------------------------------------.-.....-----.---------------.-----.--------------------------.---XXQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
N0VGE9_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V2GGV0_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARKTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A9MNG9_SALAR/76-240                 ..................................AVLTNKIVKDFMLQKLNSLDIKGNASKDPDYARQTCEAMLSSVYSNNKDQCCKLLVSK.G.....ISITP.FLKEIGEAAQNAGLP.GEIKN.GIFTPGGAGTNPFVVPLIASASVEYP.HMFINY..SQQVSFK...AYAEKIIMKEVTPLFNEGTMPTPQQFQLTVENIANKYLQNAS...............................................................
V1Z6K7_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L9SN73_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N0NUZ4_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1PB89_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
X3QT59_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X2UQY9_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V1NII9_SALRU/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6G539_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
N0YDB8_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A018U7W3_SALET/33-197             ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQNT-p..............................................................
V2P1L4_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
G4C2J0_SALIN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVAPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
Q7P1B7_CHRVO/84-241                 ........................plspgdvkam-----------IRSRLDSL---RDGMADPVYRRQALESTYATIYSEAKQAFYRA--NG.G.....KMPEG.YLRELGEAARAAGLP.GENKH.GVFIPSGDGASPFVNYLLIPVQKEFG.HRLRNE..SQQRLFR...DFARQLSMELVAPHAAERGWEPPAAFAARLEAVGRPWL----aqa............................................................
U6QZN3_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
X4Q5V3_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L6XLL1_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V2DBX7_SALBE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3PCC7_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3K7S7_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A018V7I9_SALET/25-189             ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQNT-p..............................................................
V5VV69_SALET/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
X4QVH6_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V5S0B3_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4T9T7_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
G5MXD7_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
X4E2L0_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
J2DLX6_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1QZF6_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNA-p..............................................................
X2TP39_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
F2FD43_SALDU/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
U6WX28_SALTM/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2WU50_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
H0LQ33_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6MWC8_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X3D5P1_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X2Z5H9_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1T3D4_SALON/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
K8UFI3_SALTM/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
S5UQU6_SALPU/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6AUM1_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
N0ZFN6_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1IHI2_SALVI/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
T2K8I4_SALTM/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A019A6X6_SALET/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2NDS4_SALEN/37-98                  .................................x-VLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSXX-----------.-.....-----.---------------.-----.--------------------------.------..-------...------------------------------------------xtllpparlaflkgc................................................
L9RS08_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V7TE98_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQKAS...............................................................
X3MWK3_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
A0A018RIG1_SALET/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6MK76_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V7SJ72_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQKAS...............................................................
V0PLH2_SALNE/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
X3XLY5_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X2W547_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L7AC08_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A018P9T9_SALET/76-240             ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
V1WQY4_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
X4TMB2_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
E8AL65_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2P6D6_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
B4TRG6_SALSV/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQNT-p..............................................................
C0Y4G4_BURPE/85-245                 ..............irhfvdeavkqvahartpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
V0MYZ0_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V2KBT2_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVAPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
X4A1S4_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
J2BN58_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V0QVE1_SALSE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVAPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1PNK9_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3YI76_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
C6U6E4_BURPE/85-245                 ..............irhfvdeavkqvahartpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
A0A018TJT9_SALET/76-240             ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
V2NNH4_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
G5RUB3_SALET/28-192                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
J1WAL2_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X4G1C3_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X4SVV1_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L6M5L4_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V1MZA8_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V7XIN4_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQKAS...............................................................
X4CBW5_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
C5NAW6_BURML/85-245                 ..............irhfvdeavkqvahtrtpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
X3WDQ8_SALEN/1-164                  .................................m--LTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V1QH86_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
C9X6N1_SALTD/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V2DI74_SALBE/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQNT-p..............................................................
L6QZ04_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X3AFP7_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
N0K171_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3PST1_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L6WX95_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V0NVS0_SALNE/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
X3K7Q5_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIXXXASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
E8BAM8_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N0L9G2_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V7VEY5_SALMO/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
J2B3W2_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X4FEK6_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
I9WGV5_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
Q8GCQ4_SALET/63-213                 ..................................AVLTNKVVKDFMLQTLHDMDIRGSASKDPSYASQTREAILSAVYSKNKDQFCKLLISK.G.....INTAT.FLKEIGEAAQNAGLP.GATKN.GVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQL--------------...............................................................
V7WZ77_SALMS/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2TBC9_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V0MGF9_SALNE/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
V2GXJ2_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
G5NPG9_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2X9P9_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1EHU9_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2ZDC2_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L6GXJ2_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L6XDB1_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
C5ZUR9_BURPE/85-245                 ..............irhfvdeavkqvahtrtpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
A0A018YLG5_SALET/76-240             ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
A0A038DXQ8_SALTM/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4GDK9_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3GWH7_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X4A1R1_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
E8GZZ2_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
K8TL47_SALTM/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4YAT8_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X2WTQ9_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
I9FH43_SALNE/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
N0WYH4_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
I9GED6_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
SOPE_SALHA/76-240                   ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNA-p..............................................................
X4TAI6_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V0BEF6_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N1HC52_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
S4JVG6_SALEN/1-154                  ..................................-----------MLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V7YEP3_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
T1YIK3_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V0Q0Q2_SALNE/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
E8GGB5_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
B5BEC1_SALPK/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNVGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
E8A3Z4_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3STY6_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V2K932_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L9SI50_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
E1WG92_SALTS/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V2PP69_SALET/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIPN--tp.............................................................
X3SSA7_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L5WHJ5_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V7IM51_SALET/1-159                  ..................................-----------MLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.GivskgIDMAP.FLKEIGEAAQNAGLP.GATKN.DIFTPSGAGANPFITPLITSAYNKYP.HMFTSQ..HQKASFN...IYAEKIIMKEVAPLFNECAMPTPQQFQLILENIANKYIQNT-p..............................................................
W6C258_BURTH/86-247                 ...............rhfvdeavkqvahartpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIAALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIRLRADTLMG.AELAAR..PEYRELQ...SYARQQAID---------------------------------lvanalpgersntlaefrqtvqtleatyrraaqda............................
I9K7Y1_SALNE/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
H5VMC3_SALSE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVAPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A018XBG0_SALET/1-160              .................................m--LTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYI----...............................................................
L9REA1_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L5ZPU3_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X5NBI8_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6RYN5_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
A0A038EUZ3_SALTM/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N0M2E3_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A018TR07_SALET/1-164              .................................m--LTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQNT-p..............................................................
M7RWW7_SALDU/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X3LAU4_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
N0KRJ8_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
S4HIW3_SALEN/1-154                  ..................................-----------MLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
A0A018PR93_SALET/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
J1PFU3_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X3LN47_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
I9ZSZ7_SALNE/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X3FF74_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6G9H9_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V2NBW5_SALET/1-99                   ..................................----------------------------------------------------------.-.....-----.--KEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1WXM4_SALMU/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V2ABX0_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
E8BMP7_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3K7Y6_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4SXC0_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4UUS6_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6TA42_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L9R4H7_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X4HRW8_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X4PZE9_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
M3M4R7_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3F738_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3NHE0_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
H1RHJ8_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1IQH0_SALMU/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
G9V4V0_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3WLQ5_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
N1AMN5_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3P0F1_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3APR6_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6CL80_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
N1CLN3_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2WNB1_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
U6Z119_SALTM/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQNT-p..............................................................
X3UPT7_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1NNG7_SALET/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X4GJG7_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L5WSB0_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4TYC5_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L6PHF8_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
A8EPM1_BURPE/85-245                 ..............irhfvdeavkqvahtrtpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
L5YJ25_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X3V695_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
N1GRB4_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6YY12_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1KPB1_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
E8E1G2_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6CZ35_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
A5XL56_BURML/85-245                 ..............irhfvdeavkqvahtrtpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
A0A018XKE6_SALET/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
B0G0X4_SALET/13-133                 ..................................AVLTNKVVKNFLLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKA---...------------------------------------------s..............................................................
T2Q382_SALEN/1-154                  ..................................-----------MLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V1T4X3_SALON/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
A0A018PGS0_SALET/1-164              .................................m--LTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQNT-p..............................................................
B3YGU0_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
I1WUB3_BURP2/85-245                 ..............irhfvdeavkqvahartpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
X4XSI8_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
B5P0W3_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
B5F3N6_SALA4/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V0HJN7_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4N055_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
B5R8S6_SALG2/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIPN--tp.............................................................
L6YXY9_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
Q57NF3_SALCH/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
X3XXD3_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYXXKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
B5MSK9_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3H914_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
N1F2M5_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A018XAW5_SALET/25-185             ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYI----...............................................................
L6RXT6_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4HMF1_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
S5IDI6_SALET/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
X2PEW7_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2VFI2_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V2DSL7_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3V7Q1_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
N0UFT7_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N0NJ72_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
K8VR53_SALTM/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V0KBD0_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
H0LLM7_SALMO/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
E7ZBH9_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A018WW41_SALET/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A018TZ49_SALET/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V0NUD8_SALNE/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
N0C059_SALTI/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.REIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
N0JDA9_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3REA8_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
E7VQW4_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A023SQL9_SALTM/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
K5AUX6_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
K8TNE5_SALTM/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1EHG8_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1FVR4_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
E8EAN9_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6SYS4_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
J2CRR2_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V3YPQ1_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1KCM9_SALET/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X3GBM3_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N1BF40_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N0PBA4_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6FVJ6_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A018V411_SALET/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4BAH1_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
N0WEJ0_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L5Y0M2_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V1GR46_SALCE/76-240                 ..................................AVLTSKIVKDFMRQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNSKDHGCRFLVSK.G.....VSITP.FLKEMGEAAQKAGLP.GEIKN.GIFTPDGAGANPFVIPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTSLFNEGAMPTPQQFQLTMENIANKYLQNAS...............................................................
X4BZF4_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
E1WJI8_SALTS/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQNT-p..............................................................
X3DYK4_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L6VMI2_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V0G4X3_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3EC72_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X4EEJ1_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3IBT2_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
BOPE_BURMA/85-245                   ..............irhfvdeavkqvahtrtpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
V1PEW3_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
I9Y9U6_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
X4ZN65_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L6W9Y3_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X3Q387_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
J2BPD7_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L5YT97_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4XHB3_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
E7WUB3_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L5ZPW8_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V1PPL9_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
BOPE_BURP1/85-245                   ..............irhfvdeavkqvahartpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
V2KN19_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4RGC7_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3ETE6_SALEN/76-236                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMXXPRRLR---------------rqrrqalrryk....................................................
X3E3X1_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6ZBJ1_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X3FBU9_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L6TND9_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
J1I2C2_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V5VK77_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4UNQ1_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L6GT60_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V3Y783_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V5KQ61_SALTH/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMTTPQQFQLTIENIANKYLQNAS...............................................................
V3YAL8_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2N752_SALEN/9-106                  ptakigflpgqyinlhykgvtrsysiansdesng----------------------------------------------------------.-.....-----.---------------.-----.-----------------IEXXXSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNX-x..............................................................
J1Y3W6_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3QXS8_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V7RD62_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQKAS...............................................................
L9QEU4_SALDU/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N1A8X0_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
E7WJY1_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L9R9Z6_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4GTK1_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V7W049_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQKAS...............................................................
N1ECQ3_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4EZA0_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V6YTW2_SALET/76-245                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.GivskgIDMAP.FLKEIGEAAQNAGLP.GATKN.DIFTPSGAGANPFITPLITSAYNKYP.HMFTSQ..HQKASFN...IYAEKIIMKEVAPLFNECAMPTPQQFQLILENIANKYIQNT-p..............................................................
X3GWW4_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V5ZKD6_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
J1NSZ9_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6SL60_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L6EHJ9_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A018RWW5_SALET/76-121             ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYS-------------.-.....-----.---------------.-----.--------------------------.------..-------...------------------------------------------k..............................................................
B5CDN9_SALET/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQNT-p..............................................................
A0A023MRX8_SALEN/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
SOPE_SALTM/76-240                   ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQNT-p..............................................................
#=GR SOPE_SALTM/76-240        SS    ..................................XX-SHHHHHHHHHHHHHHH-HHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHC.T.....--SHH.HHHHHHHHHHHTT--.EEEET.TEEEETT-SS-TTHHHHHHHHHHH-G.GGGSSH..HHHHHHH...HHHHHHHHHHHGGGGTT-SS--HHHHHHHHHHHHHHHHTT---..............................................................
X3JVZ2_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2UDM7_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3FZB6_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
M4LN61_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4LQX5_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X4KBU8_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V0QIJ1_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
M3LS52_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V0G9M8_SALPU/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
B4TDY1_SALHS/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
X2QLE2_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V0BKB6_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
J1NSX0_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V4GAA9_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
A0A038EFV9_SALTM/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N1C915_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
J1SID2_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V2B556_SALHA/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V7U954_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQKAS...............................................................
X3UE00_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
U6Y5Y1_SALTM/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQNT-p..............................................................
L9QU23_SALGL/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
K8VE99_SALTM/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6S568_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V7YPE7_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQKAS...............................................................
L6LLW0_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
I9ZSE8_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
X2YSR8_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X3S9G4_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V0EQL1_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3YL21_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
F8VGD4_SALBC/76-240                 ..................................AVLTRKIVKEHMQQKLNELDIKSHASKDPSYARQTCEAILSAQYSNNKDKYCRLLINQ.G.....LSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFITPLVSSASIKYP.YTFINH..NQQTSFK...AYAEKLIMEEVTPLFKEQNLPTPQQFHLTLENIASKYIQNT-r..............................................................
X3UAX2_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X3U687_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
K8SNU8_SALTM/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V0I7M2_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V3YR24_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4H2Z9_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2UW59_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X4F3R5_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
BOPE_BURP0/85-245                   ..............irhfvdeavkqvahtrtpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
E7V6J8_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2NTA4_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L6IA50_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2NBC6_SALEN/76-126                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILXX----------------.-.....-----.---------------.-----.--------------------------.------..-------...------------------------------------------tdyvssgsl......................................................
N1EQL2_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3RYI6_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V9YC57_BURPE/85-245                 ..............irhfvdeavkqvahartpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
H0MEM4_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V2MYT0_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6J2F5_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A017QZ51_SALET/76-240             ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
L9S2X5_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6H1L2_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3GN53_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
S3FBX3_SALPT/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A8KGF6_BURPE/85-245                 ..............irhfvdeavkqvahartpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
X2LR18_SALEN/7-82                   ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAX------.-----.--------------------------.------..-------...------------------------------------------xxv............................................................
V0IPE6_SALNE/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
X4VV19_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X4J839_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
N0WS30_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3X164_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L9TNX8_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3YUZ3_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N0SVL2_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N1G144_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
H8M6F6_SALTM/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6VGD8_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
I9VIF3_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6K7M1_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
S5GWM0_SALET/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
A0A018QBH9_SALET/76-240             ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
X4BFU0_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V1YWB8_SALET/76-211                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTP-----------------------------...............................................................
J1W580_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
E7UZH6_SALTM/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V7X3M7_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQKAS...............................................................
W9FB78_SALVI/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
E8G9V7_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V7VH19_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V0D323_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A018NVW2_SALET/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4N314_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2P2B9_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
K8TRH6_SALTM/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
B5BHA1_SALPK/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3A7I2_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1I248_SALVI/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3NN20_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V2JH50_SALET/76-171                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANP--------------.------..-------...------------------------------------------...............................................................
V1WCB7_SALMS/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4P4E9_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
A0A018Q0A1_SALET/76-240             ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
A0A018SBX5_SALET/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A018T8P0_SALET/56-216             ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYI----...............................................................
L6P5V5_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
A0A018X5E5_SALET/25-185             ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYI----...............................................................
L7AV43_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4D1A5_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
A0A018RN22_SALET/1-53               .................................l----------------------------------------------------------.-.....-----.---------------.-----.--------------------------.---FNQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
S4HSH0_SALEN/1-154                  ..................................-----------MLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
G5QYS9_SALSE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVAPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
N0RBY7_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
E8DQS6_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
J2ATP1_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V3WND6_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3KEH7_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V7QZ17_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQKAS...............................................................
V0KNL3_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
I9HXT2_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
J1SC26_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L6KVQ8_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A038ESG3_SALTM/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N0MFI6_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4NSB9_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V0MME2_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
BOPE_BURPS/85-245                   ..............irhfvdeavkqvahartpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
#=GR BOPE_BURPS/85-245        SS    ..............HHHHHHHHHHHHHHHCHHHH-------------------------HHTTTHHHHHHHHHHHHHHHHHHHHHHHSGGGS.S.....SSSHHHHHHHHHHHHHHCT-S.-EEET.TEEE--S--S-SCHHHHH--------.------..-------...------------------------------------------HHHHHHHTTHHHHSCHHCC-SHHHHHHHHHHHHHTSTCHHHHHHHHHHHHHHHHHHHHHHHHH
X4SYP2_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
I0MPI3_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1ELZ6_SALET/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
L7B5E1_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4R7H2_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3PWI5_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
I0MVL5_SALET/1-164                  .................................m--LTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQNT-p..............................................................
L5XIP5_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
W9UCX0_BURPE/85-247                 ..............irhfvdeavkqvahtrtpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIRLRADTLMG.AELAAR..PEYRELQ...PYARQQAIDLVANALRAERSNTLVEFQQTVQTLEATYR----raaqda.........................................................
B5R8U7_SALG2/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4KVA3_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
M7RR53_SALDU/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A017R7Y3_SALET/76-104             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDP-----------------------------.-.....-----.---------------.-----.--------------------------.------..-------...------------------------------------------...............................................................
L6LV94_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L6SYU3_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X3CTK5_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6DEA5_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
A0A018RQT4_SALET/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V2PQG7_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
F5ZSD1_SALTU/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N1IFU5_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
K0QM48_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
A0A018UZL5_SALET/76-237             ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQ---...............................................................
J1KYQ9_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6UY66_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V0DAE4_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N0S3Z0_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2Y406_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2YKN2_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L6M6S6_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4WKN7_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V2MTD1_SALET/76-138                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSIT-.---------------.-----.--------------------------.------..-------...------------------------------------------...............................................................
X3JJB9_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V3Y5S0_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6RD33_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
G5M2I8_SALET/1-54                   ..................................----------------------------------------------------------.-.....-----.---------------.-----.--------------------------.-MFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
S3E3V4_SALPT/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAGYSKNKKQCCNLLISK.G.....INIAP.FLQEIGEAAKNVGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
B1H8L5_BURPE/85-245                 ..............irhfvdeavkqvahtrtpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
X2PWT0_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
G9UAH5_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N0QQ86_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V0J0S0_SALSE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVAPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3H9R0_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4J0F2_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V2FDN5_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3HQZ9_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X3R999_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
I0A7U3_SALET/1-163                  ..................................--MTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
V2FVG3_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2XWM9_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
E7XBM2_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
W6C4T4_BURTH/86-247                 ...............rhfvdeavkqvahartpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIAALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIRLRADTLMG.AELAAR..PEYRELQ...SYARQQAID---------------------------------lvanalpgersntlaefrqtvqtleatyrraaqda............................
SOPE2_SALTY/76-240                  ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
#=GR SOPE2_SALTY/76-240       SS    ..................................S---SSSHHHHHHHHHHHHTHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH.T.....--HHH.HHHHHHHHHHHTT--.EEE-S.S-EEETT-SS-TTHHHHHHHHHHH-H.HHHSSC..CHHHHHH...HHHHHHHHHHHGGGGTSSS---HHHHHHHHHHHHHHHHHTT-...............................................................
X5NTF6_SALTM/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
S3FF11_SALPT/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
B5Q0R6_SALHA/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNA-p..............................................................
N0C0H2_SALTI/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
L6VML4_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
E8XII0_SALT4/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQNT-p..............................................................
L6BLE4_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
A0A018P241_SALET/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4PH30_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2X0R0_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2V2X5_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3M3V2_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6IA25_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X3J1G5_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
B5C323_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
N1DNB4_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
S4J1H0_SALEN/1-154                  ..................................-----------MLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
SOPE_SALEE/76-240                   ..................................AVLTNKVVKEFMLQTLNDMDIRGNASKDPAYASQTREAILSAVYSKNKDQCCKLLISK.G.....INIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLVSSANCKYP.HMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECVMPTPQQFHLILENIANKYIQNT-p..............................................................
X4H5P4_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V0F6Z9_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2SZJ9_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
L9T6Q4_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2RNF7_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3TM10_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A017QYX5_SALET/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V7VEN4_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQKAS...............................................................
L9SI56_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1E2D3_SALET/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
A0A017QPS1_SALET/76-240             ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
K5APP9_SALET/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
X4XKQ3_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
J1H3Y9_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6G9F9_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
B5PP30_SALHA/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4IPN6_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V7UEB7_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQKAS...............................................................
X2MF87_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2XL35_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
A0A018N877_SALET/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V2G073_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A018ZV43_SALET/76-240             ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
X4TLR2_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
J0ENN9_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
G7T498_SALPS/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A9MV49_SALPB/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
A0A018RNE0_SALET/1-154              ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2MB07_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
F2FD63_SALDU/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6LLV3_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3DV11_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V0M1H9_SALNE/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
L6TMQ6_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
A5J440_BURML/85-245                 ..............irhfvdeavkqvahtrtpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
S5UF99_SALPU/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIPN--tp.............................................................
N0HRD2_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6BQJ9_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4AE69_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4U5P3_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
J2FPI5_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X4Q653_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X4WH61_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
E7YJ62_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
E7Y9W8_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3IYM5_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6PA11_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A023N211_SALMO/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V2L384_SALET/23-192                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.GivskgIDMAP.FLKEIGEAAQNAGLP.GATKN.DIFTPSGAGANPFITPLITSAYNKYP.HMFTSQ..HQKASFN...IYAEKIIMKEVAPLFNECAMPTPQQFQLILENIANKYIQNT-p..............................................................
L6NKV9_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
B5N453_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3W8R8_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
U6UVN2_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
X4CJK2_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
U6XH03_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
X2LYN8_SALEN/76-223                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAXXT--------------------kin............................................................
N1GA26_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X4NFN3_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
A0A018WYY7_SALET/76-240             ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
S5IDW3_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
F2FUB4_SALGL/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIPN--tp.............................................................
V3YQJ2_SALNE/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
X4X7M2_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
N0MNM5_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X5BV23_SALAB/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X3YVU5_SALEN/76-222                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQ------------------...............................................................
V0HK02_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
G5S9U0_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V1Q2U6_SALET/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQKASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQNT-p..............................................................
L6HX51_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
L6IVW6_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
U6VW34_SALTM/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A4LPF0_BURPE/85-245                 ..............irhfvdeavkqvahartpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
E8FDS1_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X5N358_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
A0A019A3Q8_SALET/86-250             ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAKNAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQNT-p..............................................................
W9FIE8_SALVI/76-240                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
G5LMV4_SALET/1-54                   ..................................----------------------------------------------------------.-.....-----.---------------.-----.--------------------------.-MFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
T2QFL4_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
I9M5K6_SALNE/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKHLQNAS...............................................................
X3DHV8_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
V1PG67_SALET/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
O58135_PYRHO/35-148                 .................enilgviywylfkqkys----------------------------------------------TRCRCCSELYIN.Q.....TNINP.YYFASACKLKKMGLP.VEIRN.SVFYYDGLEVYPTVIPYIAR-VIKYN.WQVFNMkgNPMISFT...------------------------------------------vknhdfkavllkgyegllq............................................
V1GXE9_SALHO/76-240                 ..................................AVLTNKIVKDFMLHKLNSLDIQGNASKDTAYARQTCEAMLSGVYSNNKDKYCNLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GETKN.DIFTPGGAGANPFVIPLIASASMTYP.HMFINH..SQQVSFK...AYAEKIIMKEVTPLFNERSMPTPQEFQLTVENIASKYLQDAS...............................................................
X4IUP3_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
V2KX57_SALET/86-250                 ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
E8A7J2_SALMO/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILAAVYSNNKDQCCKLLISK.G.....ISITP.FLKEIGEAAQNAGLP.GEMKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AHAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
A0A018NU73_SALET/76-240             ..................................AVLTNKVVKDFMLQTLNDIDIRGSASKDPAYASQTREAILSAVYSKNKDQCCNLLISK.G.....INIAP.FLQEIGEAAENAGLP.GTTKN.DVFTPSGAGANPFITPLISSANSKYP.RMFINQ..HQQASFK...IYAEKIIMTEVAPLFNECAMPTPQQFQLILENIANKYIQY--tp.............................................................
W8JRW9_BURPE/85-245                 ..............irhfvdeavkqvahartpei-------------------------RQDAEFGRQVYEATLCAIFSEAKDRFCMDPATR.A.....GNVRPaFIEALGDAARATGLP.GADKQ.GVFTPSGAGTNPLYTEIR--------.------..-------...------------------------------------------lradtlmgaelaarpeyrelqpyarqqaidlvanalpaersntlvefrqtvqtleatyrraaq
X3Q3P8_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
X4MWV1_SALEN/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....VSITP.FLKEIGEAAQNAELP.GEIKN.GVFTPGGAGANPFVVPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2NEZ5_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
N0I548_SALET/1-154                  ..................................-----------MLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVAFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
X2QYL4_SALEN/76-240                 ..................................AVLTNKVVKNFMLQTLHDIDIRGSASKDPAYASQTREAILSAVYSKYKDQYCNLLISK.G.....IDIAP.FLKEIGEAAQNAGLP.GATKN.DVFTPSGAGANPFITPLITSAYSKYP.HMFTSQ..HQKASFN...IYAEKIIMTEVVPLFNECAMPTPQQFQQILENIANKYIQNT-p..............................................................
S5HSP6_SALET/76-240                 ..................................AVLTSKTVKDFMLQKLNSLDIKGNASKDPAYARQTCEAMLSAVYSNNKDHCCKLLISK.G.....VSITP.FLKEIGEAAQNAGLP.GEIKN.GVFTPGGAGANPFVVPLIAAASIKYP.HMFINH..NQQVSFK...AYAEKIVMKEVTPLFNKGTMPTPQQFQLTIENIANKYLQNAS...............................................................
#=GC SS_cons                        ..............HHHHHHHHHHHHHHHCHHHHS--SCCCHHHHHHHHHHHHTHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC.T.....SSSHHHHHHHHHHHHHHTT-S.EEEET.TEEEETT-SS-TTHHHHHHHHHHH-H.HHHSSC..CHHHHHH...HHHHHHHHHHHGGGGTTSSS--HHHHHHHHHHHHHHHHCTT-HHHHHHHTTHHHHSCHHCC.SHHHHHHHHHHHHHTSTCHHHHHHHHHHHHHHHHHHHHHHHHH
#=GC seq_cons                       ..................................AVLTsKsVKDFMLQKLNSLDIKGNASKDPAYARQTCEAILSAVYSNNKDQCCKLLISK.G.....lSITP.FLKEIGEAAQNAGLP.GEhKN.GVFTPGGAGANPFVlPLIASASIKYP.HMFINH..NQQVSFK...AYAEKIlMKEVsPLFNcGoMPTPQQFQLTlENIANKYLQNAS...............................................................
//
DBGET integrated database retrieval system