GenomeNet

Database: Pfam
Entry: Spore_III_AB
LinkDB: Spore_III_AB
Original site: Spore_III_AB 
#=GF ID   Spore_III_AB
#=GF AC   PF09548.9
#=GF DE   Stage III sporulation protein AB (spore_III_AB)
#=GF PI   spore_III_AB; 
#=GF AU   TIGRFAMs, Coggill P
#=GF SE   TIGRFAMs
#=GF GA   29.00 29.00;
#=GF TC   30.10 29.70;
#=GF NC   28.60 27.30;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 26740544 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF DR   INTERPRO; IPR014198;
#=GF CC   SpoIIIAB represents the stage III sporulation protein AB, which
#=GF CC   is encoded in a spore formation operon: spoIIIAABCDEFGH that is
#=GF CC   under sigma G regulation [1]. A comparative genome analysis of
#=GF CC   all sequenced genomes of Firmicutes shows that the proteins are
#=GF CC   strictly conserved among the sub-set of endospore-forming
#=GF CC   species.
#=GF SQ   540
#=GS A0A0B0D633_9BACI/2-169    AC A0A0B0D633.1
#=GS A0A0C2V938_9BACL/2-171    AC A0A0C2V938.1
#=GS A0A168PC71_9BACL/3-172    AC A0A168PC71.1
#=GS R6GYS5_9FIRM/2-84         AC R6GYS5.1
#=GS E2ZIP5_9FIRM/6-154        AC E2ZIP5.1
#=GS R5GVQ0_9FIRM/2-162        AC R5GVQ0.1
#=GS E0ICJ9_9BACL/4-173        AC E0ICJ9.1
#=GS A0A167T7P6_9BACI/2-170    AC A0A167T7P6.1
#=GS L0K8Q9_HALHC/2-169        AC L0K8Q9.1
#=GS W7UEC7_RUMFL/4-167        AC W7UEC7.1
#=GS J9HBS4_9BACL/1-164        AC J9HBS4.1
#=GS R5AIK6_9FIRM/3-172        AC R5AIK6.1
#=GS A0A069DC30_9BACL/3-172    AC A0A069DC30.1
#=GS R6BL76_9FIRM/3-172        AC R6BL76.1
#=GS A0A150MMW2_9BACI/2-170    AC A0A150MMW2.1
#=GS U2NNS9_9CLOT/3-172        AC U2NNS9.1
#=GS R5TET5_9CLOT/3-174        AC R5TET5.1
#=GS T0DC70_ALIAG/3-171        AC T0DC70.1
#=GS A0A101HS62_9FIRM/109-233  AC A0A101HS62.1
#=GS B1CBV6_9FIRM/4-171        AC B1CBV6.1
#=GS A7GSL0_BACCN/3-171        AC A7GSL0.1
#=GS L7VLP1_CLOSH/1-123        AC L7VLP1.1
#=GS E5WIG1_9BACI/3-171        AC E5WIG1.1
#=GS R6C8V0_9CLOT/3-172        AC R6C8V0.1
#=GS A0A023DE21_9BACI/2-170    AC A0A023DE21.1
#=GS R6XSG3_9CLOT/5-169        AC R6XSG3.1
#=GS M1LTX3_9CLOT/3-172        AC M1LTX3.1
#=GS R5QAL0_9CLOT/5-169        AC R5QAL0.1
#=GS A0A140L8B7_9CLOT/3-172    AC A0A140L8B7.1
#=GS C4IL69_CLOBU/3-172        AC C4IL69.1
#=GS C0CY21_9FIRM/1-137        AC C0CY21.1
#=GS A0A0C1U6G9_9CLOT/3-172    AC A0A0C1U6G9.1
#=GS R7MAA7_9CLOT/5-169        AC R7MAA7.1
#=GS R5HAM8_9FIRM/3-183        AC R5HAM8.1
#=GS A0A0H3J7T1_CLOPA/3-171    AC A0A0H3J7T1.1
#=GS C0C3R2_9FIRM/3-130        AC C0C3R2.1
#=GS A0A0S2W520_9FIRM/3-171    AC A0A0S2W520.1
#=GS K0AX56_CLOA9/5-174        AC K0AX56.1
#=GS E6UIW0_RUMA7/4-157        AC E6UIW0.1
#=GS A0A117L867_9FIRM/3-172    AC A0A117L867.1
#=GS K8EK41_9FIRM/3-172        AC K8EK41.1
#=GS N1ZN83_9CLOT/4-173        AC N1ZN83.1
#=GS R6PVL4_9CLOT/3-172        AC R6PVL4.1
#=GS B2TRQ2_CLOBB/3-172        AC B2TRQ2.1
#=GS W1SJW1_9BACI/3-171        AC W1SJW1.1
#=GS A0A0A5GIE0_9BACI/2-170    AC A0A0A5GIE0.1
#=GS A0A0R3JUV2_9CLOT/4-173    AC A0A0R3JUV2.1
#=GS N0AW00_9BACI/3-171        AC N0AW00.1
#=GS R6R0I7_9FIRM/5-152        AC R6R0I7.1
#=GS F6DUB5_DESRL/3-172        AC F6DUB5.1
#=GS R7IEQ3_9FIRM/3-163        AC R7IEQ3.1
#=GS A0A0A2U025_9BACL/3-172    AC A0A0A2U025.1
#=GS R5YYR7_9FIRM/4-174        AC R5YYR7.1
#=GS A0A017S0N0_9CLOT/3-172    AC A0A017S0N0.1
#=GS R7C531_9CLOT/4-172        AC R7C531.1
#=GS A0A0E4CY64_9BACL/3-172    AC A0A0E4CY64.1
#=GS R5IDE5_9CLOT/4-176        AC R5IDE5.1
#=GS R6U904_9CLOT/1-144        AC R6U904.1
#=GS M9LIQ2_PAEPP/1-165        AC M9LIQ2.1
#=GS A0A0A2TZZ4_9FIRM/3-169    AC A0A0A2TZZ4.1
#=GS D4JTI1_9FIRM/7-167        AC D4JTI1.1
#=GS A0A165XSA1_9BACI/2-170    AC A0A165XSA1.1
#=GS Q97HC0_CLOAB/3-172        AC Q97HC0.1
#=GS U5LFJ2_9BACI/3-171        AC U5LFJ2.1
#=GS R5FJL2_9FIRM/3-166        AC R5FJL2.1
#=GS D4K6A0_9FIRM/74-154       AC D4K6A0.1
#=GS W0EEB0_9FIRM/3-169        AC W0EEB0.1
#=GS R6WPP3_9CLOT/4-166        AC R6WPP3.1
#=GS A0A0K9GWW6_9BACI/3-171    AC A0A0K9GWW6.1
#=GS R6P931_9FIRM/4-171        AC R6P931.1
#=GS A0A0A2TUI0_9BACI/2-170    AC A0A0A2TUI0.1
#=GS A0A0M2PRE6_9BACI/3-171    AC A0A0M2PRE6.1
#=GS A0A0X8D1H7_9BACL/3-172    AC A0A0X8D1H7.1
#=GS C0GE42_9FIRM/4-174        AC C0GE42.1
#=GS R5A8B3_9CLOT/1-129        AC R5A8B3.1
#=GS D9R8Q1_CLOSW/7-176        AC D9R8Q1.1
#=GS C4ZD12_AGARV/5-141        AC C4ZD12.1
#=GS F6B9Z4_DESCC/3-172        AC F6B9Z4.1
#=GS R6GQG8_9CLOT/3-172        AC R6GQG8.1
#=GS D4KWV7_9FIRM/3-172        AC D4KWV7.1
#=GS R5AL47_9CLOT/3-171        AC R5AL47.1
#=GS R7QX72_9FIRM/3-172        AC R7QX72.1
#=GS A0A0V8JFA8_9BACI/2-170    AC A0A0V8JFA8.1
#=GS A0A077J4C1_9BACI/3-171    AC A0A077J4C1.1
#=GS A0A075JPU8_9BACI/3-170    AC A0A075JPU8.1
#=GS SP3AB_BACSU/3-171         AC Q01368.2
#=GS M1ZDJ3_9FIRM/5-174        AC M1ZDJ3.1
#=GS A0A0Q4RBD3_9BACL/3-172    AC A0A0Q4RBD3.1
#=GS S0IZ63_9FIRM/3-171        AC S0IZ63.1
#=GS A0A0U1QS70_9BACL/3-171    AC A0A0U1QS70.1
#=GS A0A037Z5R5_CLOTT/3-172    AC A0A037Z5R5.1
#=GS F0Z5K1_9CLOT/1-162        AC F0Z5K1.1
#=GS R6N5J7_9CLOT/1-160        AC R6N5J7.1
#=GS X5A1K0_9BACL/3-172        AC X5A1K0.1
#=GS A0A081NWL7_9BACL/3-172    AC A0A081NWL7.1
#=GS R6RFZ5_9CLOT/2-178        AC R6RFZ5.1
#=GS F6CL76_DESK7/3-172        AC F6CL76.1
#=GS G9RYK2_9FIRM/7-173        AC G9RYK2.1
#=GS A8FF26_BACP2/3-171        AC A8FF26.1
#=GS A0A0F2Q9S8_9CLOT/3-172    AC A0A0F2Q9S8.1
#=GS A5N7I0_CLOK5/3-172        AC A5N7I0.1
#=GS R9KYS4_9FIRM/4-172        AC R9KYS4.1
#=GS A0A154BUQ1_9FIRM/4-173    AC A0A154BUQ1.1
#=GS A0A090J2B4_9BACI/3-171    AC A0A090J2B4.1
#=GS U2K974_9FIRM/3-167        AC U2K974.1
#=GS R7K6U9_9FIRM/2-155        AC R7K6U9.1
#=GS R6IBL3_9FIRM/1-144        AC R6IBL3.1
#=GS C6LAC8_9FIRM/3-172        AC C6LAC8.1
#=GS F3BA03_9FIRM/3-172        AC F3BA03.1
#=GS A0A0P9D188_9BACL/3-171    AC A0A0P9D188.1
#=GS D4LX74_9FIRM/3-172        AC D4LX74.1
#=GS A0A0B7MGY8_9FIRM/21-190   AC A0A0B7MGY8.1
#=GS A0A0C2VIP5_9BACL/3-170    AC A0A0C2VIP5.1
#=GS A0A075LK92_9BACI/2-170    AC A0A075LK92.1
#=GS R6GD52_9FIRM/3-78         AC R6GD52.1
#=GS R7F5R2_9CLOT/5-169        AC R7F5R2.1
#=GS W7YMS9_9BACL/3-172        AC W7YMS9.1
#=GS C6CU13_PAESJ/3-172        AC C6CU13.1
#=GS A0A0A5GCC5_9BACI/2-170    AC A0A0A5GCC5.1
#=GS I3EAC8_BACMT/3-171        AC I3EAC8.1
#=GS R6RT95_9CLOT/4-169        AC R6RT95.1
#=GS F7KQ68_9FIRM/6-175        AC F7KQ68.1
#=GS A4XLD1_CALS8/8-165        AC A4XLD1.2
#=GS R5D5P6_9FIRM/3-172        AC R5D5P6.1
#=GS R6U276_9CLOT/5-172        AC R6U276.1
#=GS L0EE69_THECK/3-171        AC L0EE69.1
#=GS A0A0N0Z5S2_9BACI/2-170    AC A0A0N0Z5S2.1
#=GS A0A0Q9XTR0_9BACI/3-171    AC A0A0Q9XTR0.1
#=GS R6R0H1_9FIRM/3-172        AC R6R0H1.1
#=GS Q81M39_BACAN/3-171        AC Q81M39.1
#=GS R9K4S0_9FIRM/3-172        AC R9K4S0.1
#=GS R7EXW3_9FIRM/28-183       AC R7EXW3.1
#=GS J7IMK2_DESMD/3-169        AC J7IMK2.1
#=GS R6EWM6_9FIRM/1-169        AC R6EWM6.1
#=GS B1B9A5_CLOBO/4-173        AC B1B9A5.1
#=GS A6CTX3_9BACI/3-171        AC A6CTX3.1
#=GS R5IB37_9FIRM/2-171        AC R5IB37.1
#=GS A0A124FSU4_9FIRM/3-172    AC A0A124FSU4.1
#=GS N2A3Q5_9FIRM/3-172        AC N2A3Q5.1
#=GS C5EH42_9FIRM/4-176        AC C5EH42.1
#=GS R7AJV0_9BACE/7-177        AC R7AJV0.1
#=GS K6DTD6_BACAZ/2-170        AC K6DTD6.1
#=GS A0A0C2UJ52_BACBA/2-170    AC A0A0C2UJ52.1
#=GS A0A0F2JJL8_9FIRM/3-169    AC A0A0F2JJL8.1
#=GS R6GSG0_9CLOT/1-137        AC R6GSG0.1
#=GS D9SLF2_CLOC7/3-172        AC D9SLF2.1
#=GS A0A0A6VCG9_9BACI/3-171    AC A0A0A6VCG9.1
#=GS D3E6K9_GEOS4/3-172        AC D3E6K9.1
#=GS R5Q3H4_9FIRM/3-167        AC R5Q3H4.1
#=GS R7KC87_9FIRM/4-157        AC R7KC87.1
#=GS R9MDR4_9FIRM/4-173        AC R9MDR4.1
#=GS D7GUK4_9FIRM/2-178        AC D7GUK4.1
#=GS R5TLB9_9FIRM/3-172        AC R5TLB9.1
#=GS V2YJE5_9FIRM/3-169        AC V2YJE5.1
#=GS A0A0A5GHD2_9BACI/2-170    AC A0A0A5GHD2.1
#=GS R5N5V5_9CLOT/5-169        AC R5N5V5.1
#=GS C8WXI3_ALIAD/2-170        AC C8WXI3.1
#=GS D3ACR7_9CLOT/7-176        AC D3ACR7.1
#=GS R6N725_9CLOT/5-169        AC R6N725.1
#=GS R7BI57_9FIRM/5-177        AC R7BI57.1
#=GS C2X2E4_BACCE/1-164        AC C2X2E4.1
#=GS R9JDC7_9FIRM/3-172        AC R9JDC7.1
#=GS G7M110_9CLOT/3-172        AC G7M110.1
#=GS B5CM47_9FIRM/3-172        AC B5CM47.1
#=GS A0A089L3U1_9BACL/3-172    AC A0A089L3U1.1
#=GS V6IV93_9BACL/3-171        AC V6IV93.1
#=GS Q2RI95_MOOTA/3-172        AC Q2RI95.1
#=GS A0A0P6WU63_9BACI/3-171    AC A0A0P6WU63.1
#=GS R6CNW8_9FIRM/3-160        AC R6CNW8.1
#=GS A9KMD0_CLOPH/7-176        AC A9KMD0.1
#=GS A0A078KSP3_9FIRM/4-171    AC A0A078KSP3.1
#=GS A0A167UDW1_9BACI/2-170    AC A0A167UDW1.1
#=GS R6TCG4_9FIRM/3-165        AC R6TCG4.1
#=GS A0A101WDJ5_9FIRM/14-183   AC A0A101WDJ5.1
#=GS R6Z5K6_9CLOT/4-173        AC R6Z5K6.1
#=GS W4PYN7_9BACI/2-131        AC W4PYN7.1
#=GS A0A0M5JFD2_9BACI/3-171    AC A0A0M5JFD2.1
#=GS D5DS81_BACMQ/2-170        AC D5DS81.1
#=GS A0A0M0GNQ1_9BACI/3-171    AC A0A0M0GNQ1.1
#=GS R7GUZ7_9FIRM/2-166        AC R7GUZ7.1
#=GS R7BSC6_9FIRM/6-166        AC R7BSC6.1
#=GS G7W852_DESOD/3-169        AC G7W852.1
#=GS E7GNS0_CLOSY/4-173        AC E7GNS0.1
#=GS R5N3Z3_9FIRM/1-102        AC R5N3Z3.1
#=GS A3DDQ0_CLOTH/4-173        AC A3DDQ0.1
#=GS S6FMM2_9CLOT/1-134        AC S6FMM2.1
#=GS C8W107_DESAS/3-172        AC C8W107.1
#=GS R9M6D8_9FIRM/3-165        AC R9M6D8.1
#=GS A0A0C2R6T6_9BACL/4-171    AC A0A0C2R6T6.1
#=GS A0A101WSY3_9FIRM/2-169    AC A0A101WSY3.1
#=GS A0A0M1UYE2_CLOSO/4-173    AC A0A0M1UYE2.1
#=GS A1HQ77_9FIRM/4-173        AC A1HQ77.1
#=GS F4A170_MAHA5/4-173        AC F4A170.1
#=GS R6GDG8_9FIRM/4-172        AC R6GDG8.1
#=GS R7HEM6_9FIRM/3-173        AC R7HEM6.1
#=GS R6TB59_9FIRM/3-162        AC R6TB59.1
#=GS K4LIS2_THEPS/22-190       AC K4LIS2.1
#=GS A0A0Q9RAB7_9BACL/3-172    AC A0A0Q9RAB7.1
#=GS R5KKD4_9CLOT/5-156        AC R5KKD4.1
#=GS F8I9H1_SULAT/5-169        AC F8I9H1.1
#=GS A0A098F2A5_9BACI/3-171    AC A0A098F2A5.1
#=GS A0A0M1NX35_9BACI/3-171    AC A0A0M1NX35.1
#=GS A0A101HYG4_9FIRM/3-172    AC A0A101HYG4.1
#=GS A0A073KBB5_9BACI/3-171    AC A0A073KBB5.1
#=GS R6ERA2_9FIRM/3-171        AC R6ERA2.1
#=GS R9IWS1_9FIRM/3-170        AC R9IWS1.1
#=GS R5IGU5_9FIRM/1-147        AC R5IGU5.1
#=GS B0K9D1_THEP3/2-170        AC B0K9D1.1
#=GS M8EE36_9BACL/3-172        AC M8EE36.1
#=GS R6R314_9FIRM/4-172        AC R6R314.1
#=GS W4V483_9FIRM/4-173        AC W4V483.1
#=GS F4XAH5_9FIRM/3-169        AC F4XAH5.1
#=GS C6PQS6_9CLOT/3-172        AC C6PQS6.1
#=GS R7R618_9FIRM/4-173        AC R7R618.1
#=GS A0A0A7FV67_9CLOT/3-172    AC A0A0A7FV67.1
#=GS T0E9B9_CLOSO/4-173        AC T0E9B9.1
#=GS R6XGN9_9CLOT/5-169        AC R6XGN9.1
#=GS H3SFE1_9BACL/3-174        AC H3SFE1.1
#=GS D7CKG4_SYNLT/7-176        AC D7CKG4.1
#=GS A0A0U2UZU1_9BACL/3-172    AC A0A0U2UZU1.1
#=GS R7RPT6_9CLOT/3-172        AC R7RPT6.1
#=GS R6H489_9CLOT/5-169        AC R6H489.1
#=GS A0A167DHF1_9BACL/3-172    AC A0A167DHF1.1
#=GS R5Y419_9CLOT/4-173        AC R5Y419.1
#=GS R5QH78_9FIRM/3-172        AC R5QH78.1
#=GS R6NPU3_9CLOT/3-170        AC R6NPU3.1
#=GS R7DBE8_9FIRM/3-172        AC R7DBE8.1
#=GS R5CZB5_9FIRM/2-169        AC R5CZB5.1
#=GS A0A0Q9MVZ6_9BACL/3-172    AC A0A0Q9MVZ6.1
#=GS R5UPW6_9FIRM/3-171        AC R5UPW6.1
#=GS D4LE91_RUMC1/3-165        AC D4LE91.1
#=GS A0A176U8T1_9FIRM/2-169    AC A0A176U8T1.1
#=GS W4CUC3_9BACL/3-172        AC W4CUC3.1
#=GS R6DUA5_9CLOT/3-171        AC R6DUA5.1
#=GS G2G096_9FIRM/3-169        AC G2G096.1
#=GS B1I3A8_DESAP/3-172        AC B1I3A8.1
#=GS R4KFS4_9FIRM/3-172        AC R4KFS4.1
#=GS A0A0Q3VZA5_9BACI/2-170    AC A0A0Q3VZA5.1
#=GS R6YYS9_9CLOT/10-174       AC R6YYS9.1
#=GS D9QRW5_ACEAZ/3-172        AC D9QRW5.1
#=GS H5XSI9_9FIRM/3-169        AC H5XSI9.1
#=GS A0A0K0GEY4_9FIRM/2-170    AC A0A0K0GEY4.1
#=GS G2TPR1_BACCO/3-171        AC G2TPR1.1
#=GS K4L1Q4_9FIRM/3-169        AC K4L1Q4.1
#=GS E3E4Y7_PAEPS/3-172        AC E3E4Y7.1
#=GS R5UCV0_9FIRM/3-172        AC R5UCV0.1
#=GS A0A0J1IMF3_BACCI/3-171    AC A0A0J1IMF3.1
#=GS R6DM84_9FIRM/3-171        AC R6DM84.1
#=GS A0A090ZHB4_PAEMA/1-169    AC A0A090ZHB4.1
#=GS W4VDH6_9BACI/2-170        AC W4VDH6.1
#=GS D3FUV9_BACPE/2-170        AC D3FUV9.1
#=GS R7A1H9_9FIRM/3-170        AC R7A1H9.1
#=GS A0A135L2V1_9BACI/3-172    AC A0A135L2V1.1
#=GS B7GHE8_ANOFW/2-170        AC B7GHE8.1
#=GS A0A0U4FQC6_9BACI/2-170    AC A0A0U4FQC6.1
#=GS A4J3D9_DESRM/3-172        AC A4J3D9.1
#=GS R5WDN8_9FIRM/2-78         AC R5WDN8.1
#=GS R5DH03_9FIRM/5-160        AC R5DH03.1
#=GS R6LMJ0_9FIRM/3-172        AC R6LMJ0.1
#=GS R6TRE8_9FIRM/3-160        AC R6TRE8.1
#=GS R7L7Y5_9CLOT/5-169        AC R7L7Y5.1
#=GS A0A015KSE5_9BACL/3-172    AC A0A015KSE5.1
#=GS K6DNH1_9BACI/3-171        AC K6DNH1.1
#=GS A0A136WF36_9FIRM/16-184   AC A0A136WF36.1
#=GS A0A098M7F6_9BACL/3-172    AC A0A098M7F6.1
#=GS A0A117LJ88_9FIRM/3-152    AC A0A117LJ88.1
#=GS A8MFK1_ALKOO/4-173        AC A8MFK1.1
#=GS R5Y7F5_9CLOT/5-157        AC R5Y7F5.1
#=GS R5ASR1_9FIRM/1-70         AC R5ASR1.1
#=GS A0A0A8X7W1_9BACI/1-125    AC A0A0A8X7W1.1
#=GS R6PFL3_9FIRM/3-172        AC R6PFL3.1
#=GS A5Z6N6_9FIRM/4-173        AC A5Z6N6.1
#=GS R6MSD6_9CLOT/1-156        AC R6MSD6.1
#=GS A0A0Q9YD19_9BACI/3-171    AC A0A0Q9YD19.1
#=GS A0A0M2U9Y5_9FIRM/3-172    AC A0A0M2U9Y5.1
#=GS Q3AAK9_CARHZ/4-167        AC Q3AAK9.1
#=GS A0A060M3B6_9BACI/2-170    AC A0A060M3B6.1
#=GS K0J3W9_AMPXN/2-169        AC K0J3W9.1
#=GS A0A0D3V885_9BACL/3-172    AC A0A0D3V885.1
#=GS A0A0A1MFD3_9BACI/2-170    AC A0A0A1MFD3.1
#=GS A0A101V9N0_9FIRM/4-173    AC A0A101V9N0.1
#=GS R5F3J4_9CLOT/5-177        AC R5F3J4.1
#=GS K4ZMZ1_PAEAL/14-185       AC K4ZMZ1.1
#=GS R5YCP8_9FIRM/3-171        AC R5YCP8.1
#=GS R7CGF4_9FIRM/3-172        AC R7CGF4.1
#=GS R5L5F8_9FIRM/4-170        AC R5L5F8.1
#=GS A0A0B0IE10_9BACI/2-170    AC A0A0B0IE10.1
#=GS D5WV73_KYRT2/5-174        AC D5WV73.1
#=GS A0A0M0XBK6_9BACI/3-171    AC A0A0M0XBK6.1
#=GS A0A0U1L402_9FIRM/4-172    AC A0A0U1L402.1
#=GS L1QH30_9CLOT/1-98         AC L1QH30.1
#=GS A0A0J5R0M7_9BACI/3-171    AC A0A0J5R0M7.1
#=GS C2WBX9_BACCE/1-159        AC C2WBX9.1
#=GS A0A176JBA0_9BACI/3-171    AC A0A176JBA0.1
#=GS A0A0H4KML3_9BACI/2-170    AC A0A0H4KML3.1
#=GS Q18B53_PEPD6/4-173        AC Q18B53.1
#=GS L5N846_9BACI/1-130        AC L5N846.1
#=GS F7NJX1_9FIRM/4-173        AC F7NJX1.1
#=GS A0A0D0QSM5_9FIRM/3-172    AC A0A0D0QSM5.1
#=GS B2A544_NATTJ/3-171        AC B2A544.1
#=GS A0A096BKX4_9CLOT/5-174    AC A0A096BKX4.1
#=GS R7ANQ8_9CLOT/4-98         AC R7ANQ8.1
#=GS A0A0D5NQ32_9BACL/3-172    AC A0A0D5NQ32.1
#=GS F5LLP7_9BACL/4-173        AC F5LLP7.1
#=GS U2CHG5_9CLOT/3-172        AC U2CHG5.1
#=GS R6QGT5_9FIRM/35-140       AC R6QGT5.1
#=GS A0A0A2UUG9_9BACI/2-170    AC A0A0A2UUG9.1
#=GS R6S2Z2_9FIRM/3-172        AC R6S2Z2.1
#=GS A0A024P6N4_9BACI/2-169    AC A0A024P6N4.1
#=GS R5E6Z4_9CLOT/6-130        AC R5E6Z4.1
#=GS R5JZC4_9CLOT/8-177        AC R5JZC4.1
#=GS A0A0H4P1T1_9BACI/2-170    AC A0A0H4P1T1.1
#=GS C7H7R4_9FIRM/5-151        AC C7H7R4.1
#=GS R6RQG1_9FIRM/6-175        AC R6RQG1.1
#=GS E6U545_ETHHY/1-162        AC E6U545.1
#=GS R5B586_9CLOT/4-166        AC R5B586.1
#=GS R6EGF6_9FIRM/2-166        AC R6EGF6.1
#=GS G9YNK0_9FIRM/3-170        AC G9YNK0.1
#=GS V9WA33_9BACL/3-171        AC V9WA33.1
#=GS A0A099SAC4_9CLOT/3-172    AC A0A099SAC4.1
#=GS R7A9L2_9CLOT/1-70         AC R7A9L2.1
#=GS R5V793_9FIRM/3-166        AC R5V793.1
#=GS R5R841_9FIRM/2-169        AC R5R841.1
#=GS A0A0N0E9T5_9BACI/3-171    AC A0A0N0E9T5.1
#=GS Q67N97_SYMTH/4-173        AC Q67N97.1
#=GS R7JTR0_9FIRM/2-171        AC R7JTR0.1
#=GS A0A0V8HMH3_9BACI/3-171    AC A0A0V8HMH3.1
#=GS D9RXK2_THEOJ/4-173        AC D9RXK2.1
#=GS R5AZ05_9FIRM/5-70         AC R5AZ05.1
#=GS R7IT11_9FIRM/2-171        AC R7IT11.1
#=GS H6NL71_9BACL/3-172        AC H6NL71.1
#=GS I3VWP6_THESW/3-171        AC I3VWP6.1
#=GS A0A0M2SKV4_9BACI/3-171    AC A0A0M2SKV4.1
#=GS R6LSA2_9FIRM/3-176        AC R6LSA2.1
#=GS A0A0B0HQ00_9BACI/2-170    AC A0A0B0HQ00.1
#=GS A0A0D6ZBK8_9BACI/3-171    AC A0A0D6ZBK8.1
#=GS W6N4G6_CLOTY/1-164        AC W6N4G6.1
#=GS A0A089LXB1_9BACL/3-172    AC A0A089LXB1.1
#=GS R5E180_9FIRM/5-176        AC R5E180.1
#=GS A0A0F5IBG9_9BACI/2-170    AC A0A0F5IBG9.1
#=GS D5X7K6_THEPJ/3-172        AC D5X7K6.1
#=GS A0A084JIU9_9CLOT/3-172    AC A0A084JIU9.1
#=GS A0A0F5QZR3_9BACL/3-172    AC A0A0F5QZR3.1
#=GS R6GID0_9FIRM/4-161        AC R6GID0.1
#=GS E9SG86_RUMAL/3-157        AC E9SG86.1
#=GS A0A0F2PIV7_9FIRM/3-172    AC A0A0F2PIV7.1
#=GS R6WDE6_9FIRM/2-161        AC R6WDE6.1
#=GS U2F5J4_CLOS4/3-169        AC U2F5J4.1
#=GS Q65HH7_BACLD/3-171        AC Q65HH7.1
#=GS R9KHS6_9FIRM/3-171        AC R9KHS6.1
#=GS C6J3S9_9BACL/3-172        AC C6J3S9.1
#=GS R6M5Z4_9FIRM/3-163        AC R6M5Z4.1
#=GS R9N9R6_9FIRM/4-173        AC R9N9R6.1
#=GS F4LVG6_TEPAE/4-173        AC F4LVG6.1
#=GS G2SX17_ROSHA/3-172        AC G2SX17.1
#=GS A0A124IJ98_9FIRM/3-169    AC A0A124IJ98.1
#=GS Q8XJC8_CLOPE/2-171        AC Q8XJC8.1
#=GS A0A0P8WAD1_9CLOT/3-172    AC A0A0P8WAD1.1
#=GS A0A0D8IDS1_9CLOT/4-173    AC A0A0D8IDS1.1
#=GS R5BU12_9FIRM/3-172        AC R5BU12.1
#=GS R6LJ97_9FIRM/4-172        AC R6LJ97.1
#=GS V9G432_9BACL/3-172        AC V9G432.1
#=GS A0A0V8JNA7_9BACI/2-170    AC A0A0V8JNA7.1
#=GS R6KNG9_9CLOT/5-177        AC R6KNG9.1
#=GS A0A101XSK2_9BACL/1-168    AC A0A101XSK2.1
#=GS R6N2U0_9FIRM/6-167        AC R6N2U0.1
#=GS U2CLD4_9FIRM/3-172        AC U2CLD4.1
#=GS A0A024QBV3_9BACI/2-170    AC A0A024QBV3.1
#=GS B8D2E8_HALOH/4-173        AC B8D2E8.1
#=GS A0A0J1FD49_9FIRM/3-169    AC A0A0J1FD49.1
#=GS Q8EQ30_OCEIH/2-170        AC Q8EQ30.1
#=GS A0A0F0C844_9CLOT/4-176    AC A0A0F0C844.1
#=GS C0EFZ6_9FIRM/3-167        AC C0EFZ6.1
#=GS A0A172TM17_9BACL/3-171    AC A0A172TM17.1
#=GS F9VKT2_ARTSS/2-170        AC F9VKT2.1
#=GS A0A160IQ00_9BACI/3-171    AC A0A160IQ00.1
#=GS A0A124FZH2_9FIRM/1-154    AC A0A124FZH2.1
#=GS A0A150Y9B9_9FIRM/4-177    AC A0A150Y9B9.1
#=GS A0A0B0HV75_9BACL/3-172    AC A0A0B0HV75.1
#=GS R7K2T2_9CLOT/9-177        AC R7K2T2.1
#=GS R6AIN6_9CLOT/3-164        AC R6AIN6.1
#=GS R6QZU0_9FIRM/3-172        AC R6QZU0.1
#=GS R6K031_9FIRM/3-175        AC R6K031.1
#=GS G5IBS7_9CLOT/4-173        AC G5IBS7.1
#=GS A0A0E4C8J6_9FIRM/5-174    AC A0A0E4C8J6.1
#=GS A0A0V8QFX1_9FIRM/3-175    AC A0A0V8QFX1.1
#=GS A0A132NC42_BACSC/1-157    AC A0A132NC42.1
#=GS R7G1Y7_9FIRM/1-164        AC R7G1Y7.1
#=GS A0A150M796_9BACI/3-171    AC A0A150M796.1
#=GS A6NV03_9FIRM/3-170        AC A6NV03.1
#=GS X0R4D8_9BACI/2-170        AC X0R4D8.1
#=GS R5JGP9_9FIRM/1-168        AC R5JGP9.1
#=GS Q818Q4_BACCR/10-168       AC Q818Q4.1
#=GS A0A094JM94_9BACL/3-172    AC A0A094JM94.1
#=GS E6SL65_THEM7/3-171        AC E6SL65.1
#=GS R5LF31_9CLOT/5-172        AC R5LF31.1
#=GS A6LU35_CLOB8/3-172        AC A6LU35.1
#=GS F0T0S3_SYNGF/3-169        AC F0T0S3.1
#=GS A0A0K8JJI7_9FIRM/4-173    AC A0A0K8JJI7.1
#=GS C0CY20_9FIRM/4-40         AC C0CY20.1
#=GS R7C103_9FIRM/3-172        AC R7C103.1
#=GS R4KAY4_CLOPA/3-171        AC R4KAY4.1
#=GS A0A162URE0_9CLOT/3-172    AC A0A162URE0.1
#=GS V9H3G9_9CLOT/3-172        AC V9H3G9.1
#=GS A0A0M2VMT7_9BACL/3-172    AC A0A0M2VMT7.1
#=GS A0A0Q9LRZ7_9BACL/3-172    AC A0A0Q9LRZ7.1
#=GS B0PBE3_9FIRM/2-166        AC B0PBE3.1
#=GS T0PFZ4_9CLOT/3-172        AC T0PFZ4.1
#=GS B0TEH5_HELMI/3-172        AC B0TEH5.1
#=GS R5P7W4_9FIRM/3-172        AC R5P7W4.1
#=GS I0JNW2_HALH3/2-169        AC I0JNW2.1
#=GS R8W8I6_9CLOT/5-173        AC R8W8I6.1
#=GS R6ICS7_9FIRM/2-169        AC R6ICS7.1
#=GS B8I3C0_CLOCE/4-172        AC B8I3C0.1
#=GS Q894F9_CLOTE/4-173        AC Q894F9.1
#=GS A0A117KYG3_9THEO/2-171    AC A0A117KYG3.1
#=GS A0A061NV86_9BACL/2-170    AC A0A061NV86.1
#=GS R5T8Q3_9CLOT/7-176        AC R5T8Q3.1
#=GS R6JN57_9CLOT/1-147        AC R6JN57.1
#=GS R7GAR3_9CLOT/5-119        AC R7GAR3.1
#=GS R5XPI3_9FIRM/3-172        AC R5XPI3.1
#=GS W7YYL3_9BACI/2-170        AC W7YYL3.1
#=GS R5ECS1_9FIRM/4-170        AC R5ECS1.1
#=GS R7FH89_9CLOT/5-123        AC R7FH89.1
#=GS A0A0M0KYS1_9BACI/2-170    AC A0A0M0KYS1.1
#=GS A0A0N0YD81_THEVU/2-171    AC A0A0N0YD81.1
#=GS A0Q091_CLONN/4-173        AC A0Q091.1
#=GS R7FQQ8_9FIRM/2-167        AC R7FQQ8.1
#=GS L0F7P7_DESDL/3-169        AC L0F7P7.1
#=GS J1H3U7_9CLOT/1-146        AC J1H3U7.1
#=GS Q5KX94_GEOKA/2-170        AC Q5KX94.1
#=GS R5LXU5_9FIRM/1-158        AC R5LXU5.1
#=GS R6EIE9_9FIRM/1-164        AC R6EIE9.1
#=GS M1ZJT6_9FIRM/98-266       AC M1ZJT6.1
#=GS R7I7Q5_9CLOT/3-172        AC R7I7Q5.1
#=GS A0A0L0W7F4_CLOPU/5-174    AC A0A0L0W7F4.1
#=GS F5SB01_9BACL/3-172        AC F5SB01.1
#=GS A0A084GWE3_9BACI/3-171    AC A0A084GWE3.1
#=GS R6ZUU8_9FIRM/4-173        AC R6ZUU8.1
#=GS E6TXN9_BACCJ/2-170        AC E6TXN9.1
#=GS R5PDC9_9CLOT/1-166        AC R5PDC9.1
#=GS R5HGP6_9FIRM/4-169        AC R5HGP6.1
#=GS R5VM52_9CLOT/3-170        AC R5VM52.1
#=GS A0A151AQ92_9CLOT/22-191   AC A0A151AQ92.1
#=GS N4WWI6_9BACI/2-170        AC N4WWI6.1
#=GS A6TR28_ALKMQ/4-173        AC A6TR28.1
#=GS Q8RAD9_CALS4/2-170        AC Q8RAD9.1
#=GS R7ISW6_9CLOT/6-170        AC R7ISW6.1
#=GS R5RJJ1_9FIRM/3-172        AC R5RJJ1.1
#=GS R7FEP9_9FIRM/3-167        AC R7FEP9.1
#=GS I8J694_9BACI/4-171        AC I8J694.1
#=GS D4J409_9FIRM/1-138        AC D4J409.1
#=GS F3AI40_9FIRM/4-173        AC F3AI40.1
#=GS R5TCB0_9CLOT/5-172        AC R5TCB0.1
#=GS A0A0D1XUH5_ANEMI/3-172    AC A0A0D1XUH5.1
#=GS A0A151B703_9CLOT/3-172    AC A0A151B703.1
#=GS A0A0C7NK31_9THEO/3-172    AC A0A0C7NK31.1
#=GS A0A0J1GC07_9FIRM/3-172    AC A0A0J1GC07.1
#=GS A5I318_CLOBH/3-172        AC A5I318.1
#=GS A0A074LPW3_9BACL/3-172    AC A0A074LPW3.1
#=GS A0A0L0QPG1_VIRPA/3-170    AC A0A0L0QPG1.1
#=GS R6G6F9_9FIRM/3-172        AC R6G6F9.1
#=GS A0A0F2SK18_9FIRM/3-169    AC A0A0F2SK18.1
#=GS A0A0J6FU45_9BACI/2-170    AC A0A0J6FU45.1
#=GS R6DUF9_9FIRM/4-160        AC R6DUF9.1
#=GS A0A140LC95_9THEO/3-172    AC A0A140LC95.1
#=GS A0A094WJF3_BACAO/10-178   AC A0A094WJF3.1
#=GS N9Y2A4_9CLOT/3-172        AC N9Y2A4.1
#=GS R7KYP0_9FIRM/3-173        AC R7KYP0.1
#=GS C0ZBZ1_BREBN/3-172        AC C0ZBZ1.1
#=GS A0A085L6A9_9FIRM/3-172    AC A0A085L6A9.1
#=GS R7NNJ7_9FIRM/1-133        AC R7NNJ7.1
#=GS R6GNP4_9FIRM/6-157        AC R6GNP4.1
#=GS Q24UX9_DESHY/3-169        AC Q24UX9.1
#=GS A0A0B3VWT7_9FIRM/4-173    AC A0A0B3VWT7.1
#=GS U5MT08_CLOSA/3-172        AC U5MT08.1
#=GS R1ASY0_9CLOT/5-174        AC R1ASY0.1
#=GS R5HZJ8_9FIRM/3-172        AC R5HZJ8.1
#=GS U5RXC4_9CLOT/3-172        AC U5RXC4.1
#=GS A0A0U2L054_9BACL/3-172    AC A0A0U2L054.1
#=GS A0A117KX88_9FIRM/1-161    AC A0A117KX88.1
#=GS R5Y7U2_9FIRM/2-153        AC R5Y7U2.1
#=GS A0A0C2UP39_9BACL/3-175    AC A0A0C2UP39.1
#=GS S0FJJ5_9FIRM/4-172        AC S0FJJ5.1
#=GS R6XJJ5_9FIRM/3-172        AC R6XJJ5.1
#=GS C5D483_GEOSW/2-170        AC C5D483.1
#=GS I4D8X5_DESAJ/3-169        AC I4D8X5.1
#=GS A0A0K2SMU5_9FIRM/4-171    AC A0A0K2SMU5.1
#=GS A0A0Q3THZ2_9BACI/3-171    AC A0A0Q3THZ2.1
#=GS G4KPT5_OSCVS/2-164        AC G4KPT5.1
#=GS R5WWV3_9FIRM/3-172        AC R5WWV3.1
#=GS W6S2T8_9CLOT/4-171        AC W6S2T8.1
#=GS A0A0K9GAL6_9BACI/3-171    AC A0A0K9GAL6.1
#=GS R5Z1B3_9CLOT/5-169        AC R5Z1B3.1
#=GS A0A150KLN0_9BACI/4-171    AC A0A150KLN0.1
#=GS Q5WF48_BACSK/2-170        AC Q5WF48.1
#=GS U2SH45_9FIRM/3-165        AC U2SH45.1
#=GS Q0AZG9_SYNWW/5-174        AC Q0AZG9.1
#=GS A0A177L048_9BACL/2-170    AC A0A177L048.1
#=GS S2KVU5_9FIRM/3-172        AC S2KVU5.1
#=GS W9AG63_9BACI/2-170        AC W9AG63.1
#=GS A0A147K7R9_9BACI/3-171    AC A0A147K7R9.1
#=GS R7N9T8_9FIRM/3-173        AC R7N9T8.1
#=GS R6P608_9FIRM/3-172        AC R6P608.1
#=GS R9N4J9_9FIRM/3-171        AC R9N4J9.1
#=GS R9M0Z1_9FIRM/7-172        AC R9M0Z1.1
#=GS A0A139CXH0_9FIRM/3-172    AC A0A139CXH0.1
#=GS C9R8Z9_AMMDK/3-172        AC C9R8Z9.1
#=GS R5NHY8_9FIRM/3-172        AC R5NHY8.1
#=GS R7N2Y4_9FIRM/4-171        AC R7N2Y4.1
#=GS A0A117LJE9_9FIRM/1-154    AC A0A117LJE9.1
#=GS A0A0X8VB18_CLOPR/5-173    AC A0A0X8VB18.1
#=GS A0A0F2PSX6_9FIRM/3-172    AC A0A0F2PSX6.1
#=GS A0A075R476_BRELA/3-172    AC A0A075R476.1
#=GS A5D344_PELTS/3-172        AC A5D344.1
#=GS I7LKN7_9CLOT/3-172        AC I7LKN7.1
#=GS Q9K954_BACHD/2-170        AC Q9K954.1
#=GS V6MD78_9BACL/3-172        AC V6MD78.1
#=GS G8LWK3_CLOCD/4-171        AC G8LWK3.1
#=GS D4LPN5_9FIRM/3-172        AC D4LPN5.1
#=GS A0A075KBE0_9FIRM/4-173    AC A0A075KBE0.1
#=GS A0A162MGV2_9FIRM/4-173    AC A0A162MGV2.1
#=GS N2ASA6_9CLOT/3-172        AC N2ASA6.1
#=GS W4QWP9_BACA3/2-170        AC W4QWP9.1
#=GS R6SV52_9CLOT/5-158        AC R6SV52.1
#=GS A0A0M3R9K2_9BACI/3-171    AC A0A0M3R9K2.1
#=GS R6VE33_9FIRM/3-172        AC R6VE33.1
#=GS R6CWK5_9CLOT/3-162        AC R6CWK5.1
#=GS R5K248_9CLOT/5-174        AC R5K248.1
#=GS K6UC52_9CLOT/3-172        AC K6UC52.1
#=GS C4Z0I3_EUBE2/4-172        AC C4Z0I3.1
#=GS A0A0F2NK71_9FIRM/3-172    AC A0A0F2NK71.1
#=GS R9JFM0_9FIRM/4-173        AC R9JFM0.1
#=GS A0A089ILM4_9BACL/3-172    AC A0A089ILM4.1
#=GS I9AZW5_9FIRM/3-172        AC I9AZW5.1
#=GS R6B816_9CLOT/5-171        AC R6B816.1
#=GS F2JME2_CELLD/3-173        AC F2JME2.1
#=GS W4QIX9_9BACI/1-155        AC W4QIX9.1
#=GS R5DS37_9FIRM/4-164        AC R5DS37.1
#=GS A0A0J1DN12_9FIRM/2-170    AC A0A0J1DN12.1
A0A0B0D633_9BACI/2-169               ............................................................e-WIGAMMILSVTTWAGFDIAARY..KKRPGHIRQWKNALQMIEAEMVFGQSSLWEVCENLS...........KHL.PD.......PIGKF..FESIIEE--K..E.........HCSDFSQRWTSHLKKH....WSS....NALTKNE...WEILTQFGRTLGQHDLEQQQKQIKLTLHHLDRELHDALEVCDQYQRMARGM.GVLSGLLVIILII..........................................
A0A0C2V938_9BACL/2-171               .............................................................KLLGAALVLLAATLFGFFQALQF..ARRPRQIRELISALQRLETEIVYGSTPLPEALRRLS...........AAA.AE.......PVGPL..LGGVAAALAQ..R.........PQTPLGELWREEAERV....WKR....SAMKEPE...FEAFTRLGLALGLSDRTDQAKHLKLAAAQLKAEEQTAREEQKRYETMWRSL.GVLVGALIVILM-y.........................................
A0A168PC71_9BACL/3-172               .............................................................KLLGMLIIVLAGTLAGFNRARQF..ERRPQQIRELILVMQRLETEISYGFTPLPEALNKMG...........SQI.RE.......PLKSF..FISAANDMNS..T.........NGLTAQESIQQALSVH....WKR....TSMKATE...REVLHQLSFTLGTSDRQDQIKHIALAAQQLKHEEVAAREELDKYGRLSKNL.GLLVGILVVILI-f.........................................
R6GYS5_9FIRM/2-84                    .......................................................tiyerl-----------------------..------------------------------------...........---.--.......-----..----------..-.........------------LKKT....WK-....EKFSKEE...QNLFLNAGRNLLSDDMEYQREEIKQLSTYLNEKILQMKKEYTNKKKVVLIS.CLCMGALAVILLF..........................................
E2ZIP5_9FIRM/6-154                   ............................................................h-WAAAALLLLCGWLAGSAFQVRT..EQHILQLQRTVELLQRIRQEIAYRRLDLEQLQRCLV...........---.--.......-----..----------..-.........QEKLLESDAAPKLQEI....PAP....ERFDDAE...RLCFEQCFAGLGQSEAAQECERLDYYSARFEAFLHQAQQKAASGQGLPCRL.GLAAGAVAALILL..........................................
R5GVQ0_9FIRM/2-162                   .............................................................KLAAGLMILFICGGWGLAQRIKL..RRRCELLRELRLMLEQYSIKISCTAPTL----EQLA...........QES.EG.......VFGSI..LRECAA----..-.........ETPDIRSAWSSSVQRL....SAL....PCCGKEE...AKMLAELGRALGTCPAESEISLLRLYSGQMDRLCDEAEKTSEQKGRLYSSG.GILAGLAAAVLLL..........................................
E0ICJ9_9BACL/4-173                   .............................................................KMIGAALILFAGTLIGFLQAARY..ADRPKHIRQLAGALQRLETEIVYGRTPLPEAITRIA...........ANV.QQ.......PTARL..MEAVTAQLQQ..S.........DGRTFNECWEAAIRSQ....WPS....TAMRSAE...LTVAIRLGSTLGISDKDDQLKHLRLAAVQLKAEEDAARDEQAKYEKMSRSL.GVLLAILVVILMV..........................................
A0A167T7P6_9BACI/2-170               .............................................................KWFGALLILLATTWSGFEVARQL..SERPRQLRQLKVALQALEAEIMYGHTPLTEASLHLA...........RQL.AF.......PFSHL..FERFAEKLNI..-.........GETNVCEAWEESLRAI....WRT....TALKQAE...FEVMKQFGETLGQYDRIAQQKQIALALIHLDREEQDALDKKMRYEKMAKSL.GFLVGLLLIILLI..........................................
L0K8Q9_HALHC/2-169                   .............................................................KLVGTILIIISSTGLGFVVARQF..ILRSKQLKQIKLALELLQTEISYGITPLPQAFEKIA...........SEL.DA.......PVDNF..FVEAREGLK-..-.........AGQTAKDAWQQAVKKV....ISQ....TALGQTE...EDVLLDFGCNLGQSTSDDQLRYLNLAQDHINNLHQEAITDQKEKVKLWRYL.GVLGGLFIVILI-f.........................................
W7UEC7_RUMFL/4-167                   .............................................................KLLAAIFFALGGSFCGICCSGRL..KSRADICNDSVRIMRSCGIMIRSSGADVYKLMLELK...........-KT.GV.......GLLHF..IGKMPDIY--..T.........ETVNFRSLWADAVSSE....---....SGIPAEE...KKLLIDFGNILGTTDIEGQISSIAAQITLMEGLREQRMAEYRQKGRLYRSL.GVMAGVMIGIIII..........................................
J9HBS4_9BACL/1-164                   ............................................................m------IIVFATTLIGFRMAHAY..RERPRELRRLLQAVQQLQAEVEYHAKPLPRALIDVG...........QNS.GG.......ACGKW..FVTAAKHLQE..-.........DGRSVAESFAAAAQSV....ASE....SAYRSSD...FDPLDGVAASLATMDAVHLHGQFQLAAQALEQAEVQAREEAERSARLWQYL.GVLAGVLLVILL-y.........................................
R5AIK6_9FIRM/3-172                   ............................................................r-LLGSVLVLGATLWFGAYFAAKE..KYRLQELAELERAILLLQSQIAYLSAPLTEVLESVS...........WKA.EG.......VIGEI..FAQAAAVMAE..R.........ERASAEEIWTEAWSKR....RNQ....IFLTAED...LDMVLSFGKTLGYLDKAQQEGSICLLLRYLEEALAQGRKRSEKNGRLYYGI.GGLSGLLIIVTLL..........................................
A0A069DC30_9BACL/3-172               .............................................................KLIGSVLILLSGTLAGFYQANQF..ASRPKQIRELTLMLQRLLTEINYSYRPLAEALSQIG...........KQA.SE.......PLGRL..FISAADHMNS..S.........QGLSAQESFQHAINRY....WSQ....TAMKQPE...KEAIRQLSFSLGTSDREEQNKHITLAIQQLNHEEASARNDQIKYEKMSRSL.GLLVGALIVILIL..........................................
R6BL76_9FIRM/3-172                   .............................................................KLFGAGLTMFSCFAAGCLICAEM..KKRIHILEELRRMTVMLSAEIGYANTMLDEAFGSIA...........KRV.SP.......PLSDF..LVHVQEKMQK..G.........EEANLGVIFEKQLEMD....LKG....TALKESD...LASLRTLGGQLGYLDVAMQKKTLDYYLEQVSDACVQAKKEYREKEKMFRCL.GFGAGAFLVILL-y.........................................
A0A150MMW2_9BACI/2-170               .............................................................KLVGALLILLTTTWAGFEAARML..HERPRQLRQLKAALQALEAEIMYAHTPLSEAALHIS...........RQI.SS.......PLSKL..FAQFAAKLQV..-.........GETSVHQAWEESLQAV....WKE....TALKQGE...LEIMKQFGETLGQYDRLTQQKQIALALAHLEREEADARERQARYEKMAKSL.GVLAGLLLVILLI..........................................
U2NNS9_9CLOT/3-172                   .............................................................KGILFIGIFICSTYLGFSLGESF..IKRYTHLRALEKSLVLMQNQILYVYTPLPEVFEFIT...........EKV.EG.......IWKEF..FKHISELLTN..N.........FTDDVYGAFKDSIDKY....KDK....LYLKNED...LDLIIDFSKSLGESGTYGQEQIFNLTLSNLKNHIEEARELKEKNCKMYRYL.GACLGAVVIIFLI..........................................
R5TET5_9CLOT/3-174                   .............................................................KWIGCILVMTGCVGGGMVMAVGL..KRRIRILEELEVLLQRLYGEMEYAGNDMIDILKILQ...........VES.IY.......-FSEL..WQRIIERLER..G.........DSVRLWEVWREETKRKt.glSPI....CFLGQEE...QYILQEVGRALGQTDRKTQLHMLKLHEQRLHKVVNKIRSESQTQARVYRVV.GVTAGCFLVILFV..........................................
T0DC70_ALIAG/3-171                   .............................................................KLVGAMLLVLATSLLGFQMARAH..RDRPRQLRSLIRALTHLQAEVEYQSTPLPTALANVA...........ERA.SP.......PCSSM..FRRVSDMLME..-.........KGASVQAAFRSGIAEL....VAD....SALKGSD...CEPIQMVAETLSTMDRAHLQTQFQLSIDALMQAEQQAREQGLKNARLWQYM.GVLTGVILVILL-y.........................................
A0A101HS62_9FIRM/109-233             nitppskdglalekanslllnhdwseaeesflelieqypdrpeillglakselgqgnpfds-----------------------..------------------------------------...........---.--.......-----..----------..-.........----------------....---....-------...LLILRNLGSSLGISDRDDQIKHLHLAMEQIRAETVAAEEEAARNVKLWSYL.GFLGGLLLVLVL-y.........................................
B1CBV6_9FIRM/4-171                   .............................................................KLPGMVCLFIFSVLFSRSITRKI..KNRLLELEEINRILNDFIVSINVGLYDVNFLITEAI...........KIT.KT.......TYHDF..LRDVKTTMIK..K.........DLSDFSAIWFECLNNH....--K....FNISREE...MILLENIGVSLSFNDKNRMVKQLTLIQSGLTEAIKKAREDRDSKVSLYEKM.GVLFGSFLVVIFI..........................................
A7GSL0_BACCN/3-171                   .............................................................KIFGAVLIVAVTTFFGFSHAKRY..SERPRQLRLLKAALQSLEAEIMYGHTPLSEAAERLV...........KQM.PK.......PLNWI..FQSFSKRLEN..-.........GEQTVRESWLDSLKEN....WAL....TSLKQAE...YEILQQFGETLGQHDRESQQKHIRLCITHLEREEGEAKALQQQYEKMIKSL.GVLAGLLIVILLL..........................................
L7VLP1_CLOSH/1-123                   ...........................................................mg-----------------------..-------------------------RPLGEALSQYA...........RNR.TS.......SLSEF..TGRVYEI-SV..N.........EGNGIDAAWRKGIEEF....RKR....WPMDQEE...WNLLSQMGEVLGKTDRAGQSSFIKMMREKFAVQEKKAEEDRIRKEKLYRDL.GILGGLAIVLVLI..........................................
E5WIG1_9BACI/3-171                   .............................................................KVIGAVLIIVATTWAGFEASRHL..TERPRQLRQLKSALQSLEAEIMYGHTPLHEAARRLS...........AQL.SK.......PLSWF..FESFAKKLT-..D.........SETTVKDAWEESLKEI....WKM....TAFKQGE...FEIMKQFGETLGRHDRLSQQKQIMLTLSHLEREEADAHDRQVKYERMVKSL.GFLSGLLLIILLM..........................................
R6C8V0_9CLOT/3-172                   ............................................................r-LFGAILIFAGCTALGLFYRTRY..YESIRLLKTMEKILDLFISEVRYGKSTLHECLFMIA...........EKT.EE.......PFRGT..LLSAGKLLQK..E.........DGRDFSACWEEAFAVL....LQK....LPLTKEE...KESFLSFAKVKGLKDWQMQVRVMEGHRDAIKEARRIREQNVLQQGKLATGL.GIMGGLFLIIVLL..........................................
A0A023DE21_9BACI/2-170               .............................................................KLIGAMLILLTTTWFGFESARML..KERPRQLRQLKAALKVLEAEIMYAHTPLSEAALHIS...........KQI.SL.......PLSKL..FEQFAAKLQK..-.........GETSVQQAWEESLQTV....WSS....TALKQGE...LEIMRQFGDTLGQYDRLTQQKQITLALVHLERQEAEALERQARYEKMAKSL.GILTGLLLVILLI..........................................
R6XSG3_9CLOT/5-169                   .............................................................KIVIYTFIFLSCSLIGILVSNKY..RNRVNELKEFKNALNIFKTKIRYTYEPIPEIFEQIS...........KNT.NS.......NISNV..FGVASEKM--..-.........KVLAAGEAWNLALNME....--E....LNINDED...RLALSNLSKLLGKTDVTGQLNQIELTTDFLEGQIKKAEQQRDKSEKMYRTL.GMLIGMAIVIILM..........................................
M1LTX3_9CLOT/3-172                   .............................................................KIIIAIGIFLISTYIGFIYGDTF..KKRQDQLREILKALTILENDIVYGTTPLPEALENLY...........SKI.NN.......PLNNL..IKAIADRLIK..G.........DVESVYQGALEEFKGL....ENE....FYLNEAD...KEIMADFLKSLGSSGVLGQKKIFALAVEGIRMNLREAEDIAKKNIKLYRYL.GVCLGAMIVIFII..........................................
R5QAL0_9CLOT/5-169                   .............................................................KGILIFFVFLIFVKIGSIYSKKY..INRASQLEQMKNLLNIFKVKIKFTCNTIQEIFNQLY...........EDT.PN.......EIGEI..FKKANEYM--..-.........ETYSAKEAWNTSLEEA....--K....TDLTKED...IETLKNLGKILGETDVEGQINQIELTETLLENQIKEALEEKLKNSKMYRTL.GVTVGLAISIILI..........................................
A0A140L8B7_9CLOT/3-172               .............................................................KLMISAVIVLSASLIGYILSYNY..VQRPKQIKNLILSLQLLETEILYMLTPLPQALKKIG...........SKG.NT.......ELAGI..FKEAGSLLET..R.........RGYDIEDAWQQAIEQK....IRF....TSLSEED...KEILIDFGKNLGSIDRENQIKNFNFIYAQLKKQQQTAEELRAKNEKMYRSL.GVLLGLAIVILFL..........................................
C4IL69_CLOBU/3-172                   .............................................................KLVIACALFSICSYVGFEYGEGF..NRRMIQLREILKSLIILQNDILYGSTPLPEAFENFS...........YKV.EE.......PIHSF..INGIREKLVS..G.........SVESVYDGVAEEYREL....KGK....FSLNDND...IKILGDFFKSLGESGVFGQERIFSLAIEGIRMNLKDAEDTAKKNVKLYRYL.GVCVGGMITIFV-l.........................................
C0CY21_9FIRM/1-137                   ............................................................i-----------------------..--------------YFLKGEITYSHAPLAEALERVG...........RRG.GG.......PLGDM..FVRASERICT..Q.........EGESLQEIWSGETRTMa.agAKN....LPLTRAD...LEQFTALGEHLGYLDVDMQERTLLLYLEQLDLSIEYLQAHRQEKCRLYTSL.GVMGGIFLVIVM-c.........................................
A0A0C1U6G9_9CLOT/3-172               .............................................................KLVGSFMILISASLIGYLYGENL..KKRVIHLKELEGAIYHLKNEISYSHALLQDGLITVA...........EKT.KS.......PVNKV..FYSVSNILRK..H.........ECDSVYEAFIQSFENN....KES....LELTKED...IGIFLSLAKTLGEISLEGQEEMFKLTIINLEKAIKNAEQSLEKNLKMYRYL.GFTIGAMVVIVLI..........................................
R7MAA7_9CLOT/5-169                   ............................................................r-LFILAMIIVVSSIIGILFSKRY..ANREKEIKEMKNALNMFSTKIKFTYEPIPNVFMEIA...........NKI.DG.......NIGTI..FNVAANNM--..-.........KEMSAGEAWRKALLI-....-SK....NNLNKED...VATIQNLSRLLGQTDIEGQISEVEVVNNFLTVQLENASEERRKNEKMYRTL.GLVTGLTIAIILI..........................................
R5HAM8_9FIRM/3-183                   ............................................................r-LIGICLTLAGSFGSGLAFCREK..SRHAGTLFLLAELFLRMAEEIGYSAERLPDVFSQMSvwlakdaendrKEE.AS.......ALAEA..LLHCADRLEQ..E.........RSEPLEVVWNAELGAW....AAQ....TVLSREE...AEKLLSFAKEQGFPDRERQRQWMLRLSGEFKSRAESVFEKAASEKRMVLSV.SLAAGALVVVLFW..........................................
A0A0H3J7T1_CLOPA/3-171               .............................................................KIIGSILIIIASTFGGFMYAQCF..VNRVKELNEIERCIYQLQNEIVYTHTPLPEALVNVA...........VKS.KE.......PIADI..FNRSSHKLKS..N.........RYDNVYEAFKEAFREN....-SN....LNLKEED...INLMLDLSKSLGESDITGQINIFSLTIENLKKIIAQAEITMKKNVKMYRYL.GFGIGAMIVIMLI..........................................
C0C3R2_9FIRM/3-130                   .............................................................KIAGALLLTAGTTLMGMRAASGI..QDEYRQIQYLQQIMYLLLSEIRYSRAYLGEAFLHIG...........GQV.RE.......PYSKW..LAQMSRRMDS..R.........DEGIFSDIWENSAEEY....LAD....SGLPGEE...ISRLKALGTRLGAADMDMQLK------------------------------.-------------t.........................................
A0A0S2W520_9FIRM/3-171               ............................................................r-WIGALLLMAGAAGLGLGAAAQL..RTRVASLRSLVGALGQLERELTFRLTPMPELMERLA...........RQS.QG.......PAAYL..FAHCRDHLWE..L.........GEKSFGQLWREALDG-....EPD....LLLDERE...SQILLELGEVLGRYDVEGQSGALRNSVLELERCLAGAEEEQRRLGRVYTTL.GLGSGAMLVILLL..........................................
K0AX56_CLOA9/5-174                   .............................................................KILGCLFVIISSTMIGMEYSKKY..TERLNNLVYVQNCIQLLETEIVYSCNPLPNALENVY...........NKG.NK.......KVSFL..FEEIRKYLLE..N.........KDKTLFESFEYSLSKF....KDK....LYLEDED...TEIILSLGRVLGVSDRLDQEKHFKTILVNLEMNHKDANEKKSKNAKMYKSL.GVLFGFALVLIL-y.........................................
E6UIW0_RUMA7/4-157                   .............................................................-IVGFILITSAGVIVGENAVLGL..KKRENELRELSGLMARIDIYLTSCCLDTTELFGRIS...........-SE.GG.......CYDRL..FSSVEEDI--..-.........-TESVSYRIRTS----....---....-GLE--M...CDVLADHIAKFGCTDLDGQLAQNALIRCDVDAALEDACKRRIKYTGIYRAV.GVSAGLTAALLMI..........................................
A0A117L867_9FIRM/3-172               ............................................................r-LIGALLIIGVAGWGGLWVASTY..SRRPQQLRSFQSALQMLDTEIVYGATPLPVALKKVG...........QAV.EP.......AVGVV..FQKAGKLLEK..S.........CGYTAGEAWNKALGDQ....AGR....TVLRSGD...LMILKTFGEVLGASDRSEQHKNIVLTIHYLQKAESEAEKEKEKNGKLWRYG.GFLIGISMVLLLL..........................................
K8EK41_9FIRM/3-172                   .............................................................KFIGAAAVLLSCTLMGLLVAGSY..SRRPVEIRCLLNALQMLETEVTYGATPLPEALAAVA...........ERC.DP.......RVALL..FNRAAQELLT..M.........RGLTAREAWEAALREF....YPG....SALTNSE...RAILLELGNSLGISDRSDQVKHLVLAKEQLKLEQAKAEEASLKNSKVYNYL.GFLGGLTIVLILI..........................................
N1ZN83_9CLOT/4-173                   ............................................................q-LIGALIVMLSCTITGICFGKKI..CYRIEELQKMQSAMTMLQNQIDFLSTPLPEALEEIG...........LKY.NN.......VIGSL..FLKTAQEMEK..R.........EGEKGEEIWKKAVLNW....KQK....TYLEKQD...IDAILCFGYSMGYLDITQQKASICLLLQYIEMTLAQLQQKKKQQQKLYSSM.GILGGMLIIVILL..........................................
R6PVL4_9CLOT/3-172                   .............................................................KIIGAILIILASGGIGVTKGLEL..QKYLRELELLKQLFWMLKREIQYTKAPFSEAFSHIG...........RRM.EG.......AQGEW..LLYLAEQIEE..K.........AGATFFELWTESIDRC....LIK....SQLKNKD...KEELKAIGMQMGYLDEQMQLGTIDLYLEQLSFVIQKTREELVMKKRLCNCL.GVMGGIFLVIILI..........................................
B2TRQ2_CLOBB/3-172                   .............................................................KLVLIFMLFVTASYIGFLYGETF..RKRYIQLKEILKNLIILQNEILYGSTPLPEALSNIQ...........KKT.MK.......PISTL..IGNVNEKLCE..G.........EAESVYSAFSSEYALL....EEE....FYLSNSD...KNFLIDFIKSLGESGLYGQEKIFELVIENVRSNLKEAEEESKKNIKVYRYL.GICIGAMITIFLI..........................................
W1SJW1_9BACI/3-171                   .............................................................KLIGAIIIIVATTWTGFEAARNF..SDRPKQLRALRSALQSLEAEIMYSHTPLHEAARRLA...........AQL.SK.......PLSLF..FEAFGKKLT-..D.........TETTVKDAWETSLKEV....WKS....TALKQGE...FEIMKQFGETLGRHDRFSQQKHIMLTLTHLEREEADAIDRQAKYEKMVKSL.GFLSGLLLIILLF..........................................
A0A0A5GIE0_9BACI/2-170               .............................................................KWIGALILLCATTWGGFEFARRL..RERPKQIRQLKNALQVMEAEILYGQAPVIEACEKVA...........TQV.PA.......PLCFF..FDDFSKQLKE..-.........CSSSLSSVWEERMKHY....WPI....SSLGDGE...REIMRQFGQTLGQHDFTSQQKHIRLALSHLERELEEALEQQKRYGTMVKSL.GFLLGLLLVLLFI..........................................
A0A0R3JUV2_9CLOT/4-173               .............................................................KLIGSFLIIVATTFMGFYISWIF..SEKVKQIRDIQFALNQLESEIIYSSEPLYIAFNKVG...........NKF.NG.......PLRNL..FMDISEELRE..H.........RMDTIYDTFIDCYDKT....KDK....FYFDEEE...IEVIKNFIQGIGSSDFEGQKKNFNIAIKKLEDIEKKVDAKRKSNDKLIKYL.GFSFGVVIVVMLF..........................................
N0AW00_9BACI/3-171                   .............................................................KIIGAVFIIVATTWIGFEASRHL..SERPRQLRLLKSALHSLEAEIMYGHTPLHEAARRLS...........TQM.AK.......PLSWF..FESFAGKLTS..-.........SETTVKIAWDESLNEI....WKL....TAFKQGE...YEIMKQFGETLGRHDRVSQQKQIMLTLSHLEREEVDAYERQSKYEKMVKSL.GFLSGLLLIILLM..........................................
R6R0I7_9FIRM/5-152                   ............................................................r-LVGTFFLVVCGWCAGDAVCIRT..QEHLEALRQTIALLEEIEQEITFRRADLNMLAKKLQ...........---.-R.......EH---..----------..-.........KLFCSAKMIQTAIPP-....---....QSFSPQE...AACFAECFSALGHTEAEQACSRLAFYQERFRSFLQQQEKAAQSRLVLAPKL.GILLGLTAAILLF..........................................
F6DUB5_DESRL/3-172                   .............................................................KLLGALMVIFSCSLMGMTVASNY..RRRPGEIRALQNALQLLETEISYGATPLPDALTYVA...........ERC.DQ.......RVSPL..FGGTGRELLT..M.........RGKTAREAWAMALEEY....YPR....SALNRSD...RTVLLELGNSLGISDREDQIKHLSLAREQLKLEQAKAEEDSARNTRVYHYL.GFLGGLTVVLILI..........................................
R7IEQ3_9FIRM/3-163                   ........................................................rllfp-----ICAALLSTLAGLHLSTHL..RQEEQRLARWGEVLPHLHLLMASCAYSLPEAFRLCA...........-DG.NH.......PPDTL..LRQLADALER..Ap......lsSPGALTDRLCPAISE-....---....-------...KDIISRMMHLLSRGSLESRLLAVENARQEVTLMHEKAARKADKDARLYQTL.GWIGGLCLLLILM..........................................
A0A0A2U025_9BACL/3-172               ............................................................n-MLGAVIILLASTLAGFYKARQY..ALRPRQLRELIAALQRLMTEINYGLTPLPDAMGKMG...........AQT.KE.......PVRTL..FLHAARQMEP..P.........HGHTALESLQSGIEEA....WGR....SAMKADE...REVMLQLSFSLGTSDRQDQTKHISLAIQQLMHEESRAQADQMKYERMCRSL.GMLVGALIVILI-f.........................................
R5YYR7_9FIRM/4-174                   .............................................................KFIGAAFLIVAGCMSGKEISSNY..LNRLRQLEEIKKTIIFICGEIKYNNSNLDYVFTKIS...........KNS.KE.......FIKEF..LESVVKDLNG..N.........TEREITDVWCENVEKK...iKTK....TSLEASD...LNDLKDMGNLLGITDKDTQINNMNLYLEKIQLQIDKLEKEKDEKCRLYKTV.ASMFGLLIVITII..........................................
A0A017S0N0_9CLOT/3-172               .............................................................KLIGSLIVITATTILGFSYARVY..SERVNQLRAMQYALNILETEIVYSATPLMEALIYVS...........EKT.EN.......NISML..FSMMADILNQ..K.........SVTDVVEAFYLAFNKL....KNE....LYLEKEE...VEVIAAFMQSVGSSDLEGQKKNFNITIKKMEAFEKRAEETRSKNEKLYKYL.GVCSGAILIILLV..........................................
R7C531_9CLOT/4-172                   .............................................................KFLGMIFVLLGSFGIGIFYRIRY..GNRLHNMQDCERALLILQGEMEYGHTPLMEACEEVS...........VRI.GG.......IVGSF..FAQIAKKLNT..-.........HEGALETIWCQTARKV....LTK....SQMEKEE...REEWEKLGGTLGYLDLEMQVSTIQIYVRRLKLRMEQTEKESHERLRMYPVI.GAFSGVLICLLLV..........................................
A0A0E4CY64_9BACL/3-172               .............................................................KLFGAVLIVLAGTLAGFKRAAQY..ADRPRHIRGLIAALQRLETEIQYGYTPLPEALRRIG...........MQS.KD.......PLKAF..FTTAADEMSP..P.........LDRSAEAAISKAMEEH....WKT....ASLKGTE...KEILRQLSCTLGTSDRSNQSTHIALALQQLKQEETAAREDQGKYEKMNKSL.GLLLGALIVILI-f.........................................
R5IDE5_9CLOT/4-176                   .............................................................KWTGGLLILFAGSGMGVWLAWGY..KKRLSTLENLRRMIYCLKGEIVYSHAPLEEAFERIG...........KRE.KG.......VLGEL..FTQTAEKIGC..H.........NGETFSKIWEQTIEEM....EKNg.ksLFLEKED...REKLLSLGGQLGYLDTQMQERTLLLYLEQLELSVSRLRGEIREKCRLSTVL.GVMGSLFLVIVML..........................................
R6U904_9CLOT/1-144                   ............................................................m----------------------I..KRRIRLFNTLALLAGNVSAAIRYSGDDITKILLQEG...........LLL.KL.......---DF..IKNAVSCVE-..-.........KGEALEKGWQESVDGI....PVF....CGITKED...RALIKQFGSKLGTTDVYGQTDHCEYFKELFHSRASKLAQECVGKSRVYRCL.GFFSGAAISL---avi.......................................
M9LIQ2_PAEPP/1-165                   ............................................................m--------IAATASIGWLKAASY..RARPKQLRLLNYALQRLETAIMYGHTPLPAAFAEIS...........RQL.PP.......PLHAI..FAAAAQAMDD..An.......aVPLTAREAWQLAWERH....RGN....TSLANED...LRVLLELGYSLGISDRDDQRKHIRHAIKQLEQEEFVAREEYQRYGTMCRSL.GVLSGLLAVILM-y.........................................
A0A0A2TZZ4_9FIRM/3-169               .............................................................-IMGCVALIAGCGSLGVWLAHRI..RLRPVELRECLMALALLDTEIVWGSTPLPEAFRSVK...........ERT.DP.......PWQGF..FAELQERLQ-..-.........RGESASLAWKETIFTQ....NQH....FCLKQED...WQVISDVGKGLGRSDSHEQHKQIELVGRQLALIKDQAGIWSDKQAKMWSYL.GFLCGIAGVLILI..........................................
D4JTI1_9FIRM/7-167                   .............................................................-IVIFLLITLSGGATGMYFSGRL..SERCRVINSYISLVQSMNCYIGFSGYKLAEIFRAEQ...........KSS.GC.......YISDK..LVELSE----..-.........NGGDISDEWDICVSKS....---....GYLKEDD...RQILSELGRTIGKSNTDGETAVLALAGQRLSFQLKTAEEERKRKGRLYTTL.GIMLGAAVGIMLI..........................................
A0A165XSA1_9BACI/2-170               .............................................................KLLGSLFILLATTWIGFDSAKRL..TERTRQLRQLKVSLQSLEAEIMYGHTPLQDASLHIA...........KQA.AP.......PLSNL..FTLFSEKLSQ..-.........GDIDVKSAWESSLLEI....WPY....TSLKEGE...LEVLKQFGETLGQHDLISQQKHIKLTMAHLEKEEKEALFNQEHYGKMTKSL.GFLAGLLIIILLM..........................................
Q97HC0_CLOAB/3-172                   .............................................................KFVGCILIITSSTIVGFRYAEHF..RKRVKELKEIHNSLYELRNEIIYTHTPLVEAFKNIS...........DRS.NY.......PVNLF..FKLAAENLCY..K.........ETDNVYSAFKCVFDTD....KFQ....TNLNNDD...KKILLNLSKSLGETDIEGQVKVFELAIKNIENHITEAEEIMKKNVKMYRCL.GFCVGAMITIMI-v.........................................
U5LFJ2_9BACI/3-171                   .............................................................KIIGACFIILATTWAGFEASKHL..NERPRQLRQLKSALQSLEAEIMYGHTPLHEAARRLA...........AQL.SK.......PLSWF..FESFSKKLT-..D.........SETTVRAAWEESLKEV....WKL....TAFKQGE...FEIMKQFGETLGRHDRFSQQKQIMLALSHLEREEADAYEKQAKYERMVKSL.GFLSGLLLIILLI..........................................
R5FJL2_9FIRM/3-166                   .............................................................KVIGGGLLCLASGYVGIQIEKRY..KERASFYEDFKSYLEFSENRISAFKSPVTEILKEYR...........-NV.EK.......KSKEF..-SRMISEV--..-.........-EHAFGAAGGREKISA....ITS....KTLKKSD...VKLFCDYFKNVGKTSLTDELNLLGAVKNIAAENLKTAKNETEKKGKMYFKL.SIVLGLAAMLVV-i.........................................
D4K6A0_9FIRM/74-154                  ...................................................ggtlqqlpap-----------------------..------------------------------------...........---.--.......-----..----------..-.........----------------....---....WQLSAEE...RACFAECFSGIGRAETAQECERLGYYTARFEDYLQQARRTAQRQAGLPHRL.GLAGGMMLALLFW..........................................
W0EEB0_9FIRM/3-169                   .............................................................-ILASIILILGCGSLGLYLAARI..KKRPVELRDFITALTLLDTEIIWGGTPLPEAFALLK...........HRS.EG.......AWKVF..FAELERRVQ-..-.........EGESANTAWSETIRIQ....EKR....FCLKSED...WQVIQNVGKGLGRSDRQEQHKQLELVKQQIRDVQEQALIMCDKQAKMWSYL.GFLGGIAGVIFLI..........................................
R6WPP3_9CLOT/4-166                   ..........................................................vls----GALLMAASSLIGIAIKRIF..RVRYAYFSDAVDFLNLYKREISSLQTPLEDVIKTFV...........SSS.KG.......AFSDS..LQKFADGLPA..-.........GYKNVEE-----VQKT....IKN....VMIKEKD...SLLVAAFLHSLGKSNLENEITNTVRYLDVFNEKKSKSAIELNKKGEMYYKL.FVVLGVTLMLIV-v.........................................
A0A0K9GWW6_9BACI/3-171               .............................................................KFIGAALIVLATTWVGYELARVL..RQRPRELRQLKSALQSLESEIMYGQTPLTEAAYKLA...........KQL.PK.......PLSHF..FESFAVKLS-..G.........GETTVKAAWETSLKLV....WKQ....LSLKQGE...YEILVQFGETLGQHDRLSQQKQIQLAMIHLEREESDALDRQNKYEKMMQSF.GFLSGVLIIILLL..........................................
R6P931_9FIRM/4-171                   .............................................................KITGAVLIIITSCIIGYLLSIKE..DLRCKDLTEIEKILQNIFSQIDYKKEVLTVAIDNSI...........ENS.NI.......YIKNI..FEQISTAIK-..-.........NNTSVSTAWRVSFENN....YQF....TDISKED...ATKISALGEVLTSGDIDFQEKGFKGAITYIHNTIQTSKEKSLKDKKIYRCL.CSSLGLLIVILLF..........................................
A0A0A2TUI0_9BACI/2-170               .............................................................KWIGALLLLCATTWGGFEFARRL..NERPKQIRQLKNALQVLEAEILYGQSPVIEACEKVA...........KQV.PA.......PLAWF..FEEFSASLKQ..-.........SSSSLYDVWEDRLDRY....WSI....SALGEGE...KEIMKQFGQTLGQHDFAGQQKHIRLALSHLERELQEAQEQQQRYSKMVKSL.GFLSGLLIILLFI..........................................
A0A0M2PRE6_9BACI/3-171               .............................................................KWMGAILIILATTWAGFEMAKHF..SERTRQLRQLKVALLSLEAEIMYGHTSLIIAAQNIS...........KQL.PK.......PLSMF..FEDFSKKLVK..-.........GHTSVKEAWEESLQSI....WRM....TALKQGE...FEVLKQFGETLGQHDRISQQKHIKLALSHLQREEADAIDRQNRYERMMKSL.GVLAGLLVVILLM..........................................
A0A0X8D1H7_9BACL/3-172               .............................................................KLIGASLVIFAGTFIGMQLGSYL..AHRPLQIRQLRAGLTLLETEIVYGSRPLLEALASIS...........RRL.TG.......DVARL..FARAAELSAE..E.........PDLAASECWHQAVQYV....WRD....TAMKEPE...KEILLQLGSVLGQSDREDQQKHLKLALANLEHEEMNARDNQRRYEKMCRSL.GVLSGILIVILL-y.........................................
C0GE42_9FIRM/4-174                   .............................................................KWLGALLILGAAAAWGNLQAAQL..RRRVKELEEFRLGMRLLAAEIGYTSTPLPRALEHVQ...........ERL.PG......gGVSVF..FTRAGELLRN..P.........EVADANAAWSRAADEV....KEE....LALTRED...WPVLLRAGAGLGSMGRENQIKQLEAAEVQLASHAATAAARCESGEKMWRYL.GVMGGLAVVILLL..........................................
R5A8B3_9CLOT/1-129                   ..........................................................mld-----------------------..---------LKALLQGFQTGIRYAAGSVAELILERE...........---.EC.......P----..FCRLAER---..-.........DGEFLLD-PVDALSRA....GEC....LLWDGGD...LEWYRGFVAGLGVSDTQGQLEHIGLYRSLLEPRLAQAQEEAKQKTKIFIAV.GLFAGVTLSLLLI..........................................
D9R8Q1_CLOSW/7-176                   ............................................................r-IVGAVLVILSSSGLGFFMAAQW..NEHLKTVEKLRKMIFLLKGEIVYANSPLPEAFERTG...........KKA.VG.......ELGAL..FENVSERLSG..Q.........QGESFYTIWQEEIDKL....PGE....VCLSKED...KQNLKGLGEHLGYLDMDMQERNILLYLEQLDLTIGYLRKHKQERSRLYTSL.GIMGGLFLTIVM-y.........................................
C4ZD12_AGARV/5-141                   ..........................................fmlllekgafylagermka-----------------------..----------------------------PQFFNSIR...........GKS.EV.......-FNEG..CRRMGEVLSN..R.........SCKSGEEGWKAVWEKV....LWG....RVSDEKI...NKMIVEMGGAFFEKNAAAMEQRLKECALDIHKQIDFYRKDYVEKMKVICPV.GILGGIMISIMLI..........................................
F6B9Z4_DESCC/3-172                   .............................................................KLLGSAVVVLSCTLMGMTIASNY..SRRPGEIRALRNALQMLETEISYGATPLPEALALVA...........ERC.DS.......RVARL..FRRASEELLT..M.........RGVTAREAWETAIADY....YPK....SALNRCD...RAILQELGNALGISDREDQVKHLVLTKEQLQMEQAKAEDASARNTKVYNYL.GFLGGLTIVLILI..........................................
R6GQG8_9CLOT/3-172                   ...........................................................ry--LVLVCIFIICSYIGFVIGENY..KKRSVNLKEFQKAILLMNNDVIYTNIPLMEALYDVS...........EKV.SG.......ELSQM..FREIASTLEK..G.........EANSVFDIFNNIYGKY....END....LSFKKED...YSIVSDFFRTLGETGVFGQEKIFKLASEQVKLNYQEALKEAKVNIKMYRTL.GVCAGALIVIFFI..........................................
D4KWV7_9FIRM/3-172                   .............................................................KLIGGILVAGSGVGLAVNMIAEI..RQHLLRLYEIRQLLINISGEAALALLPMEHILNQPT...........LTN.DV.......VLQKV..CGQIADRLAA..K.........KGESGGEIWWDIFWKN....RKE....LGICASE...LEIIANAGNAFFGRNIKENERMLSIYLERLDFVIEQERKEQREKQRVAGAV.SVIGGMMLVILFI..........................................
R5AL47_9CLOT/3-171                   .............................................................KIFAILIVFFACTAFGARSAARL..RQRATFLAALETALRRFLLAMEYEKKPLER---LAS...........KRV.YG.......EAQPL..FDAFAEALS-..-.........AGARPEAAMRQAVQGT....KDGarawLPLGDAE...AALLSEFAAIVGTPSAGRYAEGAEPVLQRLHTAVEAAGAEERGKGRAYRAT.GMLSGAAIAILML..........................................
R7QX72_9FIRM/3-172                   .............................................................KVIGCTLILAGMTGYGVSSVCCM..KRHLEELVEYKEILYALLGEIQHYRKPLAEAFDTIA...........KKR.SE.......GYRQV..LEMIAARMKK..F.........EEANGSEIWKDSFLSY....NRK....FLFSREE...EEIIQKSGHFLDAPDMESQKRELELYEAQIDYRIAEIQKTIGGKRKVCMYG.SVLGGLFLIILLI..........................................
A0A0V8JFA8_9BACI/2-170               ............................................................s-WLGAVCIFISTTWIGFELAKKV..RERPKQLRQLKVGLQSLEAEIMYGLIPLDEAFLHLS...........RQL.SG.......PVAEF..FLHAGKSLEA..-.........SVSSVQEAWENGLSHL....SAA....SSFKKEE...IEILRQFGATLGRHDRENQQKQIRLALAHLERELAEANEAQLKHEKMYKSL.GILLGLLIIILLV..........................................
A0A077J4C1_9BACI/3-171               .............................................................KLIGAIFIIVSTTVIGFEAARHL..SERPRQLRALRSALQSLEAEIMYGYTPLHEASRRLA...........AQL.SK.......PIATF..FESFSKKLT-..D.........SETTVKDAWEASLKDV....WKS....TALKQAE...FEIMKQFGETLGRHDRFSQQKHIMLTLSHLEREEAEAIQAQGKYEKMMKSL.GFLSGLLLIILLF..........................................
A0A075JPU8_9BACI/3-170               .............................................................-WVGALLLVGTTTWMGFEWSNRL..EKRPRHIRQLKNALQILEAEMIYSQSPLKDAFTVIS...........KQV.PE.......PTRTF..FAGLDDFLN-..D.........NNKDLFIVWNNAVNKL....MEV....SSLDRNE...KEILLQFGRTLGQHDFVQQQKHIQLAVGHLDRELEEARDNYLKYSKMAKSL.GFLCGVFIVLLLI..........................................
SP3AB_BACSU/3-171                    .............................................................KLLGAVFIVVATTWTGFEMAKIY..TERPRQIRQLRAALQSLEAEIMYGHTPLHTASQQIA...........KQL.AQ.......PVSTL..FSAFSDQLDK..-.........GSDSAKTAWEQSLKKV....WDT....LSLKKSE...YEVLKQFGETLGIHDRISQQKHIKLALTHLEASEADAEQAQAKNEKMIKSL.GFLAGLLLILLLM..........................................
M1ZDJ3_9FIRM/5-174                   .............................................................KFLGGLLIILSTTSMGFHYGSRF..ANRFDNLIFLEQCFKILETEIVYGAVPLPEALTNVY...........NKG.NK.......KVSFI..FEEIKIYLLN..N.........KKGDVFNSFTSVATVL....RDR....LNLKEGD...IEIFLSLGRVLGSSDRQDQEKNFKLILNQIAILQKEAKLERDKNEKMYKNL.GILTGIAIVIILL..........................................
A0A0Q4RBD3_9BACL/3-172               .............................................................KLLGALLILFAGTMLGFQQAARF..AARPRQLRHTAHALQRLETEIGYGHTPLPEALTRTA...........AFV.PA.......PLNRM..LMLAAEGLAS..D.........EGLSFPESWERAVREV....WGT....TAMRASE...QAVLIRLGSTLGISDREDQLKHLKLALIQLKAEEDSAREDQARYETMWKSL.GVLIAVLLVILMV..........................................
S0IZ63_9FIRM/3-171                   .............................................................KLAGSLLVIAASFLYGWKLNEEL..REHVVQLAGMKEMLLMLRGEISYARTPLKEAFRQVA...........SQG.KE.......PFSSF..LLKAAEGLD-..G.........TEDSMGTFWSRLVDQE....AGN....FYFTREE...LGLFKRAGENFGYLDTRMQLKNLELYMEQTEGLLRKAQKELEDRQKVARIL.SLTCGLFLVILLI..........................................
A0A0U1QS70_9BACL/3-171               ............................................................h-LIGATLIVFASTATGLLLAKRY..RDRPREIRQWRSALQSIEAEIVYGRIPVDQMAEDLA...........LQM.PL.......PLSKF..FHTLHDQMS-..G.........EHLPLQTAWSRSIERY....WPE....TALKRPE...KEIMVQFGTTLGTEDAENQRKHIQLALAHLEREEQEARQSQKANEKMIRSL.GFLAGILIVLLFL..........................................
A0A037Z5R5_CLOTT/3-172               .............................................................KFTGSVLVLISSVWIGFIFSERF..KKRTFQLKEMERDIHQLQNEIIYTHTPLPASLFNVY...........EKS.SY.......PLNEF..FKIISDMLYS..N.........KVDSVYEAFEKAFIEV....NEF....LYINKED...KDIILSLGKTLGESDIEGQKRMFSLTLENLKKQIIEAEVSMKKNVKMYRYL.GFTLGMIIIIMFI..........................................
F0Z5K1_9CLOT/1-162                   ............................................................m---------GATTGAGIAYGTEL..QRYLEKLLYIRHIVYMLKGELEYSNAPLGEIFGRVA...........VRV.KE.......PYRKW..LRVMERQVEE..R.........EEDEFAKIWNRSIDRY....LGE....IHLKSAH...SIQLKELGTFLGQLDGDTSSRTMQLYLNRLELEIEKVREGMAAKKRIGNCL.GVMGGIFLVVILI..........................................
R6N5J7_9CLOT/1-160                   .............................................................------MIVLTGAAVGYLQSKRL..TARTLFFEEYQKFLSELTLQIRYDSSSLERILEKFS...........--D.YR.......RLAPV..LRICREKIQ-..-.........EGNSFFESWRQGVGKL....SKD....NGLLKGD...IELLLDLGKGLGISDLEGQLSHLKLNSELTKLRLEEARECKVKKGKLYQML.GLSLGITTALLFL..........................................
X5A1K0_9BACL/3-172                   .............................................................KLLGAAMILLAATLAGFRRASQY..ADRPRQIRGLIAALQRLETEIMYGYTPLPEALKRIA...........VQT.RE.......PLRGL..LVTAAEGMSP..P.........QNLTAQEALDRAMKTH....WRA....TAMKIPE...QEVLRQLSCTLGTSDRSHQTNHIALALQQLKQEEISAREDQAKYEKVSKSL.GLLLGALIVILI-f.........................................
A0A081NWL7_9BACL/3-172               .............................................................KLLGAMLILLAGTLFGFYQASQL..SRRPRQIADLIRMLQRLETEIVYGFTPLPDALRRAA...........RAD.DS.......PAGAL..FAAAAEELGK..P.........GGRSVQAVWEQAVSRG....WKT....TSMKAAE...RDILLQLGSTLGLTDRDDQVKHLRLTVSSLQGEADIARDERERYERMWKSL.GLLMGALVVILM-y.........................................
R6RFZ5_9CLOT/2-178                   ............................................................r-YIGILMMAGALAAGGFWAADQW..KEKLELLLLFRQMMSYLKGQILYANATLPEALREVG...........GRY.AEgrsgflkEPGAF..FLRVAERLEE..Q.........GDVPFPVIWKEEAERF....PPG....FPLEAGD...HKNLLALGENLGYAHKDMQERTLLFYLEETDGSIGFLKREMESRTKLYRCL.GMAAGLFLMVVM-a.........................................
F6CL76_DESK7/3-172                   .............................................................KILGCALILLAGGGAGMTMAGHY..ARRPRDLRSLQAALKMLETEITYTATPLPEALGRVA...........ERA.GP.......RVALL..FNRAREELLS..P.........SGRTAREAWESALKAF....YPT....SALVPSD...LAVLRQLGPALGISSVQDQSKHLHLAMEQLGVEMVRAEEEASRYVRLWNYL.GFLGGLALVLML-y.........................................
G9RYK2_9FIRM/7-173                   .............................................................KCIGAILVLYTGAAMGWRKGNAA..MRRVQVLADICAFLGAVRDDLHFRCGRTEEILAAAQ...........QNT.RL......sALPLY..FSDLASGCG-..-.........LQTELDNALCRTEREI....--A....GVTRREE...RVLLRGALEGLGGCPAQEEEQRLAYAQTQLETALDAARAEAAQQRRLYRTL.GLSLGGAAALLLL..........................................
A8FF26_BACP2/3-171                   .............................................................KLIGAILIVSATTWGGFEFAKRY..SDRPKQIRQLRFALQSLEAEIMYGQTPLARAAEQIA...........SQV.GP.......PVNRL..FEQFAEKLKV..-.........GTFSARHAWNESLEDV....WKK....TVLKKGE...YEALKHFGETLGQHDVASQQKYIKLALGHLESEEKEAEIAQAKNEKMVRSL.GFLSGLLLILLLM..........................................
A0A0F2Q9S8_9CLOT/3-172               .............................................................KVTGAILVIMAMGTVGLVVARNY..SLRPQQLRYLLNGLQMLETEMLYCLTPLPLALKRVG...........MKL.PY.......PISQF..FLNTSTSLTN..G.........EGITAGEAWEMALGEL....AEE....SALLMEE...LDILLYFSQSLGVADREEQGKSLRLVKEQLMNMEKKAEELKEKNQKLWQYL.GFSLGAVIALVLI..........................................
A5N7I0_CLOK5/3-172                   .............................................................KFLGCMMILAASTGIGVIYGEGF..KKRVKQLKEIQRCMYQLQNEIIYTHTPLPEAISNTA...........CKS.VS.......PIKDI..FKDISQMLEK..N.........SVDSVYEAFSHTLKAK....ENT....LNLKKED...TAALLDLSRTLGESDIEGQKKMFLLTLENIKEQIETSQILMNKNLKMCRSL.GFSLGAVIVIILI..........................................
R9KYS4_9FIRM/4-172                   .............................................................KLVAGTCVMTGAVGFGLALCAEL..GSEIAHLKKLKELLLYIIGEITYLHRPAAEILSMAA...........QRM.GA.......PYAVF..LEQTAQQLEA..R.........DGLTLPEIWNANIGL-....MRE....AEIPKEA...LRYLERMGTCFGCEGDKMQIEYFSLFERELDERISVLSAKQSENSRLISAL.SALTGVLCIVLFL..........................................
A0A154BUQ1_9FIRM/4-173               .............................................................KLTGSILVIAAGGLMGFSLAARY..QNRPKQVRQLINGIVALKSYIRYASTPLAEAFSESA...........RGL.SG.......VICEV..FTTIGKFLRW..E.........AALTPQEAITRALETS....GDQ....LALKRQE...KEAFILFGANLGKMNREEQERYCDMLMSQLEKIEHDALALRDQNVAMYRYL.GVCGGMTVAILLI..........................................
A0A090J2B4_9BACI/3-171               .............................................................KIVGAICILIATSWIGFEASKAF..TERTRQLRMLKSALQSLEAEIMYGHAPLHDASRRIA...........NQM.SK.......PIETI..FENFSSLLLQ..-.........GDITAKEAWEISLKTI....WNR....TYLKKNE...LEILLQFGETLGKHDRVQQQKHIQLALVHLEREEVEARERQASYGNMVKNL.GFLSGLFIIILLM..........................................
U2K974_9FIRM/3-167                   .............................................................KWLGLLLVVCSGGGIGFLYAMRL..RQERTNLERLCQMLREIAVQIAFRSLTVQELLEQLC...........RET.AY.......AAFQF..PVTVLSGME-..-.........QGLPLAEAWAAGIRQD....---....KAVPEPA...KKLLLPLGEELGASDLDGQAATLAQYRMQLEPYAAEAGEKCVQRQRLYCSL.GLLGGLLAAILL-c.........................................
R7K6U9_9FIRM/2-155                   .............................................................KLLLCAVLVAVCGCGGLFLSKKY..KRKERLFFDLNNFCCSFNANLGYERVPVEKLLENNE...........NLF.GK.......DFSQL..----AEG---..-.........--YLLDG--EQAAHS-....---....DILSDSQ...ADKIEQFFGLIGRGDAAAQREAVSAYGEYFRNELKNAENENKSKGNLNRKL.GFLLGVFLSVLV-l.........................................
R6IBL3_9FIRM/1-144                   ...........................................................ml-----------------------..SLRVSLLEKICIMLRVVRTQLECCCCPVGDVLRILG...........--S.TP.......DLKELvfIPECIKL---..C.........DSEPFPQAWSDSLSAR....KNT....VGLTSSD...VSRLVSFGRSLGTTALDGQIANCDMFCADFELRLSEAREKKKKYAKVLPPL.GALAGAVIVI---a.........................................
C6LAC8_9FIRM/3-172                   .............................................................KVAGMALIIISGSALGVCMSREL..AQRVRWLGELERLMQVLKGEIQYAATPLPEIFPELA...........KRT.EE.......PLESF..FASLASAMEL..R.........SKSTTGDIFAEQAEAL....LGF....GGLKERD...VEALVRFGRRLGCPDREQQVQTIRLYQEELAAARAEAQEDYRQKAKVYQSL.GFLGGCFCVLLLL..........................................
F3BA03_9FIRM/3-172                   .............................................................KLIGCVLIIFASSGMGYLKGMEL..KKHLVEVEKMRQMFLMLRSEIRHIKSPLPEAFRHIG...........KRM.GG.......VYESW..LLDLSEQLIR..K.........SGVTFMELWSNSIEKH....WKG....GNLKEGD...MEKLKAAGENMGYLDEEMQVGTIDLYVEQLEQEIQRLQNEFAVEKKLYHCL.GVMGGIFLAVVLI..........................................
A0A0P9D188_9BACL/3-171               .............................................................KLIGCALIVVATSAIGFRVARVY..RERPRELLLLIEALRLLRAEIEYTATPLPQALKNVG...........ARM.HS.......PVNIV..FNTTADELS-..G.........ADVTVGEALAAGVRAC....RQK....AHLTDAD...FTALAVFGRTLGTSDLLHQSQQFEATLAQLESAQKGAAEDRRRYERMWQYI.GVLAGLFIVILL-y.........................................
D4LX74_9FIRM/3-172                   ...........................................................ra--IGAFLVFLASAGMGCQESRKL..SEHIQALEEFLQVIICLKGEIRYGGSSLPDAFRETA...........MHC.SE.......GYAAF..LKAVSEKMEN..R.........QVEDPGRIIQQCAKKY....LKE....NALSAEE...QERIAQLGERLGYLDREMQLRQLSLYEDEFERMIQKAKEDAPAKKKLYHSL.GVLGGAMLAILFW..........................................
A0A0B7MGY8_9FIRM/21-190              .............................................................KMVGACLVIGSMGMAGMKVASFY..SRRSAELRFLQDALQMLDTEILYAATPLPSALKKIG...........QSG.GD.......IIARI..FAEAGELIAA..G.........QGCTVAEAWGKALQKN....WSS....TALNRED...YAILYSFGELLGISDRQEQHKNIALTSLHLRKEEEKSRRDQEKNARLWQYG.GFLAGISIVLLLL..........................................
A0A0C2VIP5_9BACL/3-170               ............................................................n-LLGAGLLVLGSGLEGWRRASLL..DRRQRVLVEMAEAFTWMQNEIVKRQTPMIEIIHYQM...........-KR.DG.......EVAVL..FRLFLHHLTV..-.........TQLLLAEAWQEATKEY....SIV....TVLHKDD...LEWISRVGNAINQFDRTSIDKELVFVIHVLNSRQQEARNRSLQYGKLYKTI.GWMGGVLAVLLL-s.........................................
A0A075LK92_9BACI/2-170               .............................................................KWVGAILVLIAATWVGFDLSRRL..QQRPKQIRQLISSLQVMEAEILYSQTSIIETSDNLA...........KQV.PQ.......PAAAF..FQSLSDKLL-..L.........HPVDLYDCWEETTEAW....IDT....TALKTSE...KDVWLQFGRTLGQHDFEQQQKHIQLAKTHLERELEESEEANQRYGKMIRNL.GFLTGLLIVLLLI..........................................
R6GD52_9FIRM/3-78                    .............................................................KILGGSLVLIAAYLFGMKLMEPA..AEHIRLLEEGDLLYRILESEIRNTRTPLPILFGELS...........DRT.NT.......RWHNF..FLSF------..-.........----------------....---....-------...---------------------------------------------------.-------------lsh.......................................
R7F5R2_9CLOT/5-169                   .............................................................KTILLIAVLGMCTVLGIMKANKF..KLRVIDLQEIKKALNLAITKIRYTYEPLPELFKEIS...........KDL.NE.......NISNI..FIKAHTYM--..-.........ENLNAGQAWEKAVDES....--S....NNFTNED...INIIKGLSKLLGKTDLEGQLMQIELTTKLVDEQIIEATNLQNKNTKLYKTL.GATAGLAIMIIFI..........................................
W7YMS9_9BACL/3-172                   .............................................................KMIGIILILLSGTLAGFHKARQF..AARPRQIREMILALQRLETEITYGLTPLPDAMAKMA...........EQA.KE.......PLRTV..WSSASRWMSP..L.........MRLSAQESIQRALNDN....WKR....TAMRSSE...KEILHQLSYTLGTSDRQDQIKHIALAAQQLKHEEASAREDQIKYEKISKSL.GLLIGALIVILI-f.........................................
C6CU13_PAESJ/3-172                   .............................................................KLLGAVLILFAGTMIGFQQAARL..AARPRQLRQLAHALQRLETEIGYGHTPLPEALERTA...........EAV.PE.......PLAEL..LRDAADRVQG..P.........EGLTFRESWEQAMTSG....WGT....TALRQTE...QSVMLRLGSTLGISDKEDQLKHIHLALLQLKAEEDAARDDQSRYEKMWKSL.GVLIAVLVVILMV..........................................
A0A0A5GCC5_9BACI/2-170               .............................................................KWIGALLLLCATTWGGFEFAKRL..KERPRQIRQLKNALQVLEAEILYGQSPVKEACEQVA...........KQI.PV.......PLSLF..FDAFSSALKK..-.........SNAPLHLVWEKQLQEY....WSN....SALGLGE...KEIMKQFGQTLGQHDFVGQQKHIRLALSHLERELQEAEDEQQRYSKMVKSL.GFLSGLLLILLLI..........................................
I3EAC8_BACMT/3-171                   .............................................................KIIGALLIIVATTWTGFEASRHL..SERPRQLRQLKSALQSLEAEIMFGHTPLHEASRRLA...........AQL.SK.......PLSWF..FESFAKRLTN..-.........SETTVKDAWEESMAEI....WKF....TAFKHGE...YEIMKQFGETLGRHDRMSQQKQIMLTLSHLEREEGDARDKQAKYEKMVKSL.GFLSGLLLIILLM..........................................
R6RT95_9CLOT/4-169                   .............................................................KLIGLFLISVTGGLVGINASLRL..KSRTEFLEKYISLLSETKTRIRLSACDIRELFKNDS...........--G.YE.......PLDFM..TAEFTRNIK-..-.........NKSNVKISWERAVNSA....FRK....YRLSKAD...KELISDFGTDFGKRDIDGEISHIDLNIALIEDRLEKARTELTQKGKLYRTL.GIFGGITVSLIIL..........................................
F7KQ68_9FIRM/6-175                   .............................................................KTFGAVLIIGATSLWGIRAADRI..NDQYVQMQYLKKLIYQLRSEIRYARSYLGEAFRHIG...........TSS.RE.......PYKGW..ILEIYDRLEH..K.........NRGTLADIWEDTVREY....LGA....SGLPDEE...LDKLINLGGQLGVADIEMQVKTLDLYLEEMSLSMEEMRGGMKAKVRLCHCL.GVMSGIFITVLLI..........................................
A4XLD1_CALS8/8-165                   .............................................................KLIGSSLIIFSSLLIGYSKTLKL..REQLRIINLFINFFSFARADILTTRLTLFEILNRFK...........SKV.FS.......AHTTI..LEYYYKQ---..-.........NGKPLLD-----VKNV....---....YQIDENV...HKVILNLFNSIGYSSISEIDRIIDEGVRELREYYEIHKEKYSKNSKMFTLL.GLFCGVSICILLL..........................................
R5D5P6_9FIRM/3-172                   .............................................................KAIGAFLILFSASMEGTRHAHKI..REEYEELQKIRYLISLLKSEICYARSSLEEVFASVA...........EKC.ED.......PYRNW..LLMMRNEMRC..K.........KEKRFVKIWQESADVC....LVG....LMISRKE...KENLKEVGARLGNLDLKMQIRSLELYEEKVEESLRQIQKQMYTKMRLYYLM.GIMGGILTVVLLI..........................................
R6U276_9CLOT/5-172                   .............................................................KIIISILIVALTAYIGSSKSRKL..KEREYVLREMVTFLKLVENEIKYMMNILPNAYEIAR...........QKL.NT.......ELKIK..IGQIVVDMLD.sN.........NMTYIEGSIEKNISEV....---....ESLEKYD...KDIIISTLKNLGRSDIEGQINIIQNTINILENQINEANEIKNTNSKLYRTI.GIISGLMLVIIFI..........................................
L0EE69_THECK/3-171                   .............................................................KLAGAILVLLSGTLIGFRQAARY..ADRTAQIRQLLHVLQRLETEIGFGHTPLPEALERAA...........AGA.AG.......PVAAL..FRRTAERLRE..-.........GGAAVRDALRAAVDEG....WSL....TAMREPE...RSAVIRLGDALGISDREDQIRHLRLAAALLQAEEAGARDEQARYGKMWRSL.GFMAALLVVILML..........................................
A0A0N0Z5S2_9BACI/2-170               .............................................................KWFGALLILAASTWLGFAAARVL..HERPRQLRQLKAALRALEAEVMYGHTPLADAAMHLA...........RQT.AA.......PLSEL..FERFAAALCT..-.........EETSAAEAWEKSLRTV....WGK....TALKQGE...FEVMKQFGATLGQYDRLTQQRQIALALAHLEREEAEALDNQARYAKMAKSL.GVLAGLLLVILLM..........................................
A0A0Q9XTR0_9BACI/3-171               .............................................................KLIGSLLILGATTIIGFEIARGL..SERPKQLQLFAASLETLETEIMYGHTPLGEACIKIS...........KQL.PN.......PISAH..YVRFSNFLQK..-.........EEITVYKAWEAALKET....WKQ....TALKQNE...FEILQQFGANLGRHDRESQQKQIILTLNHLSREEKEAREKQKIYEKMSRNL.GVLIGVLIILLLL..........................................
R6R0H1_9FIRM/3-172                   .............................................................KLLGAAIVIISGGVLGFYRASRE..RKRLEQGIELKRLLYLLQGEIRYGLTPLPDAIGTIA...........GKM.NA.......EFSVF..LSDVSKKLSS..Y.........QEETFSQVWKNSVEKD....LTP....YVLEKKM...LEPLITMGDTIGYLDKDMQVKTIDFTIEQIEERMYQIKDQVIKNCKLYQSL.GLSFGLLVVIILL..........................................
Q81M39_BACAN/3-171                   .............................................................KIFGAVLIVAVSTFFGFSYAKRY..SERPRQLRLLKAALQSLEAEIMYGHTPLSEAAERLV...........KQM.PK.......PLNWI..FQSFANRLES..-.........GEQTVREAWIDSLKEN....WKL....TAFQQTE...YEILQQFGETLGQHDRESQQKHIRLCITHLEREEEEAKVLQMQYEKMIKSL.GVLAGLLIVILLL..........................................
R9K4S0_9FIRM/3-172                   ............................................................r-FIGGVLVITATTGAGILYSMEL..QEYLEKLLYIRHIIYMIKGEMEYSSAPLSEVFGRIS...........VRV.RE.......PYRQW..LMAMEKQVEE..R.........EEDAFLKIWMRSVDKY....LKE....LHLKSEH...SIQLKELGTYLGQTDGASESRNLQLYLGRLELEIEKVREGMAAKKRIGNCL.GVMGGIFLVVLLI..........................................
R7EXW3_9FIRM/28-183                  .............................................................KLIGAALVVVSCLGVCFEARRAD..RERMALLDGFLRLAVFMRSEIDCFLTPQGRILEKCG...........AGL.LS.......DCGWH..--------EN..V.........PPRDLSELLSVVGDR-....---....--MEPQA...YGILSSFAASLGRCFREEQLRNCDGCIDALTALRGRLETELPKRRRASLSI.VICAAAAAALILF..........................................
J7IMK2_DESMD/3-169                   .............................................................-ILGCMVLIAGCGCLGLWFAYRI..RRRPQELRECSMALALLDTEIVWGATPLPEAFGILK...........ERT.DV.......PWQGF..FGELKERLS-..-.........QGESAGIAWKETMIAQ....NSH....FCLKSED...WNVIGDVGKGLGRSDRTEQHKQIELVQRQLMVIKEQAETWSGKQAKMWSYL.GFLGGIAGVLILI..........................................
R6EWM6_9FIRM/1-169                   .............................................................-MIGSILVLTATSGAGFLYGMEQ..QDYLEKLLYIRHIIYMLKGELEYTKAPLGEVFGQAA...........VRV.RE.......PYKGW..LHGLERQVER..R.........KEDEFFKIWMRSIDRD....LHT....LHLKSEH...VIQLKELGSCLGRMDSTSESLHLKLYVERLELEIEKVRESLSAKKRIGNCL.GVMGGIFLIVILI..........................................
B1B9A5_CLOBO/4-173                   .............................................................KILGSILVLVSSSLLGFIYGENL..KKRFFQLEEMEQALYQLKNEIVYTHNSLPDIFMSVG...........SKG.TK.......PIGDI..FKRVSNLLYE..H.........QVESVHEGFKKALSEN....KKQ....LNLKKYD...IDILLNLSKSLGESDIEGQQNILTLTIRNIKSQLDSAKNVMEKNIKMYRYL.GFSFGAILVIMML..........................................
A6CTX3_9BACI/3-171                   .............................................................KIIGAVFIILSTSWAGFEASRHL..SERPRQLRILKSALQSLEAEIMYGHTPLHEAARKLS...........KQL.QR.......PVAWF..FEVFAKKITT..-.........EETTVSEAWEASLKEV....WKM....TAFKSRE...YEILTQFGESLGKHDRLTQQKHILLTLTHLEREETEALEKQKRYEKMTKSL.GFLSGLLLIILLL..........................................
R5IB37_9FIRM/2-171                   .............................................................KTTGIILIIFSGTGLGLCKSMEL..SGRLKILERLAQLLLLLKGEIRCTGASLEDAFLDVA...........KKM.PG.......EYRLF..LEEMAGRIGE..R.........SGIAFEVIFRECAFKC....LPM....EKISPEE...QECLLSLGEKLGYLDKEMQVAQLTLLEEELRERIRELKSGMPKRQKMYQSM.GILGGILLAVLMW..........................................
A0A124FSU4_9FIRM/3-172               .............................................................KTIACLVIVSAGGICGMLVARSY..SLRPVELRSLKSALQMLETEITYAATPLAEALGLVA...........SRT.DY.......RLAPL..FEETRKELLS..M.........SGCTAREAWEKALLEF....YPH....SSLIGCD...MAILRSLGGALGISDSSGQSKHLSLAMEQIEAELKKAEISALQHVKLWNYI.GFLGGLVIVLIF-y.........................................
N2A3Q5_9FIRM/3-172                   .............................................................KLIGCICILAASSGMAYSCTVGL..QVRLRQTELLSELLTAIEGELTYSRCPLPELLIHLS...........QHM.KE.......PYADL..LLQVSSQMEE..N.........READIPVLWKEACTRF....RRQ....MNLPSEV...YESLLRVGEVFSYSSLDSSLQLLEYTKKKLDAAIRSQYAEFAGKRKLYCCL.CYTAGLFSIIILL..........................................
C5EH42_9FIRM/4-176                   .............................................................KWIGSMLVLFSAGGFGIWSARQW..RERLRLLEKLRQMIYFLKGEITYSHAPLAEALERVG...........KRE.TG.......PLGKL..FTAAAEGICR..Q.........EGESLQEIWRREVQAL....SSPk.irLPLTEED...LEQLAGLGEHLGYLDVDMQERTLKLYLEQLDISIEYLRTNQREKCRLYTSL.GIMGGMFLVIVM-y.........................................
R7AJV0_9BACE/7-177                   .............................................................KICGMALVMASAVLTGRQIACGY..RKRLLELDALRRCMMILNNEIAYSSSALAECFEAAS...........ARCiDK.......EISEM..FADMSRLVSQ..A.........QGERASDIWDSCVNRH....EGS....LHLTDTD...IAELYNFGKSLGYLNAQMQTDSIRLYMSVLETQISDAAAHVDNQCRAAKTL.SIACGAFVCIILI..........................................
K6DTD6_BACAZ/2-170                   .............................................................KLIGAILIIVATTWFGFEAAKKL..SERPRQLRQLKVALQSLEAEIMYGHSSLSEACNHIS...........KQF.EK.......PLSVF..FSRFARRLSE..-.........GETFVSSAWKESLDSI....WNK....TAFGQGE...YEVLRQFGETLGQHDREHQQKHIRLTLIHLEREENDAVEKQGRYEKMVKNL.GFLTGLLIVILLM..........................................
A0A0C2UJ52_BACBA/2-170               .............................................................KWLGALLILFASVWLGAEQSKKL..SDRPKQIRFIRSALQTLEAEIVYGLTPLHESARKLS...........ERL.PP.......PVSEL..FALFSELLTS..-.........TELDASEAWKRSLAKV....WPR....TALMESE...RAILLEFGETVGKHDRLTEQKQILVTLKHLERQEEEACEKQKKYGKMMRSL.SLMGGLLIVLLLF..........................................
A0A0F2JJL8_9FIRM/3-169               .............................................................-ILGCIVLIAGCGSSGLWLADRI..RRRPSELREFLMALTLLDTEIVWGATPLPEAFGIVK...........ERT.DM.......PWQGF..FKDLQERLE-..-.........RGEAANIAWKATILCQ....KAH....FCLKPED...WQVIRDVGKGLGRSDRTEQHKQLELVLRQLTLTKEQADIWSVKQAKMWSYL.GFLGGIAGVLILI..........................................
R6GSG0_9CLOT/1-137                   ............................................................m-----------------------..-------QQYLQFVSYIETEIRYSQRILSEFINEYK...........--N.ES.......EFKLF..LTEIKENLK-..-.........SRASFSKAWTDSVHKI....PNS....YGLLRQE...KELISEFGQELGSTDIDGQIALCNLNKSLISSILDAAKEEKTKKSKLYFML.GTSFGMCIAVILL..........................................
D9SLF2_CLOC7/3-172                   .............................................................KIIGCLFIIVSTSCAGYMLGDKL..RKRVADLKELQRILISIKNELKYSIEPIELTFKKIA...........RDF.KN.......PYDEI..LRIAAAKIYN..N.........EITSIDEAISEALAEK....EMD....LALKDED...KLIFTEFARSLGKWNIGAQEDFFNLSFVKIEEQLNSAEDFCAKNLKMYNVM.GPCIGLMLVIVLI..........................................
A0A0A6VCG9_9BACI/3-171               .............................................................KMIGAVLIVMATTLIGFEISKRL..SERPKQLRLFKSALQSLEAEIMYGHTPLHEASRKLS...........LQM.PK.......PLSTF..FEEFSNQLTS..-.........IETTVKDAWQNSLQHI....WKE....TALKQSE...YEILLQLGENLGKHDRYTEQKQIILTLTHLEREEKEAHEKQNRYEKMAKSL.GVLSGLLIVILLM..........................................
D3E6K9_GEOS4/3-172                   .............................................................KLVGAVLVLGAGTLAGFYQAQQF..AARPRQLRELILALQRLETEISYGFTPLPDALERIG...........VSL.RE.......PLKSL..LASAALYMRP..D.........YGLSAQDSIRKALGEY....WRR....TSMKSAE...REVLEQLSGVLGTSDRQDQIKHIALAVGQLKHEEAAARDDQVKYEKMSKSL.GLLIGALIVILI-f.........................................
R5Q3H4_9FIRM/3-167                   .............................................................KYIGALVVFVSCTLSGLTLCERE..KLKLRQCEAFLSLFEYVKNQIHYFLAPTKQIYRGFE...........DPV.LA.......-KAGF..LAKLCEE---..-.........SGGVYRNNWIDAFEAC....GES....FCLSPAQ...AEIVKAFGSHIGKSNEPMQMRNFEYCIKSMEAETAKQRALCEKNTKLYRTL.GFTLGAMAALLLI..........................................
R7KC87_9FIRM/4-157                   ............................................................l--VAGGLIAVAFTLVGMSINRRF..KMRKEAFASLYDFSVKLKGDISYLKTNLPSVIKSHF...........ENN.KS.......PVAQS..MLKYAEN---..P.........SSEFVPE--------I....---....GCFKESE...KKEVTKYLYSIGSLPYAESLNMTDRMIENYKQLKEKSETEAKKLGSMYFKL.LVLLGFAIMLI--v.........................................
R9MDR4_9FIRM/4-173                   .............................................................KISGCLLVIAATTLTGITRADKI..QEQYRQMRVLQRLLYMLESEIRYAHTHLGEIFLRVS...........RRV.KE.......PYRDW..LLSMEKRMGQ..T.........DSGTFETIWRQAVTAN....LSS....SGLPARE...VERLSQLGAQLGVMDLELQLRVLSLYQEQLSLNMEEVRQEMRTKIRLCHCL.GVMGGLLVAVLLL..........................................
D7GUK4_9FIRM/2-178                   .............................................................KYLGLLCMAAAAVAGGFLLAGEW..EMRVKMLGIFRQMAVYLKARILYSNETLPEALKEIG...........SRF.SDgnsgmaaEAGLF..FLRVEKRMEE..E.........AGKPFAAIWKEEMEKF....PDD....LPLRKQD...LEALQALGENLGYADKKTQERTILFYLEQADDSLAFLKKEMESRTKLYRSL.GMAAGLFILVLF-a.........................................
R5TLB9_9FIRM/3-172                   .............................................................KAAGSMCVLAACIGFVRELLRTG..SLHKEYLEALIELTELLSAEIRYERLPIQEALQQIQ...........KKI.RP.......EIAFV..LRQMIEQMKD..G.........TGTSFSEIWEQAFRKG....GKG....LFLTGEE...LEEVCRIGKHLGFLDQRQQEEHLQGCRERLQRLLRLRQKELEEKKHMYRCL.GVAAGIFVILILV..........................................
V2YJE5_9FIRM/3-169                   ............................................................r-LMGAALIAAGCAVLGFRAAAGL..QAQVRAVGQMAGGLALLEGELELSAPPLSQLMARGA...........ARS.QG.......PARAL..FQDCARGLTR..L.........DREDFPSLWRRLTAER....---....TELGAEG...QAVLLPLGETLGRCGADRQLEALSSARRRLEALSARLESDSRLQGRVYQAL.GLSGGAFLVILLL..........................................
A0A0A5GHD2_9BACI/2-170               .............................................................KWIGALLLLCATTWGGYEFARRL..NNRPKQIRELKNALQVLEAEILFGQAPIKEACEKVA...........NQV.PA.......PLSWF..FKEFSEQLDQ..-.........CGSSLYEVWEDRLKQY....WPM....SALGDGE...KEVMRQFGQTLGQHDFTGQQKHIRLALSHLERELEDALEQQQRYSKMVKSL.GFLTGLLLILLFI..........................................
R5N5V5_9CLOT/5-169                   .............................................................KFIILSGIFCLSTACGITISRKY..ITREKELKEMLNALNIFEEKIKFTYEPIPDVFKEIS...........EKC.IS.......SIGNI..FKSASDNM--..-.........QIMSAGEAWEKAIDES....--E....TKLNKGD...KDTIKGLAKMLGQMDLDGQVNEIRLTMKFLENKIEDAQMERKKNEKLYKTL.GATIGLAIVIILV..........................................
C8WXI3_ALIAD/2-170                   .............................................................KLAGAALVLFACTLIGLRVAQGY..RDRPKALRQLLQALIELQSEVEYHATPIPQALRAVG...........TRL.GG.......WCGSW..LVDMANVLSR..-.........PADSPEIALQNVSLAS....ATS....GTLRDAD...AEPFLRLLRSIAVADRDHLQQPFLAARADLEAAIQAAQDEAIQGARLWQYL.GALAGVFIVLLLL..........................................
D3ACR7_9CLOT/7-176                   ............................................................r-LLGAVLVVVSCSGMGFFLAGQW..GERLKTMEHLRKMIFLLKGEIVYARSALPESFERTG...........KKG.GG.......EIGDL..FVRVAGRMEG..Q.........RGEPFYDIWQEEIEKL....PKA....FCLSKED...RQSLKGLGEHLGYLDLEMQERTILLYLEQLDLTIGYLREHKQERSRLYTSL.GIMGGIFLTIMM-y.........................................
R6N725_9CLOT/5-169                   .............................................................KYFILFLILVFSSMIGKFISKRY..VYRLQELEEMKNTLNILKNKIKFTYEPIPDIFKEIS...........NNS.NK.......NIGQI..FKKAEEKM--..-.........EKTTADVAWEQAVEET....--N....NNLKEED...KNVLKMLSKLLGQTDTDGQISQIEITENFLEGQIKDAMEAKQKNERLYTRL.GTIVGLAIVIVL-c.........................................
R7BI57_9FIRM/5-177                   .............................................................KIAGAVCITAATTFYARGLVLEL..RTRIEGLKFLKQCFCTLKGELRYGVETLPAAFMNVG...........ERC.GVg....geDIRDF..FWNVGRRLGS..D.........EAVSLKEVWEEETKKL....AAR....VNLDGRE...CDNLVRVSESLGYLDITQQINNIDLYLESIEADIAALTEKYADNCRMYMGL.GVMAGLFLTIILI..........................................
C2X2E4_BACCE/1-164                   .............................................................-----MLIVAVSTFFGFSYAKRY..SERPRQLRLLKSALQSLEAEIMYGHTPLSEAAERLV...........KQM.PK.......PLNWI..FQSFAKKLEN..-.........GEQTVREAWIESLKEN....WKL....TAFQQTE...YEILQQFGETLGQHDRESQQKHIRLCITHLEREEEEAKALQLQYEKMIKSL.GVLAGLLIVILLL..........................................
R9JDC7_9FIRM/3-172                   ............................................................r-FAGVVLLMVGCIGSGWSAKERL..KKNLDDLYRIRQIFQMFQSEIAYSKAPIPEACLRIG...........NRT.GE.......PYRSA..LFAVREEMTA..D.........HGELFLDIWHRQMNIC....MRK....LSIAGED...KRLFLDFGSCIGYADEKMQIQAVEQYIYKLDISIKRMEKDMTDKCKVVMSL.SIMGGLVLAIILL..........................................
G7M110_9CLOT/3-172                   .............................................................KLSLSICIFILSTYIGFAYGETF..RKRQNQLKEILKALTILENDVMYGTTPLPEALENLS...........YKV.CS.......PLSSF..TEAIANRLTK..G.........NVESVHQGAVEEFKGL....DKE....FYLNKDD...KKIMEDFFKSLGESGVYGQEKIFFLAIEGIRMNLNDADDSAKKNIKLYRYL.GMCLGAMIIIFII..........................................
B5CM47_9FIRM/3-172                   .............................................................KLIGSILVLTATAGAGYLYGEGL..KDYLRQMEYLRYIAGMIRGQLEYTGAPLQELLMDVS...........AKI.KE.......PYKSW..LEHTARRTAK..R.........TDADFTEIWKGCVEKD....LGA....AGLKKEH...REWIRDFGAFLGQGDRETMGRSIELSMKQMDLMIRQQRGELAGKRKIGNWL.GVMSGLFLIILLW..........................................
A0A089L3U1_9BACL/3-172               .............................................................KLLGAVLVVVAGALAGFTRAAQY..ADRPRNIRGLIAALQRLETEILYGYTPLPEALHRIG...........QQS.KG.......PLQAF..FTAAAEEMSP..P.........LNRTAEEAFQRAVELH....FRS....ASLKGAE...KEIIRQLSCTLGTSDRSNQSTHIALALQQLKQEETVAREDQGKYEKMSKSL.GLLLGVLIVILI-f.........................................
V6IV93_9BACL/3-171                   .............................................................KLVGSLIILFASTAAGMMLARQY..RDRPREIRQWRSALQSIEAEIVYGRVPVDQMAADLS...........KQF.PM.......PLSKF..FQLLHEQLR-..G.........EGLPLQIAWSTSIEHF....WPR....TALKRPE...KEILLQFGTTLGTEDAENQKKHIQLALAHLEREENDARQSQKANEKMLRSL.GFLAGVLFILLFI..........................................
Q2RI95_MOOTA/3-172                   .............................................................KLLGGVLIITTCGSLGLMVARGY..RARIEQLRHLNAGLKMLETEIRYTATPLPLALIRVG...........NQL.PG.......AIAHF..FHTVAGVLKA..D.........AAAGALAAWERGLEDL....RAR....GALEADD...LEILRALGPMLGRSGVNDQVKNLEMTRQLLGQQQLAALEINNRQGRMWQTL.GFLLGVTLVLLL-y.........................................
A0A0P6WU63_9BACI/3-171               .............................................................KLVGAVFILLSTSWAGFEASKYL..TERPRQLRLLKVALQSLEAEITYSHTPLHEATRKIS...........KQL.QK.......PVSWF..FETFSKKLTE..-.........QEISVKKAWEESLNDV....WKL....TAFKAGE...YEILKQFGENLGRHDMLTQQKHIQLALKHLDREETEAVEKQKKYEKMTKSL.GFLSGLLLIILLL..........................................
R6CNW8_9FIRM/3-160                   ............................................................e-LVGAVLLAVSGAAAGSAAADEI..KQQRLALQSVEDMLAQMMIMLEFEAPTVQIMLSELR...........KGS.AP.......---EF..IMRMPEN---..A.........DP----ERICEAIKRC....--P....DGLTEQD...VQKLCTLFGRLGSADKLCEQQRIAGAAAYFAERRKKCEPECRRKEKLAKSL.GLLGGIFFAVMLL..........................................
A9KMD0_CLOPH/7-176                   ............................................................r-MTGCALIIGASTGMGFLFGNEI..KKRMEDLRAAKTIAILLRGDIRYAQTALPEALENIT...........KRH.DG.......RLTPF..FKKVSKELSQ..Y.........SGVSLAEIWESAMKEE....LLN....TSLTKKD...RTCFLEFGKQLGYLDKDMQMNHIDWYITQVEEDMQEINLDAKEKIRLYRSL.GVLLGIFVTILV-l.........................................
A0A078KSP3_9FIRM/4-171               .............................................................KYAGIAVFIFTCTAAGFMKSLSL..SRRVKELETFISALSFIATEIRYFASPTPVIISKIK...........SKE.EY.......AGLHV..FEICEKNLL-..-.........TTHDFKKSWTSALDAS....KQY....LSLDAGD...IETLKCFGNTFGTTDIEGELANCEHYINSMKVRLESARIDKTKRGRMYSSL.GLLTGVLIAAVLI..........................................
A0A167UDW1_9BACI/2-170               .............................................................KWIGALLILLATTWTGFETANRL..SERPRQLRQLKTALQALEAEIMYGHTPLSEAALHLA...........NQL.PL.......PLSRF..FQQFAETLQT..-.........GETSVKEAWQESLQSI....WGA....TALKHGE...FEVMKQFGETLGQYDRMAQQKQIALAIVHLEREEQDALEKKARYEKMAKSL.GLLTGLLIIILLI..........................................
R6TCG4_9FIRM/3-165                   .............................................................KLLGSLLILGGGFWARWSMVSVC..RRELDTLSELTACLTEMAEEIRLARTPLPELLDRLS...........RGR.GP.......EVTAF..FTAVAGAA--..R.........RGGNVAQVWRQAAEE-....---....LPLCDED...RDILAEAGRHLG-GDETSVCKGISLVISHLGRSLEEQRRSRGEREKRVTAL.CFSGAALLVILLL..........................................
A0A101WDJ5_9FIRM/14-183              .............................................................KIIGGLLVISASGLLGILFSNRL..SLRYKELNNLRRFMQMLETEVTYGATPLPVALKNTS...........NKA.EG.......LISSF..FICISNSLTD..R.........SFYTVWDAWTYAAEAV....LVG....SSLQRAD...IELIKSFGSILGCSDREDQKKHFELFYLQLKHQEDAAQAEIKRSAKMYRSL.GFLLGTAVFIVLI..........................................
R6Z5K6_9CLOT/4-173                   .............................................................KVLGAFLVVLSCSRLGVYMAARL..SERRGLLKKIRVMVIHLRGEILYANAPLYEGFQKAG...........RRS.GG.......REGLL..FETVSEQLLK..E.........QGKEFFAIWQEAVTSY....LPQ....TPLTKEE...GEQLLAFGEHLGYLDREMQERTLSLYLEELEREMEELNQEIAQKGRLYTSA.GILTGLFLAVIFI..........................................
W4PYN7_9BACI/2-131                   .............................................................KLFGAIIIILATTWVGFEGAKRL..SERPKQLRQLKVAIQSLEAEIMYGLTPLAEASEHIA...........KQI.PN.......PLSRL..FEQFSNKLLT..-.........KQETAFEAWEESVNEI....WGQ....TSMLDSE...KEVMMQFGSTLGQHDREQQQKQIK---------------------------.-------------a.........................................
A0A0M5JFD2_9BACI/3-171               .............................................................KLIGAIFILISTTWAGFELARHL..SERPRQLRQLKSALQSLEAEIMYGHTPLHEASRRLA...........AQL.SR.......PLSWL..FESFGNRLAT..-.........TETTVKEAWDESLREV....WKL....TALKQGE...FEIMSQFGETLGRHDRVSQQKQIQLTLNHLEREEAEARDKQSKYEKMMKSL.GFLSGLLLIIVMI..........................................
D5DS81_BACMQ/2-170                   .............................................................KLFGAIFILFASTYTGFEFAKQL..SARPRQLRQLKTALRSLEAEIMYSNRPLQEVAHLLS...........LQL.PN.......PLASL..FNEFSMKLKE..-.........GTESVKEAWEKTLDQF....WKQ....TALKTGE...LEILKQFGETLGQHDRYSQQKHILLTLNHLEREEQDAVDKQNRYEKMVKSL.GFLSGLLLVILLM..........................................
A0A0M0GNQ1_9BACI/3-171               .............................................................KIIGAIFILLSTSWAGFELSKVL..TERPKQLRSLKSALQYLEAEITYSHTPLHEAARKIS...........SQL.TS.......PVSLI..FDSFSRKLTK..-.........EEISVRRAWEESLDVI....WKM....TALKKED...YEILKQFGQTLGRHDIVTEQKHIRLAMLHLEREEVEAAEKQKKYERMTKSL.GFLTGLLLIILLL..........................................
R7GUZ7_9FIRM/2-166                   .............................................................KWIGLIFLILCGAMAGMACSGKL..RMKLERTEKLCSFLREMGVLMQYQMSTLGELLDTFS...........NRS.VY.......QEFQF..LSQTAAHMQ-..-.........QQTPFVQAWSEQVQAE....---....KHLSPEV...KEVLLELGEELGRTDLEGQLSALSQAHIQLQRFQDTYRVTYQKKGKLYRSL.GLLAGLLLAVLF-c.........................................
R7BSC6_9FIRM/6-166                   ...........................................................rl--VAGGLLALIACYIGVLIKRRY..AKRVTFFKSACEFSSCLATELSLKKTPMPKIASKFL...........QGR.EG.......EFESC..VECWINL-AK..R.........GGVYAFE--NANV---....---....SILKTDE...KKQLASFFSALGKTDLKDQLSHVGYYKNVFEQKQKVCEDESKKLGNTYFKL.CVLAGIAIMLIL-a.........................................
G7W852_DESOD/3-169                   .............................................................-IMGCIVLIASCGCLGLWLAYRI..RRRPLELRECSMALALLDTEIVWGATPLPEAFSIVK...........ERS.DR.......PWQGF..FAELQERLV-..-.........RGESAGSAWKETMTNQ....KDK....FCLKTED...WLVIADVGKGLGRSDRSEQHKQIELVQRQLLLIKEQAEIWAYKQAKMWTYL.GFLGGIAGVLILI..........................................
E7GNS0_CLOSY/4-173                   .............................................................KTLGLILVIASCSGIGAEAVHRL..RERLRLLETLRRMASHMKGEILYANVPLAEALYRTG...........KRN.KG.......AAGEL..FIAIATELEQ..E.........TGESFEAVWRAKAGKF....AAG....SVLNKKE...QEQLLRFGESLGYLDRDMQEKAILFYLEDLEHSIETLRKEEPEKSRLFFGM.GILSGLFLAVVLI..........................................
R5N3Z3_9FIRM/1-102                   ...........................................................mf-----------------------..------------------------------------...........---.--.......----F..IKDARERFR-..-.........RGDSFSSAWKNAIDKN....KSD....TCLPQDC...IEKLKAFSDTFGSADKQSELENCDTFISYFELRQKELHERAASAPRVYGSL.GVLFGALAVIVLF..........................................
A3DDQ0_CLOTH/4-173                   .............................................................KIIGSLIVFMSSSLLGYMYSRRC..SKRPAELRALQGYLQMFETEISFMSNVLKDAFTKIY...........MYD.DS.......SVAVF..FKGTVEALEN..D.........TGITAGEAWAKAVKEN....IKN....TSLNKED...EEIIISFGKMLGSSDVEGQIKNIRLTINQLKLQEQKAEELRAKNEAMYRNL.GILGGLAIIIILF..........................................
S6FMM2_9CLOT/1-134                   ............................................................m-----------------------..--------------LLLNNEVMYTNTPLPEALRYVA...........LKV.DY.......PLRNL..LLKVSENLVK..G.........ECESVYEAFKTEYKKE....KHE....FRIIEED...KLIISDFLKSLGESGVYGQDKIFNLAIENIKGNCKTSEVIASKNTKMYRAL.GLCIGAMLSLFLM..........................................
C8W107_DESAS/3-172                   .............................................................KLLGSIIIISACGMAGLVKARTY..TRRTGELRSIQSALQLLETEIAYAASPLAQALHSAA...........ACG.EK.......NVAGL..FLRASQELLS..M.........TGQTAGEAWDKALAVF....YPQ....SSLNRSD...LLILRNFGSTLGVSDREDQIKHLCLTQEQLRAEMEKAEAEAGSNVKIWNYF.GFFGGIVTVLILL..........................................
R9M6D8_9FIRM/3-165                   .............................................................KLFGSACILGGGILARYFQVAER..RREMDTLSDLLWALRRMAEEIRMARTPLPLLLDRLS...........KGC.GR.......EAGAF..FQEVSTAA--..R.........RGEDLGVAWRQAAAA-....---....LPLSAVS...SAALAGMGNDLH-GDEENICKAISLVIYSMAQDMEERTRRQPEESKQAAAL.WFSGAALLVILLI..........................................
A0A0C2R6T6_9BACL/4-171               ............................................................h-WIGALLFITGSSLEGFRRSNQL..QKRQLALIEFAQALTWMQNEIVKRQTPILEIIQTQI...........-QR.KG.......EVGEL..FGFFQDQLT-..M.........NQSLLKEAWTKAVLAY....KPT....SNLSVED...LEWITRVGDAVQPYDRQSIEKELSFIIDMLRSRHQEARNLALQMGKVYKAL.GVMGGILIVLLL-s.........................................
A0A101WSY3_9FIRM/2-169               ............................................................l-IIGCVALIAGCGSLGLWLAHRI..RQRPAELRECLMALALLDTEIVWGSTPLPEAFSIVK...........ERT.DQ.......PWQGF..FAELQERLQ-..-.........LGESASLAWKATILKQ....NRH....FCLKQED...WQVISDVGKGLGRSDSHEQHKQLELVQRQLALMKDQAGLWSDKQAKMWSYL.GFLCGIAGVLILI..........................................
A0A0M1UYE2_CLOSO/4-173               .............................................................KIIMISILVACSYLIGEYIYKAY..TKRHKQLNELIRILEIMRMDLAFGLYTLDEMFFRIG...........ENK.EM.......SFHMV..FKNICKDLRD..E.........NNKTLESILDKNLEDM....GKD....TYLQDRE...IEELKNLILTLGKGDIESQERMIDLSISNLKKMTEESLEDINKKGNVYKKL.STIIGLVIGIFLM..........................................
A1HQ77_9FIRM/4-173                   .............................................................KLTGSLLVVTAGTAIGFLMAWRY..GERPRQIAQIISCIVSLKSYINYAAIPLPEALARCS...........VGI.NG.......PVAEL..FGRMAQMLQK..E.........SWLSPQEALRRALGQA....DSR....LVLGRPE...LEALLLLGANLGAMNREEQQKQLDLVQHELEKAEREAIAQRDPNMKMYRYL.GVCGSLAIVILLV..........................................
F4A170_MAHA5/4-173                   .............................................................KLILSAVIVIASAMIGNIYSMKY..AIRVTQLRRLQTALQMLETEVIYRYSPLPEAFKSVA...........LSM.KG.......EIQCI..MEDTASMLAD..R.........KGYTIDHVWETALKHY....AKS....MALTSDD...IGILLNLGKTLGSSDADNQIKYFELILNQLRQQEKYAEAEKAKNQKLYNNL.GILGGLGIAILIL..........................................
R6GDG8_9FIRM/4-172                   .............................................................KVIGALIVVTACSLMGFALANEY..IAKINNLDAFKKSLRILKGKIKYDNLSVFEAMELIK...........-IN.NN.......VIENF..YHKVSEVYF-..M.........EEKTLFESWKMAVNKY...lKKE....IKIDKQE...TDVILTFGTNLGVTDRETQLSNIDECINDIQEVILQLKEEKNNKCKLYKCL.GTFSGILIAVLLI..........................................
R7HEM6_9FIRM/3-173                   .............................................................KLCGAVCIVAGTTCYGLFYAFQK..KSRLWRLKQFKESLLCLSGQLRVARMTMPQALAQIG...........QKS.RY......dYLSQF..YIFVSENLEQ..H.........TYSGFWETWAAGIDSY....VRD....IYLTESD...SEILKNIGSIPLHLDIQMQLAFLEENISELENLIEETQKDIRARCRIYQSA.GVIAGLVIVLILI..........................................
R6TB59_9FIRM/3-162                   .............................................................KLIGCVLIISACTQMGCAMALDK..IRQMKYLKLLRRLIFETRAMVDGGM-TFGEIILKLS...........--L.QK.......DYSDF..T-FLSQD---..T.........SSPDVRRRITEDIYNS....---....KLFDNEI...RQTAIDFFEKLGTTDTNGQLAYVSMSLAALDEQISRLSENFTSQVRLCRAL.GVLSGAFIAIMLI..........................................
K4LIS2_THEPS/22-190                  .............................................................-LLGAVMIIGSAGLAGMLRASYF..SRRPQELRLLQEVLQMLDTEIMYAATPLPDALLKIG...........RTG.EG.......VIARI..FTFAGEALVQ..E.........RGITPAEAWERALRQN....WQL....TALSKED...QAILSAFGERLGISDREEQHKNIALTSLHLRREEEKSQREREKNERLWRYG.GFLLGISIVLLLL..........................................
A0A0Q9RAB7_9BACL/3-172               .............................................................KFIGGVLIIGAATLFGFLKAAHY..VRRPKQIRSLISALGRMETEIMYALTPLPEAFVSLS...........KQV.AE.......PLSSL..FRITSERLLK..S.........DGKSTREIWQWSVNDV....WTR....TSMKQAE...QEVVLQLGAVLGLTDRSDQIKHLRLAISQLQTEETESREEQRRYEKMWKSL.GVLIGALIVILM-y.........................................
R5KKD4_9CLOT/5-156                   .............................................................KILGILLINLVCAATGAYYALKT..KDRCETARQLIQMADMMSVELSFSADNSRKIINRLR...........KEK.SL.......-----..----------..T.........KLGFLNDIDLENIDIK....---....TGLDPAD...DEKVNMLFRNLGSTDVSSMLKIINSFKESISASLKGYTEYSRSHSRLFVAF.GILGGLAVSIVLI..........................................
F8I9H1_SULAT/5-169                   .........................................................kvtg------LVVTGGAILGITRQAGFpyRQRVRVLEEWERALARLVPLIGWRHLPLKDACRLAV...........-KG.LP.......MIGPY..WLRMVASLD-..D.........REVDFLTAFNTMVDHL....---....PGLWAED...RPVLQEVGRLLGQSAAVYQEALLARGLADVSRLLEEARQQSQSDGRVMPAL.VGAVGALLLILLL..........................................
A0A098F2A5_9BACI/3-171               .............................................................KLAGALFILAATTWTGFELSRNL..SERPKQLRQLKAALQSLEAEIMFGHTPLHEASRRLA...........AQL.PG.......PLCGL..FEKFGERLA-..M.........TETTVKDAWDESLEEI....WKL....TALKKEE...LEIMRQFGETLGRHDRLSQQKQIQLTLSHLEREEAEARERQSKYEKMFKSL.GFLSGLLVIIVLI..........................................
A0A0M1NX35_9BACI/3-171               .............................................................KLIGAAIIIIATTWAGFEAAKKL..SMRPRQLRQLKVAMQSLEAEIMFGHTPLKEAARKLS...........KQM.AK.......PLSSF..FDTFANRLES..-.........GETTVKEAWDDSLKKI....WQS....LALKQGE...FEILSQFGETLGKSDKYHQQKQIMLTMAHLEREETDALDRQGKYEKMMKSL.GFLSGLLLIILLM..........................................
A0A101HYG4_9FIRM/3-172               .............................................................KTIACLVIVSAGGICGMLVARSY..SLRPVELRSLKSALQMLETEITYAATPLAEALGLVA...........SRT.DY.......RLAPL..FEETRKELLS..M.........SGCTAREAWEKALLEF....YPH....SSLIGCD...MAILRSLGGALGISDSSGQSKHLSLAMEQIEAELKKAEISALQHVKLWNYI.GFLGGLVIVLIF-y.........................................
A0A073KBB5_9BACI/3-171               .............................................................KIVGAVLIVAVTTFFGFSYAKKY..SERPRQLRLLKAALQSLEAEIMYGHTPLSEAASRLE...........KQM.PK.......PLNWL..FYSFYERLEA..-.........GEQTVREAWIDSLEEN....RKV....MAFQDAE...YEILQQFGETLGQHDRESQQKHIRLCITHLEREEGEAKELQLQYEKMIKSL.GVLAGLLIVILLL..........................................
R6ERA2_9FIRM/3-171                   .............................................................KLIGLLGLVIACGLSGIMKTGDL..KKRVALLEDYLQMIIELKGQINYFREPLPDIFDKLK...........KND.RS.......AAYII..LDSLGTQLRE..-.........KGGEIVKIWPEKVEEI....YKS....EPVTADD...MEIMKYPGEFIGQTDFENHIYHFTYLEEKLKKQIIEAQESYKKKGPMYSKI.GFFLGSIGAIILF..........................................
R9IWS1_9FIRM/3-170                   .............................................................KLAGSFLVIVVSLLYGWKVKEEL..KAHVDQLVGMKEMLLMLQGEISYARTPLKEAFWQMS...........SQG.KE.......PFAAF..LKKAVEEID-..G.........NEESIGKFWGRLVEEA....-EN....FSFSQEE...KELLKRVGENFGYLDTQMQLKNLELYLGQVDVLIRKAQKELKDRQKVASVV.SLMCGLFLVILLI..........................................
R5IGU5_9FIRM/1-147                   .............................................................----------------------M..RRQQAQTLALIDALLRIRHELQYRLTPLPEIFAALG...........GSR.NR.......EIAEF..FSRLAALLSS..A.........QTCTVGYACRQALAQT....-RG....LSLSSAA...RGTILNLFDSLGRYDLEGSVQALDLALSRLREEVKALQNSAAARCRTYLTL.GVCTGLAAAVILI..........................................
B0K9D1_THEP3/2-170                   .............................................................KLLGIVLVIFSTSSLGYLFALKY..KMRRWILKSMISSLNLFKIEITYSKAPLGEILMAIS...........RSS.DK.......SIKFV..FSKTGMILSQ..N.........EGYTAGEAWEIALKE-....WDN....GYLKKED...VEILRSFGYGLGNSDVYNQEKNFDLAIELLKRQLSNAEEESKKNEKLYKNI.GVLAGLAIIILFL..........................................
M8EE36_9BACL/3-172                   .............................................................KLIGAVLILFSASMVGWQIGRFY..AYRPVQLRALLVGLQMLETEIVYGLTPLQPALLKVG...........NRL.PT.......EIGQL..FQTAAGSLRE..E.........RAQNADEALRLAIDRH....WQQ....TSLRKQE...RDVLTSLGQVLGSSDREDQQKHLRLAVTHLRGLEEEARAEQNRYEKMYKSL.GFLCGLLVVILMF..........................................
R6R314_9FIRM/4-172                   ............................................................s--IGICMILAVTTLTGAYFCLRE..KYRLQDLRELERAMVMMESQIRFLSVPLSEVLENIS...........YQT.GG.......QVGML..MEETAKAMAE..R.........TGETAEQIWEAVWMRH....ISH....TYLSGED...YQSILRFGKTLGYLDQEQQKNSTELFLTELRQKCGQIERRLEKNGRLYYSM.GFLGGLMLVIVLL..........................................
W4V483_9FIRM/4-173                   .............................................................KIIGSLIVFVSSSLLGYMYSRRC..SKRPGELRTLQGYLQIFENEISFMSNVLKDAFSKIY...........MHD.DS.......GVAAF..FKGTVDALEN..D.........SGLNASEAWTKAVKEN....IKN....TSLNSED...EEIIISFGKMLGSSDVEGQIKNIRLTVNQLKLQEEKAEELRAKNEAMYRNL.GILGGLAIIIILF..........................................
F4XAH5_9FIRM/3-169                   .............................................................KLVGAVLVAAGSGWLGLSAAAGL..TKRLRAVQSMIVGLELMERELWERGAALPELMAALA...........RRC.SQ.......PAAGF..FQRCAEGCTR..L.........DQVPFGESWRQAVDEL....---....ELLSPDG...RAALLPLGEVLGRYEADSQRQALEHARQALEREEQRAQEERRRLGRVYQAL.GLSGGAFLVILLL..........................................
C6PQS6_9CLOT/3-172                   .............................................................KILACIIIIIASTAIGFNYGEGF..KKRTKQLNELQRCINQLQNDMIYTFTPLPEAIYNIA...........EKS.KD.......PIKSI..FKEISSLLFS..N.........AVDSSYDAFYKVFKDK....KEV....LNLNKED...LNVILDLAKTLGECDIDGEKRMFSLTLSSLKKQLEGSEISMNNNVKMCRYL.GFSLGAMVVIMLI..........................................
R7R618_9FIRM/4-173                   .............................................................KTVAAALVLCGAQGFGYALCQEM..KCMLYHDTEQKQMLLYMTREIAFLHRPIQEILEQIG...........EKL.QE.......PYRSL..TLEVACQMKK..E.........DGRSLHTLWNEQTYKL....RER....RYYPPAA...MDNLARIGECLGCEEDEMQIASLRLLMGNLDEEIEKIKCRKEERSRLIQTL.SLLAGIFCIVLFL..........................................
A0A0A7FV67_9CLOT/3-172               ............................................................r-LIILMFIFMSFCFMGYVYGDKF..LKRHKRLNEILKSILLLQNEVIYNLSPLPEALFSIG...........TKS.RE.......PFNKL..FLDVSDILLK..G.........DGESVYEVFKQEYKKN....KED....YYLLEED...ERILSDFFKSLGDLGIYGQDKMFDLVIANLKLNIKDAEVIAKKNTKLYRYL.GVCIGAMIVIFLL..........................................
T0E9B9_CLOSO/4-173                   .............................................................KIIMISILVACSYLIGEYIYKAY..TKRHKQLNELIRILEIMRMDLAFGLYTLDEMFFRIG...........ENK.EM.......SFHMV..FKNICKDLRD..E.........NNKTLESILDKNLKDM....GKD....TYLQDQE...IEELKNLILTLGKGDIESQERMIDLSISNLKKMTEESLEDINKKGNVYKKL.STIIGLVIGIFLM..........................................
R6XGN9_9CLOT/5-169                   .............................................................KLIILNLILVSSTIIGITFSKKY..TYRVKELQEMKNALNIFMTKIKFTYEPIPSTFLYIS...........EKV.EG.......NVSKI..FKNATEEM--..-.........ENKPAGEAWDKSLDAI....--V....TNMKKED...IDIIRNLGRLLGKTDIEGQISEIKLVNNFLDIQIKDAEEEKNKNEKMYRTL.GIVAGMTITILLI..........................................
H3SFE1_9BACL/3-174                   .............................................................KLLGSALLIAAAASIGWLKAASY..AARPKQLRLLNHALQRLETAIMYGHTPLAAAFAEIS...........RQL.PS.......PLRAV..FADAAQGMDA.aD........aIPLTAREAWQLSWERH....RGN....TALANED...LRILLELGYSLGISDRDDQRKHIRHAIKQLEQEEFVAREEYQRYGTMCRSL.GVLSGLLAVILM-y.........................................
D7CKG4_SYNLT/7-176                   .............................................................KIVGGLLTFLACGAYGLAGAKSL..DNRVRQLKSIRFALAILEKEITYLQNPLPRALQKTA...........LLA.EP.......PTRQF..LAVAAGCLER..R.........GGVTAEEAWLEGIKTL....QEN....SDLSETD...LFLLQSFASRLGMSDTEEQKKAFQLLGEEIKQLEDSAFKTAATEKKLWTYG.GFLLGTLVVLLLL..........................................
A0A0U2UZU1_9BACL/3-172               .............................................................KLIGAALILFAGTMIGFQQAARL..AARPRHIRTLLHTLQRLETEIGYGYTPLPEALERAA...........EHT.PE.......PLAAM..LKEAAKRLDD..A.........DGPSFRESWSRAIEGH....WAN....SAMRSPE...KAALIRLGSSLGISDREDQVKHLRLAMQQLKAEEDAARDDQERYEKLCKSL.GVLVAALIVILI-v.........................................
R7RPT6_9CLOT/3-172                   .............................................................KILGAMLIIMSTSAMGYLYSFGY..RERVRQLRELQFSLNSLSSEILYASNPLWIAFSNVS...........KVC.TS.......PFKEL..FLKISENLKN..R.........STETLVEAFNLAYNEY....KEE....FYLEKED...IELLNTFIQGLSSNDTEGHKKNFNIAIKKLESIEKDAEDKRQKNEKLYNYL.GVLCGLLIVILLV..........................................
R6H489_9CLOT/5-169                   .............................................................KYSMLLLVFISSTLIGKYIAQHY..YYRLKELEDIRTALNILKSKIKFTYEPLPEIFNEIA...........KNI.NK.......NIAQL..FENSTKKM--..-.........ENKTATEAWNESIEEY....--K....GNLTEED...KQVIKTLSKMLGTTDSEGQISQIEVTENFLDNQIKQAQEEKNKNEKLYKKL.GSTIGLAIVIILI..........................................
A0A167DHF1_9BACL/3-172               .............................................................KLIGMLIIVLSGTLAGISKARQF..ENRPRQIRELILAMQRLETEISYGYTPLPEALDKMG...........AQM.RE.......PLKSF..FQNAAQYMNA..P.........HGLTAQESIQQALNNH....WKH....TSMKSLE...MDVLHQLSYTLGTSDRQDQIKHLALAAQQLKHEETAAREELEKYGKLSKNL.GFLVGILVVILI-f.........................................
R5Y419_9CLOT/4-173                   .............................................................KIILVGMLIGCSYLVGEDISKRY..IKRHKQLNDLIRVLEIIRMDLAFGMYTLEEIFRNIS...........LKD.EY.......DFNEF..FSKFADELSK..E.........DGKTIDNILNETIHIL....YKD....TYLKENE...IEEFKKLILSLGKSEVESQERLIDLTVENLKKLTVESKEDIKNKGNLYKKL.ITFSGICIGIILI..........................................
R5QH78_9FIRM/3-172                   .............................................................KVIGGILILSATAGAGVVYGNEL..KRYLRNMVYLRYVFGLIRGEIEYTCAPLPEIFFGVS...........ARV.KE.......PYRRW..LKKTAEEMEC..R.........DLSGFARVWNRCTDKY....LEI....PGLKQEH...KILIKEPGTFLGSFEKDISDRAMEMYLNKMDLEIEKLRAELASKVKVGRCL.GVMAGLFFIVLLI..........................................
R6NPU3_9CLOT/3-170                   .............................................................KTAAALAVALGFALGGKCVASFY..AGRVRVIRESLLLISAVETGVRFAHLTVEQLLRELD...........KNG.GF.......VYLDF..IADCRRRME-..-.........SGEPFPSAWRKSIEQR....GEL....CRLLGEA...KEYLAALGSDIGATDVDGQLNSCGYYKRLLTAELEQREEKNRRSSKLFPAL.GVMLGVSAAIMMI..........................................
R7DBE8_9FIRM/3-172                   .............................................................KLVGAVLIIFASAGLGYLKSKEL..MLHEKNLEEFLQVILCLKGEIRCGNSSLSDALRDTA...........CRC.RG.......RYEEF..LERVAACIEA..N.........TEEKLSIIFQNCTENY....LTD....LKLDEDE...RRKISLLGEKLGYLDREMQIRQLELYETDFLYLLQNLRKDKEEKKKIYRSL.GAMGGILLAILFW..........................................
R5CZB5_9FIRM/2-169                   .............................................................KLLGAVLLTAAASVMGFFKAREL..KASSQSLREIISLLELMRNEICTRRTPIKQIFSCSN...........LPD.YR.......YMNSF..ISSLETELSS..L.........GSKSFTQIWCENAEKT....L--....QMLSKSS...RQALKDLGSSIGKYDAELQAASIDRCISELSSEYEKLNEGLKNNEKMYIGL.GTGIGLIAAIILV..........................................
A0A0Q9MVZ6_9BACL/3-172               .............................................................KFVGGVLIFGAASMYGFMQAAHY..VRRPKQIRILIGALGRMETEISYALTPLPEAFASLS...........KQV.AD.......PLSTL..FRLMSERLLG..S.........NGESTKDLWQMTVKEV....WSR....TSMRQAE...QEVILGLGPVLGLSDRSDQIKHLRLAMSQLQSEETDARDEQQRYEKMWKSL.GVLIGALVVILM-y.........................................
R5UPW6_9FIRM/3-171                   ............................................................r-IFGTVLILAGCAGFLYKWAEGE..KARQRMAGEWIRLFVRWGYALEQEHVRLCD-FLSFY...........ETA.DA.......SMQAF..LDEVCVCMRN..H.........QNPSGQKIWQDCLQKH....KRE....LQIGQEG...WEILTSAAGAFYGESSAENLRCNEICRKRMEKFLAESRLEFFKKQRVYLPV.GMLTGVVMIILLV..........................................
D4LE91_RUMC1/3-165                   .............................................................KLLGLLLVVGTGGMLGLQKAKQL..QNQAAWLAALEGFLRSMQTEIRYLAPPLEQLLSQLY...........AQP.AY.......QSLTF..LSGTASYL--..-.........GQMPFGQAWSRAVRE-....---....ACSHREA...KQVLLQLGGELGNSDIDGQLAAIGLAEERIHMLLESARQQSREKGKLCTAM.GTLLGTLAAILL-a.........................................
A0A176U8T1_9FIRM/2-169               .............................................................KLAAAVIIAGTLLSIGFCMETSR..KETAKQLQELIRFLLFAGQEIEIRGSILEDVFTKAS...........SIT.QG.......ATKEL..VSRMAKRMA-..-.........EGGDFLQEWSHAVNEV....YRR....MGWNEQE...EELIIHCASDFLLFERGMVKEQLFFDAKQLSQLYEKRITKLGNECKLCRVL.SFCAAAFLLILLW..........................................
W4CUC3_9BACL/3-172                   .............................................................KLLGAVLIVLAGTLAGFKRAAQY..ADRPRHIRALIAALQRLETEIQYGYTPLPEALRRIG...........MQT.KE.......PLRAF..FLTAAEEMNP..P.........HNYSAEEAIRRAMEAH....WSS....ASLQGTE...KEIIRQLSCTLGTSDRPNQSTHIALALQQLKQEETVAREDQGKYEKVSKSL.GLLLGALIVILI-f.........................................
R6DUA5_9CLOT/3-171                   .............................................................KIAGVLLILTGCTGVGLYTAMRY..LIRIHLLEEIEQAMQFIYSEIEYAACDMVEIMHMLA...........ARS.NA.......-CRMF..WCRMEEALLS..C.........EGKLFYQNWKEHITGI....EGY....SCLKTEE...LLLLQELGKNLGNMNRDAQLHTIRLFLERLHAILLQAKGEYREKRKISGIV.GITAGIFISVLLV..........................................
G2G096_9FIRM/3-169                   .............................................................-ILGCVALIAGCGSLGLWLANRI..RRRPAELRECLMALALLDTEIVWGVTPLPEAFCIVK...........ERT.DL.......PWQEF..FAELQERLQ-..-.........RGESASPAWKDTISTQ....YKH....FCLKQQD...WQVIRDVGKGLGRSDSQEQHKQLELVQHQLTLMKEQAGIWSEKQAKMWTYL.GFLCGIAGVLILI..........................................
B1I3A8_DESAP/3-172                   .............................................................KLAGAVILIGSAGALGLLVARGY..ARRPHELRAMHSALNLLETEIVYAAAPLAEALEQVG...........SRA.EK.......CVSGL..FIRAQAELAA..G.........AGTTAQEAWEWALAQY....QPD....SYLRPED...LAVLEGVGKVLGTSDRQDQARHLRVARERLQAQILKAEDEARRNVRLWRYL.GFFAGCAVVLILV..........................................
R4KFS4_9FIRM/3-172                   .............................................................KLIGGLLVVAASGLAGWQVSRSY..ARRPVELRQFISALQLLETEITYAATPLPEALAGVA...........EQV.DV.......PAASF..FRQIAGDLGA..H.........RGCSAREAWHGALECY....GHR....SALGRGD...LSVLRGLGNSIGISDREDQSKHLRLAAEQLKTALAMADAAAAKNVKLWNYM.GLLGGLIIVLAL-y.........................................
A0A0Q3VZA5_9BACI/2-170               ............................................................r-WIGALVIIFSTSWLGFYFARRL..SERTKELRGWKLALQSLEAEVMYSQLPLQEAFRRIS...........SQL.KG.......PINSC..LQDFAIQLET..-.........SAFSAKEAWENSLMKY....AKT....VSIKESD...IQVLLQFGETIGMHDKYSQQKQIILALKHLEREEQEAIDSQGSYERMSKML.GVLSGILIVILLL..........................................
R6YYS9_9CLOT/10-174                  .............................................................KYILLLAIFALSTAIGLLIAKSY..QNRVVELKEFKNILNIMKTKIKFTYEPLAEIFKQIS...........KDN.ES.......EVEKI..FGQMANQI--..-.........TYYQAKDVWENCIQDA....--D....ISIKQED...KDILKKLGKLLGQTDIEGQISEIEVIENFLDMQIENAEDERKKNQKMYKTL.GIVAGLVFVIILF..........................................
D9QRW5_ACEAZ/3-172                   .............................................................KLAGSLLIVGATSWLGFLKADQL..IQRTKQLQQLQIAFQALEAEIMYAAVPLPEAMGKVG...........NKV.DS.......PAADF..FLVSKEKLKS..E.........IGITARQAWQEAVEEV....FPN....TALMIED...KEFLLNFGNNLGNSDRTHQEKNLQLVQKELKQAKEASVTAKKSGVKKWRYF.GILGGLLIVILL-y.........................................
H5XSI9_9FIRM/3-169                   ............................................................v--IGCIALIAGCGFLGLWIAHRI..RRRPIELRECTMALALLDTEIVWGATPLPEAFNILK...........ERT.DT.......PWQGF..FAELQERLQ-..-.........RGESASTAWKETVMAQ....NAH....FCLKPED...WLVIGDVGKGLGRSDRTEQHKQIEFVQRQLSLIKEQAEIWSGKQAKMWSYL.GFLGGIAGVLILI..........................................
A0A0K0GEY4_9FIRM/2-170               ............................................................n-WIGALLLISTTTWLGFDWSNRL..SNRPKQIRQLKNALQILEAEIVYSQLPLKEAFLNIS...........RQI.PE.......PTRFF..FEEIGLSLQ-..D.........KNIDFYIIWKEKVDAL....INN....SSLAINE...KEILYQFGRTIGQHDFYQQQKHIQLTLSHLERELEDAREEQYKYSKMAKSL.GFLAGLFIVLLLI..........................................
G2TPR1_BACCO/3-171                   .............................................................KLFGAALIVFATSFIGFEAAKRL..SERPRQLRIFQSALQALEVEIMYGHTPLHEAARKLS...........DQL.PD.......PAAAF..FRSFAGQLTT..-.........LETTVKEAWEKSLDGI....WEL....TALKENE...YEVLRQLGENLGKHDRYTEQKQLLLALSHLEREEKEAHERQLRYEKMAKSL.GVLTGLLIAILLI..........................................
K4L1Q4_9FIRM/3-169                   ............................................................v--AGYLGLIIGFGCLGIIRANQI..KKRPQEIREMINALALLDTEIYWGATPLPDAFQVLK...........ERT.GP.......PWQLF..FASLEEWIR-..-.........AGENASQAWKKSIETH....RRK....TCLTDDD...WLVISGISQGLGRSDRNEQHKQLELVQRHLAGVDEKARQQAESRAKMWSYL.GFLGGIAVVIMIM..........................................
E3E4Y7_PAEPS/3-172                   .............................................................KLLGAVLVILATTLAGWQRARQF..AMRPRQIRELILALQRLTTEVSYGVSPLPDAFAKTG...........EPL.RE.......PLRSL..FQQASRWMHP..S.........FGLTARESLHKAIEVS....WSR....SSMKQAE...KEAMRQLAYSLGTSDREDQIKHIALTIQQLSHEEAQAQADQVRYERMSRSL.GLLIGALIVILI-y.........................................
R5UCV0_9FIRM/3-172                   .............................................................KLIGCILILLSTTAGGFLYGVEQ..QQYLEKLMYIRHILELIQGEIEYSGAPLFEVFGKTA...........NRV.QE.......PYRSW..MLDLKRRVEA..R.........GGQSFRGIWEACTETK....LKE....LHLKSRH...MRELSEVGMYLGQMDVRTGRTSMQMYLENLGAEIEETRQEITAKKRIGNWL.GVMSGLFLVIVLF..........................................
A0A0J1IMF3_BACCI/3-171               .............................................................KIIGAILILASTSWGGMEFSKLL..SQRPKQIRALKSALQSLEAEIMYGHTPLHEASRRLA...........EQL.SE.......PLRSF..FASFAERLLK..-.........EDTTVKEAWTASLHEI....WKK....TAMKDSE...LEIMKQFGETLGRHDRFSQQKQIMLTLTHLEREEEEAREIQGKYEKMIRSL.GFLSGLLIVILLM..........................................
R6DM84_9FIRM/3-171                   .............................................................KFAGIVGLVAALGLIGILKAEEL..KSRVKDLEDFLRMCLFLKSKINYLREPLTYAYSTGN...........SGS.GN.......RADLL..LHEVFVEIDE..-.........KQGEIEEIWAQKANEI....YKT....SRLTKAD...MNYIRYPGKFIGQTDYENQLYQFEYIQSSLENQIKEADEELKRKGPLYRKL.GFFAGALIGIILF..........................................
A0A090ZHB4_PAEMA/1-169               .............................................................-MFGAALVILAATLAGWVQARQF..ASRPNQIRRLILALKRLETEIMYGFTPLPDALRRIG...........EQS.QE.......PVRAI..FVTAADNMSA..S.........NRLSAQESLEQAAINV....WQF....TAMKAPE...QEVIRQLSYTLGTSDRKDQLRHLATAVRQLESEESAAREEQARYEKMYRSL.GLLCGAFIVILF-y.........................................
W4VDH6_9BACI/2-170                   .............................................................KWIASIVLIFSLTLLGHEYAKNL..ANRPKLIRLFKTALQILEAEIVYSHATIREALISVT...........KQT.PE.......PISNL..FLHIAKDIQQ..-.........EKEELFPIWEKHMEDF....HKN....SSIQKDD...AEILNQFGRTLGQYDIYQQQKYVRLTITHLERNLVEAEEKHQRYGNMSRSI.GFLTGMLIVLLLL..........................................
D3FUV9_BACPE/2-170                   .............................................................KLFGALLIILVTTAVGFELARRL..NERPRQLRTLKVAIQALEAEILFGLTPLAEASHNLA...........KQT.PK.......PISYL..FEYFSYKLR-..H.........TELPAYAAWDESIAEM....WSL....TSLLESE...KEILKQFGQTLGQHDRSQQEKQIKMTLAHLEREEGEARDRQHRYERMVKSL.GFLTGLLIVILLM..........................................
R7A1H9_9FIRM/3-170                   ............................................................q-LFGCLLVIAGCVGFAYLMCLEL..SDRIRFLKEICRIYEELQYYIAYQRTPVSEAMKAMA...........RKQ.EP.......LLGEA..LCEVAEGME-..-.........KGKELQKLWQQSIGEA....LLK....TPLKEEE...RRLLLDFPGRLGYLEGQAQAEAFAEPLREAQRRIAQLYEVQKNRNKVVMSL.GLAGGILLSLVLV..........................................
A0A135L2V1_9BACI/3-172               .............................................................KLIGATLIIGASTIAGFQIARNY..HERTKQLRILQQALQMLETEIVYGAVPLHLAMEHIG...........QRI.TN.......VVKTF..FLEMSENLKM..L.........DGASTYECWRLSIEKH....YQK....TALKTQD...KAILIQFGHTLGISDREDQMKHIRLTMQNLATEEQLARDEQKINEKLSKNL.GVLLGILIVILM-y.........................................
B7GHE8_ANOFW/2-170                   .............................................................KWIGAVCIILATTWSGFEASRLL..RERTKQLRQLKMALQSLEAEIMYGHTPLIDASLRLS...........QQL.SR.......PLSWL..FESFAQKLQK..-.........GTMNARQAWEESLHEI....WKM....TALKEGE...LEIMKQFGETLGQYDHEIQQNYIRLTMVHLEREEGDAIEKQQRYEKMMKSL.GVLTGILIVLLLI..........................................
A0A0U4FQC6_9BACI/2-170               ............................................................q-WIGALLFIGTTTLVGFNISTLL..TERPKHIRQMKNALQILEAEILYSQLALPDVFATIA...........QQI.PQ.......PANSF..FKQLDESLKQ..-.........HNVDLYSVWTKHVDSL....LAT....SALGASE...GEILKQFGRTLGQHDFTQQQKQIHLTIKHLDRELDEAQDDQYKYSKMAKSL.GLLCGVFIVLLLI..........................................
A4J3D9_DESRM/3-172                   .............................................................KIIGAAVVVFFCTLIGMTVASGY..SRRPGEIRALLNALQILETEIAYGATPLPDAMTSVA...........ERC.DP.......RVALL..FSRAGTELMS..M.........RGITAREAWQTALSQY....YPK....SSIAKTD...RAILVELGTSLGMSDREDQIKHLVLAKEQLKLEHAKAEEASLKNTKVYHYL.GFLGGLTVVLILI..........................................
R5WDN8_9FIRM/2-78                    ......................................................avlsdls-----------------------..------------------------------------...........---.--.......-----..----------..-.........----------------....---....-AVRADV...VEEIGRLGDILGDMDVDAQISRISLIENIITDKYERERNRNGGIRKLSNSL.GILAGLFIVIMLL..........................................
R5DH03_9FIRM/5-160                   ............................................................v--LGSLLLLGGALWLWLGLVQAQ..RRQLRLLEELAASLEQMASAIRFRRETLLRLLAAQR...........QRP.LA.......--GPY..YGAVLAALE-..-.........EGISFPAAWRQGFAA-....---....--LSGEG...GRILRRLEP---EGDEQRILGELTWAAGELTELRRGLEQESRQREKLWFAG.LFSGAGLLLILL-i.........................................
R6LMJ0_9FIRM/3-172                   .............................................................KMLGAACVIFSASAVGFGFSGNV..RRQCAQLTALIEALTYLKSEMLYRRTPLPQAMGMLA...........EHS.AD......aAVGGL..FAKAAEKLEE..S.........CTLSVHAAFRAALGMA....-DG....LVLSAQT...RQALLSLSLSLGQLDLDGQERALELASERLSAQLRLLEQGRSARCRSYATI.GICAGMALAVILL..........................................
R6TRE8_9FIRM/3-160                   ............................................................r-VLGIILICTAAGGSGMLYAASL..NREYEKLLGFIRLIRFIGTRIECFSQPLMTVYADFS...........DPA.LD.......SCGFT..-----GA---..L.........REDGFTTALCRCRDE-....---....LCLDDAV...FGILSEFGDGLGKSFSDDQVKHCARYADMLSERASELEKTLPGRKKTAVAV.SASLAVMAAVILL..........................................
R7L7Y5_9CLOT/5-169                   .............................................................KVFIFAMIIGTSSAIGLMLAKKY..TNRELELKEIKNALNMFENKIKFTYEDIPTVFKDIS...........KKI.NG.......NVGNI..FKNASEKM--..-.........QNMQAGEAWKYALENT....--Y....TSLKKAD...IDIIKGLGRMLGKTDLSGQISEIKLVNNFIDAQIEDAKQEKDKNYKMYKTL.GIVVGATIVIIL-a.........................................
A0A015KSE5_9BACL/3-172               ............................................................q-VIGAMLILFAGAMLGFVQAAKY..ADRALQLRQLVHALQRLETEIGYGHTPLPAALDNAA...........SGL.HG.......PVPEL..FRDASLRLKS..G.........DGLLFRECWEAALDGG....WSR....TALRQAE...RTSLVRLGSALGISDREDQIKHLRLAMLQLRTEEESAREEQSRYGKMWRSL.GVLAAALVVILML..........................................
K6DNH1_9BACI/3-171                   .............................................................KLIGAIIIIVATTWTGFEASRNF..SARPKQLRALRSALQSLEAEIMYSHTPLHEAARRLA...........AQL.TK.......PLSTF..FEAFARKLT-..D.........TETTVNEAWETSLREV....WKS....TALRQGE...FEIMKQFGETLGRHDRFSQQKHIMLTLSHLEREEADAIDRQAKYEKMVKSL.GFLSGLLLIILLF..........................................
A0A136WF36_9FIRM/16-184              ............................................................g--VGALLIVSATTFAGYAFFAKD..KYRLKELGEIERGILLMKNQISYLGTPLAQLLDEIS...........WKI.EG.......VAGLA..FQEIASRMEE..R.........QGNSADEIWESTWVEL....GKK....SYLTAVD...LNELMAFGRTLGFLEKEQQEGSMDMLLHYLREVEERINKRLDKNGRLYFSM.GVLGGLLMVITLL..........................................
A0A098M7F6_9BACL/3-172               .............................................................KLFGAVMIVLAGTLAGLQRARLY..ADRPRQIRSLIAALQRLETEIRYGFTPLPEALRRIG...........AQA.RG.......PLQHF..FVTAADEMSP..P.........NNRSAQDAIDKAMEMH....WKN....TAMNASE...KEIIRQLSCTLGTSDRSNQTTHITLALQQLNQEELAARDEQGKYEKMSKSL.GLLLGVLIVILI-f.........................................
A0A117LJ88_9FIRM/3-152               .............................................................KILASLVIVSAGGICGMLVARSY..SLRPVELRSLKSALQMLETEITYAATPLAEALGLVA...........SRT.DY.......RLAPL..FEETRKELLS..V.........PGCTAKEAWEKALYEF....YPR....SYLIGCD...MAILRSLGGALGITDSSGQSKHLRLAMEQIEAELKKAES------------.-------------rpghr.....................................
A8MFK1_ALKOO/4-173                   .............................................................KIICSIVIIACSSLVGIIFSNTY..IERTGLLSHLISTLQIIETEILYGATPIPVLLEKMG...........SRS.KK.......EIGCI..FLSASNLLKE..N.........KGQPFEEIWSIAVNKE....IKN....TSFSKND...IEILLSLGKNLGLSNSEDQIKHIRLIQEEVKRQHENSIIEEKKNVKLFKNL.GFLLGLSIVIVLF..........................................
R5Y7F5_9CLOT/5-157                   .............................................................KYIILFFIFWTSSFIGILVSKRY..SNRVKELQEMKSALLMFEAKIKFTYEPIPEIFKEIS...........NKF.SE.......HIEEL..FENSVTKM--..-.........KNKSASVAWCESIEES....--N....NNMNKED...KEVLKGLSKLLGKTDINGQISEIKLVSNFLDTQIQIAQKEKEKNGKMYKTL.-------------r.........................................
R5ASR1_9FIRM/1-70                    ............................................................m-----------------------..------------------------------------...........---.--.......-----..----------..-.........----------------....---....--LTPDV...RAALLTLGEQLGKYDAQIQRRALDTCIETLQAAAAQMQADTTQRGKLFCGL.GATLGLLAAVAL-f.........................................
A0A0A8X7W1_9BACI/1-125               .............................................................-----------------------..---------------------MYGHTPLHDASRKLA...........AQM.SK.......PLSWF..FEAFSKKLTE..-.........SDTTVKAAWEESLKEV....WKL....TAFKQGE...FEIMKQFGETLGRHDRHSQQKQILLTISHLEREEADACEKQMKYEKMVKSI.GFLSGLLLIILLI..........................................
R6PFL3_9FIRM/3-172                   .............................................................KIIGAVLVIFACAALGYKKSAAI..SDRLFLLREIEKLLLLLMGEITYRREALPEAVLRVS...........GKV.QE.......PLCSF..LKETAETAQK..Y.........QGERFACIFRENAEKY....LKN....SELTQKD...FEEFVQLGEYLGYLDTDMQKNTTQWYLQQLKTEIDILAGEIPVKKKLYRSL.GVLSGIFLAILLL..........................................
A5Z6N6_9FIRM/4-173                   .............................................................KITGIVLIMMSASLMGYLFSKDY..IERINRLEQIQKMLILLKGEISYSNNSVQEALENIS...........EMI.EG.......KVGEF..VTKVQESFKK..-.........SEIPLSVAWSLGVDNI...fDKK....SSLKSED...KNSLKDFGRGLGITDRQTQINNIEKYQSQIQLTIKELKAEKNEKCKLYRML.GITCGAFLGIVLI..........................................
R6MSD6_9CLOT/1-156                   .............................................................-------------MFGRYIWERY..MLRVKVLEEWQRMLIEINGEINYSAQSMSQICRQMS...........KTS.V-.......YGKKF..WDGIAKKTEE..R.........NAGLPGEFWGEHLREY....RYI....ELLSNED...KEIICQFGESFGTLDICSQINEIELFEKRLEKNLSDARQKMVEQKKICIVM.GVISGMMTGICL-l.........................................
A0A0Q9YD19_9BACI/3-171               .............................................................KLIGSLLILGATTIIGFEIARGL..SERPKQLQLFAASLETLETEIMYGHTPLGEACIKIS...........KQL.PN.......PISAH..YVRFSNFLQK..-.........EEITVYKAWEAALKET....WKQ....TALKQNE...FEILQQFGANLGRHDRESQQKQIILTLNHLSREEKEAREKQKIYEKMSRNL.GVLIGVLIILLLL..........................................
A0A0M2U9Y5_9FIRM/3-172               ............................................................r-LVGAGLVVVAAGWLGLVVANNY..SRRPQQLRALRSALTMLETEIVYTATPLPEALARVA...........RCT.NP.......PVSNL..FWGTHEALGE..G.........RGYTAAESWEVGLGGI....AGE....ASLLPQD...LEVLRSFGHSLGSSGPEDQVRHLQLAREQLKQLELAAEVERAKNERLWRTM.GFLVGLMLVLVL-y.........................................
Q3AAK9_CARHZ/4-167                   .............................................................KLLGACLTVTGTGALGFYLGNRY..LQRVRNLERLINLLNFLKTEIRYKATPLPEIFAKMA...........NSE.EG.......TVAKL..FEI-K-----..D.........RTLPVNQGLKKALAEG....FSQ....TALLKRE...QEILLAFAEKIGISDLREQENLLNYTCEQLKLVLAESRQEAEKNVKLVNYL.GVLVGAFLVLLFF..........................................
A0A060M3B6_9BACI/2-170               ............................................................r-WLGALLIICCTTLYGFYQARLL..QERPQHIRQLRSALQSLEAEIVYGQTPLAKASINIS...........KQL.NG.......PVAAL..FKSFSLRLTE..-.........RKATANKAWEAAIEDT....WKS....LSLKEKE...KEVLLQFGATIGTMDRNHQQKQLKLTQTHLERDEEEARVIQARYEKMYKTL.GVLAGLFIVILMM..........................................
K0J3W9_AMPXN/2-169                   ............................................................n-LIGAILLIIATSLIGFEKAARL..KKRPDQILQFKGALQVMEAEILYSQRLLADVCLQIS...........TQI.PA.......PVSHF..FRKIGEEIG-..-.........HHHDLPKLWIDELKHL....LSY....SALKHDE...INVLKQFGQTLGHFDLINQQKQIQLAIVHLDRILIEAQNEYLIFSKVYRGI.GVLSGILIALILM..........................................
A0A0D3V885_9BACL/3-172               .............................................................KLLGAILILLSGTLAGFYKARQF..ERRPRQIRELILAMQRLETEITYGFTPLPEAMSKMG...........AQM.KE.......PLSTL..FTSAARSMNS..S.........QGLTAQESIAHALALH....WKN....TSMKTAE...KDVLHQLSFTLGTSDRQDQIKHIALAAQQLKHEEAASREDQAKYEKMSKSL.GLLVGALIIILI-f.........................................
A0A0A1MFD3_9BACI/2-170               .............................................................KWIGVLLLISMSTVLGWEWGRSL..KQRPKHIQLLLQSLQILEAEMVYSQVPLQEAFQLIS...........KKL.QG.......PTALF..YQELAEELEN..-.........KEKDFDEIWEECAQRL....IGQ....SALQKSD...LEILLQFGRTLGQHDIEQQKKHIKLTNLYLEEQWKNATERFQTYGKLSNVL.GLLCGIFLALLFM..........................................
A0A101V9N0_9FIRM/4-173               .............................................................KFVGSILIIATCSYLGFYFGKQY..NARLEQIRKLRSSLKMLETEISYSINPLPEALFKVG...........SRI.KG.......PVQTL..YEHTSDLLIK..N.........MGLPMDEIWRTGLNRL....AEE....SSLKKEE...LDVLDDFGIGLGGSDREEQLKNLLMVQEQLKVIESNAENERNKYERMYKTL.GVLAGIALVLILI..........................................
R5F3J4_9CLOT/5-177                   .............................................................KWTGAILVLFSAGGLGIWSAMQW..KGRLRMLETLRQMIYFLKGEITYSRAPLAEALERVG...........KRE.PG.......PLGGL..FEGAAEGIYM..Q.........EGESLQEIWKRQVMNL....NTDs.gpIPLEQED...LEQLAHLGEHLGYLDVDMQERTLKLYLEQLDLTIDYLRQNQREKCRLYTSL.GIMGGMFLVIVMF..........................................
K4ZMZ1_PAEAL/14-185                  .............................................................KLLGAAILISAAAGIGWVQAAAY..AARPKQLRLLHHALARLETAIVYGQTPLSTAFYDIA...........QQM.PA.......ALRDI..FISASKAMGH..Sa.......aFPLTAREAWQQAWDHY....GSN....TALSKED...LRIVKELGYSLGISDREDQSKHIKLAIKQLEQEEWSAREDHSRYGKMTRSL.GVLAGLLVVILM-y.........................................
R5YCP8_9FIRM/3-171                   .............................................................KLIGILMILCGCAGILYQWMKVQ..RCRALLMEEWIRIFAAFEYALEKEHVPIQRFFLRYD...........GRL.PE.......-VERF..FERVLQLLEK..N.........EYPSGQMVWGMVFKEW....EKK....FALKEEA...GHTLRAAGDAFFGENSQENLRCMQGCRQRMEKCVEKEREEFVRQRSVYMPV.GMLTGLMLVILLV..........................................
R7CGF4_9FIRM/3-172                   ...........................................................rt--VGLCVIVISGVGCGFAMSNEL..GRRKKMMEMILRMIILLRGEIRYGNKSLYDAFTGAS...........GKL.EG.......KYREF..FILTAQKMKE..K.........TGDSFGTIFRESAGKC....LDL....DCLLQEE...RDRFYSLGDQLGYLGLDMQLKQMDLMEKETEYAIRELRKDFCEKRKLYRSM.GILGGIFVAVFFW..........................................
R5L5F8_9FIRM/4-170                   .............................................................KIFGCLLIFSGCGGIGFGMGRDY..NARISQLEQVKKMLFLLEGEIKYNNGGIYESMKKLT...........GIS.DN.......IMTGF..FEGVIKD---..-.........NVGTLKEAWQFNIEKS...fVSD....SKLSKED...IAIIEDLGNTIGMTDKETQIKNIDHAMECIDDNIGELKKGKTEKCRLYRTT.GIAAGAFLAILFL..........................................
A0A0B0IE10_9BACI/2-170               .............................................................KLFGAIIIILATTWVGFEGAKRL..SDRPKQLRQLKVAIQSLEAEIMYGLTPLAEASAHIA...........KQM.PS.......PISHF..FERFSYRLKS..-.........KQETAFEAWEESLNET....WGQ....TSMLDSE...KEVMMQFGATLGQHDREQQQKQIKLTLSHLEREEQEAKERQHRYERMIKSL.GFLTGLLIVILML..........................................
D5WV73_KYRT2/5-174                   ............................................................q-WVGSAFVLTASAGLGFYKAERL..RKRVEALRSVQGGLQLLDTEIAFSATPLPRALVRIA...........RVC.AP.......PASVI..FADAAEGLAS..R.........PEVGAGVHWEAAVGKR....CAE....LALAPAD...EEILVQFGRTLGVSDREDQRKHIRMALERLSVQEREAAGEAAQRVRMWRSL.GILAGLAVVVLLM..........................................
A0A0M0XBK6_9BACI/3-171               .............................................................KVIGAIFIIIATTWAGFEAARHL..NERPRQLRQLKSALQSLEAEIMYGHTPLHEAARRLA...........SQL.SK.......PLSSF..FESFAKRLT-..H.........SETTVKDAWEQSLKEI....WKI....TALKQGE...FEIMKQFGETLGRHDRTSQQKQIMLTLAHLEREEADAYDKQAKYEKMVKSL.GFLSGLLLIILLM..........................................
A0A0U1L402_9FIRM/4-172               .............................................................KILGSLLIIVAGTAMGFSVAARY..VERPRQIRQLISCLSALQSHINYAAIPLPGALSQCT...........SGI.AG.......PVADF..FNTMSLLLLN..N.........GWLTPQAAMDQALMES....-KQ....LVLNQPE...REILTVFSANLGSMDREEQHKSLELVQEQLSRIQYEAEKLCEQNVKMYRYL.GLCSGLAIVIILV..........................................
L1QH30_9CLOT/1-98                    ....................................................msinlndvd-----------------------..------------------------------------...........---.--.......-----..----------..-.........-IKGVYEAFTIAYKKY....KDE....INLSKDD...YKILSDFFKTIGECDAVTQEKVFTVALENLNLNYIDANNEANVNVKMYRTL.GISIGIMIAIFFI..........................................
A0A0J5R0M7_9BACI/3-171               .............................................................KLLGAVLILITTTIIGFEYAKRL..SDRPRQIRQLMTAMQSLEAEMLYGLTPLAQASSNIA...........AQL.SK.......PIAGL..FDRFAHRLLE..-.........KEESAAQAWSESVQET....WSQ....TAMLESE...KEIMTQFGATIGQQDHDQQKKQIQLVLTHLKREEWEAREKQLKYEKMLKSL.GFLSGLLIVIVFI..........................................
C2WBX9_BACCE/1-159                   ............................................................m-----------TTFFGFSYAKRY..SERPRQLRLLKAALQSLEAEIMYGHTPLSEASERLV...........KQM.PK.......PLNWI..FESFSRRLES..-.........GEQTVREAWLDSLQEN....WKL....TAFKQTE...YEILQQFGETLGQHDRESQQKHIRLCITHLEREEGEAKALQIQYEKMIKSL.GVLAGLLIVILLL..........................................
A0A176JBA0_9BACI/3-171               .............................................................KLIGAAMILFASTWIGFEIAGRL..GKRTRLLREIKVALQSLEAEIVYSQKPLKAAADDLS...........GQL.NR.......PLSEF..FTQFSHILSS..-.........GGKSTKSAWSESLEQL....AAS....SSLQKGE...LEVMKQFGETLGRHDLISQQKHIKLAMVHLEREETEAADRQQRYERMIKSI.GFLCGLLVVIVLL..........................................
A0A0H4KML3_9BACI/2-170               .............................................................KLFGALFILVATTWFGFDLAKQL..NARPKQLRQLKSALRSLEAEIMYSHRPLPQIARLLT...........EQV.PK.......PIASF..FDSFATYLE-..M.........GQKSAGEAWLLSIEEN....WRL....TALKQGE...KEALKQFGQTLGQHDRYSQQKHIVLTLNHLEREEADAVDRQTRYEKMVKSL.GFLTGLLLVILLL..........................................
Q18B53_PEPD6/4-173                   .............................................................KIIIIAFLIGSSYLIGEQIYKTY..TRRHKQLNDLIRVLEILRMDLSFGLYTLEEIFNRIG...........GNK.EF.......CFWKF..FYQISEGLHN..E.........QSKTLEIIISENIDVL....SKE....TYLGNKE...IEELKNLILTLGKSDIESQQRMIDLSIENLKKQTYETKEDINKKGVLYKKL.VTFIGIGICIILI..........................................
L5N846_9BACI/1-130                   .............................................................-----------------------..---------------MIEAEMVFGHSSLWEVCENLS...........KQL.PD.......PIARF..FQEMVENID-..-.........DCDDFPSWWSGHLQRH....WSQ....NALGKTE...LEILHQFGRTLGQHDLEQQQKQIQLTLHHLDRELHEAMEGVEQYQKMARGM.GVLSGLLVIILIM..........................................
F7NJX1_9FIRM/4-173                   .............................................................KLTGSVLIVAAGSLFGFELAKRY..IERPKQIRQLMNGIRSLQSYIHYAAMPLSEAFSQAA...........RGV.AA.......PVSDL..LTATGAIMQK..D.........TYLTPQEAITLAVKEM....RCR....LALNKAE...VDDLILFAANLGFMNREEQQKYCGMILSQLEKYEQEALKVKEQNVTMYRYL.GVCGGLTLVILIL..........................................
A0A0D0QSM5_9FIRM/3-172               .............................................................KYLGIFLASIACIALGFELSGDV..QKRIRQLRLVKSALLMFRGEVEYASSSLEEAFSEIS...........SRL.ES.......PISDF..FKGVSNHLSE..L.........DHKEFIEIWTKQLTNL....KKK....SCLEGED...IDILNQLGKQIGYLDVDMQIRVLDNSCQQIDERLHSLYEESKVSCKLYKSL.GILSALCIIVI--ci........................................
B2A544_NATTJ/3-171                   ............................................................r-IVGAGLILFSTMALGNQVAHKY..KMRPKLLRQLEVLLEMTGSEINYAAVPLPELLSKIG...........RRF.PK.......GAGKI..FHRVNEHLK-..H.........NGVTPEEAFYKTKQQL....QHE....LSINEED...WQVLENFASYLGKSDSGEQLKQVELCLSHIRANQKIAMEDQRKNERMWRYL.GVLAGLMLVILIW..........................................
A0A096BKX4_9CLOT/5-174               ............................................................r-LITSITIIFSCTFIGYYLANRY..NKRFINLIKLQNCIQLLETEIVYCSTPLPEALENVY...........NKC.DK.......SVSFI..FKDLGNLLVD..N.........KNLNVYEAFSYQTENL....SKK....LYLDFQD...IEILMSLGRVLGISDREDQQKHFKLVLMQLENCQKDAEEKKQVNEKLFKNL.GVLTGLAIVILLF..........................................
R7ANQ8_9CLOT/4-98                    .............................................................KLLGICLVCVSCAGIGGGEALRL..IGRRRFLEEVKRIAAGLRGEIGYTQAVLPL------...........---.--.......-----..----------..-.........----------------....---....-------...---------------------------------------------------.-------------xhrqfflwycagrghagmekrgsyfwwqesgwkriqsvrlgv
A0A0D5NQ32_9BACL/3-172               .............................................................KWIGAILILAAGTMIGFLQAARF..AERPRQLRQLAHALQRLETEIGYGYTPLPEALRRTA...........GHV.PA.......PVASI..LSGAAERLLA..P.........EGPAFRECWEESVRSC....WPQ....TAMRSGE...QAVLLRLGSALGLSDREDQIKHLRLAMLQLKAEEDAAKDDQARYEKMSKSL.GILVAALVVILMV..........................................
F5LLP7_9BACL/4-173                   .............................................................KLAGAALVLGAGAGFGFAKARRY..RRRPQQIREMIQALQRLETEIVYGSTPLPDAIATLS...........EQT.RA.......PLAGV..FREVADRLSE..P.........QDDTLSAIWRDAVQHG....WRN....SAMKPAE...LQVVLRLGQTLGASDRTDQAKHLRLSVLQLQAEETTAAEEQKRYEAMWKSL.GVLVGALIVILM-y.........................................
U2CHG5_9CLOT/3-172                   .............................................................KLTGALLLVMGCAGFGLCMCRDM..EKHVAQLRQLARAFTMLESEVGYSRATLPEGMIRVG...........NRL.HT.......ELGDC..FIRMGKRAQE..Q.........SGSSFQTVWQEEMPSW....LKT....TCLDARE...KELLLSFPGFTGFVDGQMQLISLEQFVKELSHAQEKAGKEAESRKKAVLSV.STAGGLLMAILLI..........................................
R6QGT5_9FIRM/35-140                  ................................mvllkttnpetekifdllnnseklkdidl-----------------------..------------------------------------...........---.--.......-----..----------..-.........-------------NNI....ISS....SPLKREE...NEKIYDYINSIGKYDSQTQINEANEFCETFRILKDYYQQYYTAHYKIIYAL.GLGIGCLIAILLI..........................................
A0A0A2UUG9_9BACI/2-170               .............................................................KWIGALILLCATTWGGFEFARRL..TERPKQIRQLKNALQVLEAEILYGHSPVIEACEKVA...........RQI.PE.......PMAWF..FYEFSEQLKE..-.........SSASLYDVWEQRIQSF....WPL....SALGEGE...KEIMKQFGQTLGQHDFTGQQKHIRLAISHLERELKEAEEQQYKYSKMVKSL.GFLTGLLIILLFM..........................................
R6S2Z2_9FIRM/3-172                   .............................................................KFLGSLFIVSSMTGIGIWKAEEV..KHSYQALGKIYHLIGMMKNELSYAGSEFGEMFECLS...........KKV.DA.......PYRNW..LLGMKIQMER..R.........DGKTFSEIWEDNVNGF....LKE....SGLGMEA...LNHLKMLGRNLGGADRQMQIWSMERYLKQIELQMDEMRKDIQMRMKVRICL.GASAGILITIFLI..........................................
A0A024P6N4_9BACI/2-169               ............................................................q-WIGAVIILTVTTWAGFDMASRF..KKRPGHIRQWKNALQMIEAEMVYGQSSLLEVCENLS...........THL.PK.......PIQSF..FVGILKE--E..G.........VWDDFFSLWSTQLKKH....WTM....NAMTKNE...LEILMQFGRTLGQHDLEQQQKQIQLTIHHLDRELHDALEVGDQYQKMAKGM.GVLSGLLVIILII..........................................
R5E6Z4_9CLOT/6-130                   .............................................................KIAGTLFVLGSSGYSAYALNGKI..DQRKAELRRLYSILLQLKSEIQYMGNPLPLSFEKMA...........EQE.QY.......PFSVW..FGQMADRLQE..K.........EKVQFADLWEEEILHL....YEI....SALKRED...LEPLLSLKEKLGGIDK-----------------------------------.-------------gqa.......................................
R5JZC4_9CLOT/8-177                   .............................................................KMAGILCILIAAAGLSAGNNRRL..HRQVREIRQLQQLLQLLQGELEYQCAALPEAFRRCA...........AHL.QG.......ECAIW..MQRMGQRLEE..Y.........EGLGFQEIWEQELERF....YGN....TVLSEEC...LMNLKQLGSQFAFVDRDTQLRGIRLCAMRLEEEESRLTQELPRKLKMGTGL.MLLAGCFLVILLI..........................................
A0A0H4P1T1_9BACI/2-170               .............................................................KWIGAILILGSACWFGFEQAKQL..ADRTKQLKMMIAALQSLEAEIMYGHTPLHEAARKIG...........HQF.GF.......PVSQL..FLTFAETILS..-.........TEISVDEAWKNSLHFI....RNK....AAFKRPE...YEIIEQFGGSLGKHDLLTQQKHILLTLAHLQREEEEARENQKKYEKMYKSL.SILVGLLLVLLLF..........................................
C7H7R4_9FIRM/5-151                   ...........................................................rw--LSVCCFVVCGWCAGDSFHQQA..QAHLEALRKTLDLLETLHQEISFRRSDLNLLCRKLI...........---.--.......-----..---------Q..D.........GQLPPETVSLQTLEPF....---....PSLTLEE...RTRFSECFSGLGRLEAEQECRRLELYQAQFQAALQEGEAAARTQSMLSHKL.GLAVGLAAAILL-..........................................
R6RQG1_9FIRM/6-175                   .............................................................KICGIAFIVFSTSAYGWVLSRDL..KRRLLELRELKKIMFLLRGEIGYGMTPLLEAAGSIA...........QRV.TA.......PFNGI..LVSLSNRNSE..I.........KECPFGQMWEEEFTKG....LVM....SHLSAAE...KERLVALGNSMGLSDGRTQQNVIDAYMQEVETAISDMEKCLPAKTRLYRSL.GVMLGVVISIIII..........................................
E6U545_ETHHY/1-162                   .............................................................------MLFGVCTTAGLLKSASF..SKRVRQLEGFTGALDSIATEIRYFAAPLEDIMAKCD...........ALP.EY......gELRV-..FGLCRKI-F-..M.........EERDFPAAWEKALGQA....KPS....LALDAGD...HEALSWFGRVLGTTDVDGQTANCARYGELLRQRLERAREDRARRGKMYTSL.GVLAGIFLVVILF..........................................
R5B586_9CLOT/4-166                   ...........................................................gl----AAAALIICISMGYMACSRM..RDRVDKLNALCAEIRTLGDSMELSQYRLSEMLDRLG...........---.--.......--GEL..WREYTAALT-..G.........EQLGAGEAWAATVQKE....ADGg.slSGLDKQD...IAALITLGEAFSSISRAAQADHARLTLRQMEARAADAEKALMGKGKLYSTL.GVLAGFAAALMMI..........................................
R6EGF6_9FIRM/2-166                   .............................................................KILSLIAMGLACTMIGRYIAYKL..SRRVRILEKIALMLEIAENEIQFLNRPTFELIELLS...........KKE.EL.......AELDF..LQRCLDNVN-..-.........DGRDINDAWAQAIHES....---....ESVGGED...TCILYSFGESLGRSDADGQIASCRYHERLTQERLIEAREKRKRYASLACGL.GMLSGIGVFIILF..........................................
G9YNK0_9FIRM/3-170                   .............................................................KLIGALLLAGGAGALGCSAAAQL..SRRVAVLRALLGALEGMEREIAFRLTPMPELLERAA...........AES.PP.......PVCTL..FARCRTLLDE..L.........GERSMAELWREALEQV....--P....LGLDGPG...RLALEELGEVLGRYDGDGQREALAHTRAELSRALEQAREAREKQGRMYQVL.GITAGAFLVILLL..........................................
V9WA33_9BACL/3-171                   .............................................................KMLGAVLVLGAGTLYGFVQAMHY..ARRPKQIRQLHQALQRLETEIVYGYTPLPEALLSVS...........MQI.NE.......PLSSM..FAELGGSLA-..R.........EERTVREVWEGTLRKY....WGH....SSMKSVE...FQAMLQLGYTLGLSDREDQVKHLKLAAAQLHAEEKQAADEQKRYEKMWKSL.GLLMGALVVILM-y.........................................
A0A099SAC4_9CLOT/3-172               .............................................................KIIGSILVIVSASVLGYSSGELF..KKRTRELKELERAIGILKNEIVYAYTPLPYALEKIG...........LRL.IE.......PIKSL..FLSISRDLEE..N.........VSEGVYEAFYSNTNLY....KKN....LNLNKED...IHILLNLSKSLGEWDVESQKNIFRVTEEEFRKQIEESETLTRKNLKMYRYL.GFSIGAIIVIMFI..........................................
R7A9L2_9CLOT/1-70                    ............................................................m-----------------------..------------------------------------...........---.--.......-----..----------..-.........----------------....---....--LGTEE...WELMCRFGNSIGYLDLEMQQKTLALYLEELERAIEQLRREEPEKKRLCWEL.GILGGLFLAVVLM..........................................
R5V793_9FIRM/3-166                   .............................................................KGIGLLCLVLCGGICGFLAANRI..RQKQEQLVHLAAFLHELEIRMWCHGGTLQELFQQLS...........EQE.TY.......QTFSF..LSNTLIA---..M.........QQVSFTEAWKTSVQAD....---....KELSPDS...QQMLCELGEELGISDLYTQKEILERYRSRMQQMEAEQRETSRKKIRLYQSM.GLLAGMAVAILL-c.........................................
R5R841_9FIRM/2-169                   .............................................................KWIGFFLVLIGSGGIGFSLVLEY..TGRLRELTTVRQMIHYIADAIIYDGLPLAEAFFRCS...........MRM.EG.......AYGAF..LEKTAQQIET..F.........CGEDPAWLWKSNAAML....--S....DRLKKKD...WEKFADCMAQTGFSDPGGQVQVLRLYEEELSDQIIKLEKQKEEKCKLYQTI.GIMAGVFICILLF..........................................
A0A0N0E9T5_9BACI/3-171               .............................................................KLVGAVLILVATSWAGFEAARHL..TERPRQLRQLKVALQSLEAEIMYGHTPLADATKNIS...........KQL.EK.......PLSWF..FESFAHKLDK..-.........ASLTVKEAWQESLDDV....WKN....TAYKTAE...LEIMKQFGETLGQHDRYTQQKHIQLALTHLEREELEARDKQNRYERMVKSL.GVLSGLLLVILLI..........................................
Q67N97_SYMTH/4-173                   .............................................................KLLGAALTVLAPSWIGFQIAARY..ARRPAELRGFQNGLAVLVTEVEYGATPMPDALRSAA...........RAS.GP.......VAGAV..LADAADRLEG..G.........GGITPGEALAAALEER....RGA....TCLTPAD...QEILAALVPVLGASDRRDQVRHLRLALERLAAAEAEATDERRRYEKMYRYV.GVLSGLALVLILI..........................................
R7JTR0_9FIRM/2-171                   .........................................................rlav----LLAASLACVGIGFAKSAAL..SAHVKDLETLQKIIQYLRGEIVTAASPLPDAFWETG...........RRM.RD.......PYRDF..LQDISEDMRR..P.........DGKTLPAILEENTAVH....LAD....TRLTKEE...KEELQEAGCSLGTGDRAMQKVNLDRYEARLVQRIAELQKGLPERKRLCQSL.GIMGGLFLFLILV..........................................
A0A0V8HMH3_9BACI/3-171               .............................................................KIIGAIFILLSTSWAGFEVSKYL..TERPRQLRLLKVALQSLEAEITYSHTPLHEAARKIS...........KQL.QK.......PVSWF..FEGFSKKLTA..-.........QEISVKKAWEDSLEEV....WKL....TAFKTGE...YEIMKQFGENLGKHDLVTQQKHIHLALKHLEREETEAVERQRKYEKMTKSL.GFLSGLLLIILLL..........................................
D9RXK2_THEOJ/4-173                   .............................................................KILGAILVIFSSTMIGFIIAGYY..QQRPRTLRNLQQALSMLETEIDYGQTPLPEALKNVS...........RSC.DP.......EISKF..LERVRQLLLS..I.........EGFTAGEAWEKSLREF....RSQ....FPLQESD...FEILTSFGKYLGSSDKDDQIRNLKLTLSQLRQQEVLAVEEKQKNEKMWRYL.GVLTGLTVVLLL-y.........................................
R5AZ05_9FIRM/5-70                    ............................................................h-WLGAALLFLGSTAAGFALRQEL..RLRLRLLTAVIDSLNLLRSDIVGCCAAISS------...........---.--.......-----..----------..-.........----------------....---....-------...---------------------------------------------------.-------------avccrcrrrcaiw.............................
R7IT11_9FIRM/2-171                   .............................................................KMAGAVLVLLAALGIGFQNAARI..RKSYEELVYLKKIMIMLRGEISYQISSMEEICIHMG...........EHT.RE.......PYSRA..FQNLAEALGS..G.........EGGNFSPMWNETVIKT....LRQ....VIPQEND...LDRLKELGENLGYLDKEMQMNYINLYLENLELSITEKGEKVRTDEKLNKIM.GCVMGLLVIVLLW..........................................
H6NL71_9BACL/3-172                   .............................................................KLLGAALVLLAGTLMGFHQAAQL..ARRPKQIADLIRLLQRLETEIVYGFTPLPEALRRTG...........GTC.AA.......PVGTL..FLETSRELER..A.........EGEQAAGVWERTITRG....WRA....TAMKPQE...REVLLQLGTTLGLTDREDQVKHLRLAVSQLQAESETARDEQQRYERMWKSL.GVLLGALVVILM-y.........................................
I3VWP6_THESW/3-171                   .............................................................KIVGMVLVLISSAMIGYMKALKY..TLRRQTLRSFLSSLNLLITEITYSQITLSEAFAKLS...........ETS.ES.......GVGRF..FLLVSRILNS..N.........EGYTAGEAWEIALDKV....-EN....INLSQDD...IKILKSFGKGLGNSDIYNQEKNFKLASELLKKQLTDAEESSRKNERLYKSL.GILIGIAVVIIFL..........................................
A0A0M2SKV4_9BACI/3-171               .............................................................KLLGAALIITATTWTGIEASRHF..SERPRQLRQLKSALQALEAEIMFGHAPLHEASRKIG...........NQL.TE.......PVSSI..FATFANKLES..-.........AETTAGAAWEESLKLT....WKD....TALRRGE...FEILKQFGETLGRHDRYSQQKQIILTMTHLEREEADACDRQLKYEKMVKSL.GFLSGLLLIILLM..........................................
R6LSA2_9FIRM/3-176                   .............................................................KMAASLLLILGGAGIGYARSREI..TEREKNLEILLQILFFLKGEIRCGNSSLPDAFREIA...........AKI.SG.......PFEMI..LRDAAQEMED..T.........GGKNLEEIMESCIQRN....FYQgnpgGSQRKEE...MEILRTLGRRLGYLDREMQIKQIEFLETDVEEQRRQLREKMPEQKKICQSL.GIMGGILLAVLFW..........................................
A0A0B0HQ00_9BACI/2-170               .............................................................KWIGAICIILATTWSGFEASRLL..RERTKQLRQLKMALQSLEAEIMYGHTPLMDASLRLS...........QQL.SR.......PLSWL..FESFAHKLQK..-.........GTMNARQAWEESLHEV....WKM....TALKEGE...FEIMKQFGETLGQYDHEIQQNYIRLTMVHLEREEGDAMEKQQRYERMMKSL.GVLTGILIVLLLI..........................................
A0A0D6ZBK8_9BACI/3-171               .............................................................KIMGAILIILSTTWTGFEASRHL..SERPRQLRLLKSALQSLEAEIMYGHTPLHEASRKLS...........EQM.TK.......PLSWF..FKTFSKKLTE..-.........TETTVHIAWEESLREV....WNL....TAFKQGE...FEIMKQFGETLGRHDRHSQQKQILLTISHLEREEADASEKQMKYEKMVKSI.GFLSGLLLIILLM..........................................
W6N4G6_CLOTY/1-164                   .............................................................------MILCSATAFGFNYGEKL..KNRTKELKELQRCIYEIQSHIIYTHTPLPEAVSNVA...........SKA.EQ.......PISTL..LMEIFHMLDE..N.........KVDNVYQAFKNAFLKQ....REI....LNLKDED...IDVILDLSKSLGESDIEGQKAVFSLTIEDMKKQIKISESILKKNLKMYRCL.GFSVGAVIVILLI..........................................
A0A089LXB1_9BACL/3-172               .............................................................KLLGAILILASATLGGFTAARRF..AQRPRSIRGLIAALQRLESEITYGYTPLPEAMGRIA...........AQS.LE.......PLRSL..FLDIADDMGD..P.........HNRTAREAVERAVRSH....WQA....TAMKAPE...RESLRQLSFTLGVSDRQDQANHIALALRQLAQEEQTAREEQAKYEKMSRSL.GVLLGALIVILI-c.........................................
R5E180_9FIRM/5-176                   .............................................................KITGAAVVLMSSFMLGMYFVVVN..KTRIKNLADIDETWRTISAEIRFQSGSLPEIFKRFA..........sHEY.SF.......GIKAL..YKDVYENMVV.dS.........EKAAFDIIWRESVRNN....ASK....SCFLRED...EEFLMQFGNMPVHLDIQTQTDFVNHMISMLDDRIKKAQDKTDSQCRIYRCM.GIAAGVFLVLVLI..........................................
A0A0F5IBG9_9BACI/2-170               .............................................................KWLGILLILTASFWIGMEQSRKL..SDRTKQIRLLRTALQSLEAEIVHGFTPLHESARKLS...........ERL.PQ.......PLSEL..FASFSELLMS..-.........TEWDAKEAWKASLNQV....WPR....TALTQNE...WNILIDFGETVGKYDRLTEQKQIAIAMSHLEHQEEEAREKQRRYGHMIRSL.SWLGGLLIVLLLF..........................................
D5X7K6_THEPJ/3-172                   .............................................................KLIGAFLAVAACGGIGLTVAQHY..IQRPKQLRAMLSALQMLETEIVYGATPLPDAMENVG...........RNC.DE.......KIARI..FLAARDFLCS..A.........EGLTAGEAWHLAVEKY....GYD....LAFIRED...LSVLKRISGFLGCSDRDDQSKHLQLTREQLRYEIAKAEAAAQSNGKVWKSL.GFLFGLVLVLM--vy........................................
A0A084JIU9_9CLOT/3-172               .............................................................KVIGFILIVVSSTILGFSYGEKF..KKRVRELKEFQRGVYVLKNEINFTHALLPEALNKVY...........EKC.EE.......PIAGI..FKEASELIIS..S.........EECDVNSCFIHSLDKR....VDK....LSLTKDD...LGIFLDFTKSLGEMDIEGHNDMFALTLENLGKAIKNAEYNIDKNVKMYRYL.GFSFGAMIGIILM..........................................
A0A0F5QZR3_9BACL/3-172               .............................................................KAAGAVLILLAGTMIGFLQAARF..AKRPRQLRELIHGLQRLETEIGYGYTPLPEAMRRTG...........AHM.AE.......PAASI..FRLTSDRLES..P.........DAPAFEACWEETLAGC....WPG....TAMRKTE...LATLRRLGSTLGMSDREDQLKHLRLAQQQMQAEEDGARDDQARYEKLSRSL.GILIAALVVILMV..........................................
R6GID0_9FIRM/4-161                   .............................................................KLLGGGLVLLGTALLCRAETRTR..RQQTERLTELSAALSEMAAGIRSLRRTLPCLLRQQT...........RRP.LC.......--GAY..FGAVLEGLE-..-.........SGQPLPDAWADAFRQL....---....---EPPE...AGRVLRDTELTG--DEERIVSALTSAACRLDRLADTRRRDRRQQERLLWTAaLSGAGLFIILLM-..........................................
E9SG86_RUMAL/3-157                   .............................................................KFIGAVLVTAAGAFAGEMEVCRL..KDRVIQLTELVELLEQIQLYLSAYGASTEELFKMLS...........SKQ.GE.......-YHSC..FQT-------..-.........SSSELTQEVCAALRES....---....---SLEM...KDALADYIYDFGKTTLDGQLQKTSILMSDVNAVLRSVKEKCEKNTKLYRAA.GFSIGMMAAVLLI..........................................
A0A0F2PIV7_9FIRM/3-172               .............................................................KLIGAILLVSACGYAGWHVSRSY..ARRPVELRQFMTALQMLETEITYAATPLPDALSGIA...........ERV.DA.......RVSSF..FAHAAKELQT..T.........RGTSARQAWSAALDRY....RTG....STLDRGD...LGILNSLGHNLGISDRDDQAKHLRLTLEQLKMAQARAEETASKNVKLWNYV.GLLGGLIIVLAL-y.........................................
R6WDE6_9FIRM/2-161                   .............................................................KLFGAFLLVTAGFAAGNLAAKAK..KDTLDRMEAVAGLISHLLRRIESSNTLLFDAINEYK...........SDM.LK.......KCGFY..--TAFDG---..-.........GRTSVNRAWQNAVYT-....---....LSLPPEA...NAVLLSLGDGFGLMCREKQLEALKRTQSGLETLISAAAEKLAKISRCYGLL.GALAGLLAAILI-a.........................................
U2F5J4_CLOS4/3-169                   .............................................................KAIGCLFLLSACSLGGLYLSGRI..REEERLVQTLLKFFRGIEGELTYGGAPVGELLQQAA...........QDP.RF.......AGLDF..LPLCCRGM--..-.........ETGDFSASFCSAVEGC....---....RCLQKSPpalRQLMLDFGREFGTRPSPVELSRLALLVQKLEEQLEETREAYRKNGKMYNTL.GVLAGLGLSIILW..........................................
Q65HH7_BACLD/3-171                   .............................................................KLLGAVLILAAATWTGFEMAKPF..RERPKQIRQLLAALQSLEAEIMYGHTPLRQASKQIA...........HQL.TE.......PVASL..FQTFAEQLEK..-.........GSASAGTAWEDSLEKV....WPE....TALKKKE...YEILRQFGETLGRHDLISQQKHIKLALTHLETEEAEANLAQAKNEKMVKSL.GFLTGLLLILLLM..........................................
R9KHS6_9FIRM/3-171                   .............................................................KLAGSFLVVTASLLYGWRVGREL..QEHVGQLVGMKEMLLMLHGEISYARTPLKEAFWQIA...........SQG.KE.......PFSSF..LEQAAEGLG-..G.........KEESIGEFWRRLVEQE....AGK....FYFTGEE...LGLLERVGENFGYLDVQMQLKNLELYMEQAQVLIENAQKELKDRQKVARAL.SLMCGLFLVILLI..........................................
C6J3S9_9BACL/3-172                   .............................................................KMFGAALVLLTATMAGWLQARQF..AARPSQIRRLILALKRLETEIMYGFTPLPDALRRIG...........EQS.GE.......PIRAI..FVRAADHMSS..A.........HPLTAQESLEQAVTKL....WSY....TAMKAPE...QEVIRQLSLTLGTSDRKDQLGHIATAVRQLESEESAAREEQARYEKMYRSL.GLLCGAFIVILF-y.........................................
R6M5Z4_9FIRM/3-163                   .............................................................KILGAIMTGFACGYLGFKISFAM..KIRAESLNNIITSLEMLESEINFSMNKLKQAFMRVD...........-K-.--.......--CGL..FKFAAENM--..-.........DEKGVKTAWTNAVNEC....STK....LSLKDAD...KDILMTLGKNIGRTDTDDQIKNIKYIKSMIAEQEKQAQSEYRRFGKMYRNG.GVLVGLLIVIMLI..........................................
R9N9R6_9FIRM/4-173                   .............................................................KTLGICMVIAATSAGGFSAANKI..RDQYEQLRYLQKLVCLLRSEIQYARSYLGEAFLRIG...........SSA.RS.......PYKEW..FLGMREEMDG..R.........RGGIFAQIWEEKAKEY....LQD....CGLSEEM...LEKLAGYGSQMGIADVNMQVRTLDLWQEEIELTMEEMREKMGTRIRLCHCL.GVMSGIFIAVLLL..........................................
F4LVG6_TEPAE/4-173                   .............................................................KMIGGATVVISCSIIGFIIADNF..KYRPKTLRDLQVALSMLETEINYGHSTLPEALRSIS...........RKC.EK.......DVAEL..FVLTTNNLAL..R.........NGFTACEAWEKALNKF....YSN....SYITKND...YEILIAFGKYLGFTDKKDQIKNIKLTVDNLKQQEILALEEKQKNEKLWKYL.GILSGLMIFLLL-y.........................................
G2SX17_ROSHA/3-172                   .............................................................KIMGSILVFAAAAGMAGTYKREL..ADHLALLYALRKLLVDLSCYGNGTRQPVEVLLGCFV...........RTP.DE.......RLNEI..CRKIADCLIE..K.........NEKNGEQVWKRVFEEY....RKK....LCLTGEE...SALIGEAGGALFGRSEEENHRRLTLILEQLDDRIKTVRGELGEKQKIYATV.SMVMGGMLVILLI..........................................
A0A124IJ98_9FIRM/3-169               .............................................................-IAGYLGLIIGFGCLGLLKARQI..KRRPLEIREMINALALLDTEIFWGSTPLPEAFAFLK...........ERV.DF.......PWKNF..FSELETRLR-..-.........DGANAASAWESAIYSQ....RKK....FSLLEDD...WRIISSLGKGLGRSDRNEQHKQLELVQKHLNSVAERARDNAESKAKMWSYL.GFLSGMAIVIFIM..........................................
Q8XJC8_CLOPE/2-171                   .............................................................KVFFLLIIVLLSSLIGYLYGEGF..RNRLSQLRELKRALIDFENDIVYTYTPLPESIESIA...........LKA.KS.......PIKEL..FNEISFKLKN..N.........EVENVYMAFKESINEH....KKE....MNLRNKD...FEILLDLSKSLGETNVEGQIKIFNLAKEKLDIELEIAEDECNKNTKVYRYL.GVAVGAMIAIFLV..........................................
A0A0P8WAD1_9CLOT/3-172               .............................................................KTIGLLLVFISASGVGLILGSQY..SSRVRQIKHLKIALQMLETEIVYSNTPLPLAFESVL...........MRC.EN.......PIKKL..FTSAVEMLNK..R.........TYSTVGEAFEASLEET....KEF....FSLKKED...MEILKSFGYSLGNSDVEGQIKSFSVIIKQLDSLEIKAEELRQKNERMYKHL.GYLSGLAIVIILM..........................................
A0A0D8IDS1_9CLOT/4-173               .............................................................KLIISFIIIGCSSLIGIIYANTF..IERTKLLASVLSTLQMLETEIVFSATPLPELLSKVA...........RKS.RT.......EMGRI..LENTAEILRR..N.........EGYLFPEAWKKAIEGV....GDE....TVFAKED...LDLLLNLGNTLGISDTSDQVKHIRLTMEEIKRNYELSIIVQSKSVRLYRNL.GFLVGITIVIVFF..........................................
R5BU12_9FIRM/3-172                   .............................................................KGIGMLLILLSGAGLGFSSVFQM..NRRLRELKNLRRMALLLENEIGCAHTVLAQALERTG...........RKL.DG.......GCAVF..ARGLAKRLRS..G.........SGSSMEVMFREQAEEY....TRN....WELSQRD...FELLCQLGMHLGRESRKVQIEQLQLFEKELEQEILSFEKTMPAKQRMYRSL.GILGGLFLAILV-f.........................................
R6LJ97_9FIRM/4-172                   .............................................................KMVGCLGIVAATSGYGYSRGMEY..QRQITDTGELQRVIRQLAGEMEYTYAPLAQVCASVS...........RRC.SQ.......NYRIW..LEHLAKELE-..M.........PSRSLAIIWERCCESD....LEC....LLLGREE...RVRLHELGMQLGSLDKKQETQIFLQYAEFLEEKRGGLLKEIQEKRRLCNLL.GVTAGLFLTILIL..........................................
V9G432_9BACL/3-172                   .............................................................KLVGAILVIGSGTLAGFYQAQQF..AARPRQIRELMLALQRLETEISYGFTPLPDALERIG...........ASL.RE.......PLRSI..FDSSAQYMRP..S.........YGLSARDSIRKAIGEN....WKR....SAMKSAE...REVLEQLSTVLGTSDRQDQVKHIALAALQLKHEEAAARDDQIKYEKMSKSL.GLLIGALIVILI-f.........................................
A0A0V8JNA7_9BACI/2-170               .............................................................KILGAIFILLASTFTGFEVAKQL..SERPRQLRQLKTALRSLESEIMYSNRPLHEISHMLS...........KQF.PN.......PLSLF..FKEFEQRLTQ..-.........GMTTAKEAWEYALQTH....KKA....LAFKEGE...LEVLKQFGETLGQHDRYSQQKHILLAINHLDREEQDALEQQNRYEKMIKSL.GFLSGLLLVILLM..........................................
R6KNG9_9CLOT/5-177                   .............................................................KWTGAILVLFSAGGLGIWSAMQW..KGRLRMLETLRQMIYFLKGEITYSRAPLAEALERVG...........KRE.PG.......PLGGL..FEAAAEGIYM..Q.........EGESLQEIWRRQVMDL....NTDg.grIPLVQED...LEQLAHLGEHLGYLDVDMQERTLKLYLEQLDLTIDYLRQNQREKCRLYTSL.GIMGGMFLVIVMF..........................................
A0A101XSK2_9BACL/1-168               .............................................................--MGSAAVLAATTLIGQALANRI..RDRPSNLRRLCSSLRVLQTEIGFRRAPLRDALMRAG...........AAA.RG......tPVAKL..FEDAAEKLAK..-.........PGSTAVDGLVAAVYKH....RLA....CSMELED...AQVMIDLAQSLGATGASDQVASLQASIAMLEAREREALIARDRFARVYRTL.GILAGVVVVILLI..........................................
R6N2U0_9FIRM/6-167                   .............................................................KIIGCILLVSATTLMGFKKAQRL..YKRRDFINDFLVFLDTLATNIRYSTDELSIILSKSE...........DRF.GK.......----A..IYGAYEK---..-.........YDGTFFKKWKNAVADI....SDG....YALKHED...KQLLCSFGEKLGITDVEGQLKHIELYKGLANAHLDDSKNEIKQKSRLYKTM.GFFVGTAAALVII..........................................
U2CLD4_9FIRM/3-172                   ...........................................................ke--MGCLIIIGASTIAGFMYSERF..KKRVKQLNEFERAINQLQDEIEYTHTHLPEAFNNIA...........SKS.EN.......PINEV..FYKTSELLYE..G.........DAESVYDAFEKSINDK....TIE....LNLDEDD...INVILDLSKTLGDSDIDGHKRMFSLVRNNLKKRISIAEISMNKNVKMYRYL.GFTIGAMLVIVLI..........................................
A0A024QBV3_9BACI/2-170               ............................................................q-WVGALLFICTTTWIGFEWSNRL..ANRPKHIRQVKNALQILEAEMMYSQLPLQDAFHTIK...........NQT.PF.......PIHAF..FDRLYKNMNQ..-.........ESKDFGIVWQNSLDEL....MDI....SCLGNNE...KEILLQFGQTLGQHDFLQQQKHIQLAASHLDRELEDASEQYQKYGKMTKSL.GVLCGLFIVLLLL..........................................
B8D2E8_HALOH/4-173                   .............................................................KLIGSLLILISGSSLGWLIGFHY..LKRIKELKELQVAINIFDTEISYGRTLLPEALEVVS...........EST.HG.......SISNI..YMQLATGLKK..D.........RDKRFRDIFKEILSRY....EEE....VSLTPAD...IKILIEWSQQIGVTSLEGQRKANKMAIKRLEQVEKRAQDLADKRVKLSRYA.GVLLSLLVIIAL-y.........................................
A0A0J1FD49_9FIRM/3-169               .............................................................-ILGAMGLIAAFGGIGLWLAARV..RRRPEEIRVLLTALALLDTDIYWGATPLPEAFSGIA...........NRV.EG.......PWRSF..FAEVKERIE-..-.........MGEAAWPAWKETIARQ....TGA....FALKPED...WLIVLDIGKGLGRSDQQEQHKQLEMVQKQLALLREQVVIWAEKQAKMWAYM.GFLVGCASAIFLI..........................................
Q8EQ30_OCEIH/2-170                   .............................................................KWIGALLLIGTATTIGFEWSNRL..KQRPKHIRQVINALQVLEAEMVYSQVSLQAAFLIIA...........QKS.PD.......PIRLF..FQGMAEQMDR..-.........IPFDFDQIWQEQVSQL....LIN....SALQSSE...EEILLQFGKSLGQHDIEQQQKHIHLTKVYLENQLTEAQDAYQHYGKLSKTL.GVLCGLFLVLLFI..........................................
A0A0F0C844_9CLOT/4-176               .............................................................KWLGSLLVLFAAGGFGVWSAMQW..RERLRLLEKLRQMIYFLKGEITYSHAPLAEGLERVG...........KRD.PG.......PLGTL..FTSAAEGICR..Q.........EGESLQEIWSREVGLLs.spKVR....LPLTDED...LEQLTGLGEHLGYLDVDMQERTLKLYLEQLDLSIDYLRTNQREKCRLYTSL.GIMGGMFLVIMM-y.........................................
C0EFZ6_9FIRM/3-167                   ............................................................r-LAGALLLAACPAIIGILLSSGL..SRRRTELLQAIELIERLKTEISYSAREVNEIVRGLG...........EED.CF.......EKLSF..LRECSAQL--..-.........SKMPFPQAWRTAVQSA....--P....TAMSGDD...LEQLASISRILGASDAEGQLSALEVVEQNLKRNLEQAQQLCTTRGKLYRSM.GALSGAALAILIL..........................................
A0A172TM17_9BACL/3-171               .............................................................KLLGAVIIIAAGTLFGFIQSAKY..ANRPKEIRELIQALQRLETEIHYGFTPLPEALTALS...........EQA.TE.......PLSSL..FRTASEQLKR..-.........QGMTAAEAMHEAVKVH....WGA....TSMGKAE...QQVMRQLGHTLGVSDRDNQIKHLRLAMNQLQSEEELAREQQRRYESMWKSL.GALGGALVAILM-y.........................................
F9VKT2_ARTSS/2-170                   .............................................................KFIALLIIFVCISLIGIILGNGY..KFRVKELQEFEAVFYSLKNNITFMRTPIAYALRESC...........-PQ.KS.......ELSIN..LHKIADEIEN..G.........DFYNLVDCVRRVFEKN....KLK....LYLNQSD...LDMIYDFFNNIENSNLNSFENVFCIFTKRIEDQLIEAIEFRNKNKKVYSTL.GIGVGAMIVIFLI..........................................
A0A160IQ00_9BACI/3-171               ............................................................s-WIGAIAILSATTIFGFEWAKRV..RERPKKLRELKVTLQALEAEIMYGSTPLHEAFLHIG...........KPL.KE.......PLSTF..FLTISDTLVE..-.........GELSVQEAWDIQLAVL....AKE....TSFKMGE...IEVLRQFGATLGRHDKEHQQKQIQLTLAHLNREEKEARDIQERYEKMCKSL.GVLMGLLIVILLL..........................................
A0A124FZH2_9FIRM/1-154               ............................................................m-----------------LVARGY..SLRPVELRSLKSALQMLETEITYAATPLAEALGLVA...........ART.DC.......RLAPL..FEETRKELLS..M.........SGCTAKEAWEKALFKF....YPR....SSLIGCD...ISILRSLGGALGISDSSGQSKHLRLAMEQIGAELEKAEVSALQHVKLWNYL.GFLGGLVIVLIF-y.........................................
A0A150Y9B9_9FIRM/4-177               .............................................................KLFGAAFVIAGCSALGIGYGRKL..NLHLEELRFLRELYRMIRGEIQYTKEPFPEVMLEVS...........SRI.KE.......PYASL..FVQAHRAFEE..Q.........GSLQFPQWFRSYTSGTlesyRRE....RGMTDEE...WEQFLSLGGQTGYLDLDMQIGTLKLSGERWETWIREAESQIGPKRRIGSCL.GVLGGVFLTILLL..........................................
A0A0B0HV75_9BACL/3-172               .............................................................KLFGAVLILLAGTLAGFHQAARF..AARPKQIRELILAMQRLETEISYGFTPLPDAFRRLA...........GQL.GE.......PLRSI..FKSAANHMAS..G.........SGNTAQESIQRSLHDH....WKR....TAMKAPE...RDILHQLSFTLGTSDRQDQIKHIALAAQQLKHEEALARDEQAKYEKISRSL.GLLVGALIVILI-f.........................................
R7K2T2_9CLOT/9-177                   .............................................................KITGSIMALAGSWGCGMWLAARR..RRRIELLREMEQILIFLYGEIEYAAVDVAELFQILA...........GKM.CY.......-FGSF..FEELCRQFQG..I.........EQETLYDLWKKAIAGS....RLA....EGMDKED...VALWQEVGMQLGTLERKTQLQTLQVLRERLHRQALEAEAEYKAQARVYRLT.GVTGGIFMVILLL..........................................
R6AIN6_9CLOT/3-164                   .............................................................KLLLAAAAFCICMAAGRVAAEKY..KLRQKTLCGFLSDLKVLEAALKYERTDVKSLALLLA...........--A.RG.......SLREF..WRIMSDELT-..-.........NGAGFGEAWRRHRCE-....---....LMLNEDI...GAIADGFAEHFGSNDAETELRRLEGTLKQLSEKEKIQCAIFMQKSRLAVSL.SALLGAAAALMII..........................................
R6QZU0_9FIRM/3-172                   ............................................................r-LMGTVLVLFSCTALGWSRSMTL..QKRLGQLREVEKMVHLILGEITYRKETLPEALLRIS...........EKT.AP.......PFSEF..LREVSRQASL..F.........QGDCFSKIFRETAQQC....LKD....SALHKKD...LEAFSQLGEYLGWMDITLQKNTITLYQEQLKQEIQYLERELPGRKKMCQSL.GVIAGIFLSIL--cl........................................
R6K031_9FIRM/3-175                   .............................................................KLSGAALIIVMTTYYGFYLAGQL..KERINVIDAYIYSLNYIQSQIKYGLTPLPVICSELS...........KSI.TN......sIVSSM..YEQVYIKLSDitQ.........KEDTFNEIWLSEAKKL....IKS....GIVKKEE...ISVIKELGNINTYIDRNMQLQCAGNVEYKLKNIYQRLQSEAGTRSKIYQIS.GVMAGIVITIILI..........................................
G5IBS7_9CLOT/4-173                   .............................................................KIIGGICVIAATSGLGFWMAGQW..KAHLLAVEQLRRMIFMLKGEIIYANAPLEEAFYHVG...........RKN.DG.......ALGRF..FVAVARRIEM..Q.........QGEAFYAMWKEEIDKL....GND....SGLTGKD...RQELAGFGEHLGYLDCDMQERTILLYLEQLDIAIDYLREHQREKSHLYTSL.GIMAGLFLVIVL-c.........................................
A0A0E4C8J6_9FIRM/5-174               .............................................................KTLGIVFIIAGFGSYGLMGARRI..EKRVEQIKNIRMALGFLEKEITYLQTPLYLALKKTA...........LLT.AQ.......PVKIL..FGESSRLLQD..R.........QGITVGEAWEKALQKL....KPA....CDLNQDD...LEILKAVANQMGSSGIKEQIKLFQLIQEELQIQEENARDQMESGRKLWSYG.GFILGTMVVLLLL..........................................
A0A0V8QFX1_9FIRM/3-175               .............................................................KLLGGILVLLSCGAAGICMAEEK..KQQLQSLKEIRQFFMLLSGEIRYGGTTLSEAIKAAAg........kqKRN.KN.......SLKEA..FAEIAVKMEG..R.........AAGSFFEIWQEELLDK....AKK....ASLSGRN...LEQLLRMGETLGGLDRETQLNSLNCYLEEIEREIIAEEKRIGEKVRLYRWL.GALAGAFVWILLL..........................................
A0A132NC42_BACSC/1-157               ............................................................m-------------WSGLAVAEGY..RMRPRQLRALREALVRMETEIVYGRTALEEIFRRLA...........AGT.SG.......PLAGF..FAEVAEAIA-..G.........GTDDLAPAFRQAVERH....FPR....AHLGREE...QAAVSALAEVLGRTDVASQIRHLRLALSALEALEARAREEEARYGRLARAF.GFLFGLFLLVLFL..........................................
R7G1Y7_9FIRM/1-164                   .............................................................------MVILAGSGWGMLQAAKI..EECYRQMRYLRKLIFRIRSEIRYSRRVLPEAFLSVG...........SEA.QE.......PYKMW..LLSLYERLEN..R.........QGTSLAGIWEEETRTH....LPV....IGIPQDM...LESLIRLGGELGTIDIEMQVRTLDLYLEQMEQKMEDMRTEQKEKIRLYQCI.GVTGGVFLAIILL..........................................
A0A150M796_9BACI/3-171               .............................................................KITGALMILLATSWIGFELSRRY..AERSSQLRLLRSALQSLEAEIMYGHAPLHEASRRIA...........KQL.RA.......PVSEL..FAAFAGKLLQ..-.........KDTTVKDAWEESLSEV....WKR....TALEKNE...YEILRQFGETLGKHDKIQQQKQIILALTHLEREEKEAREKQAAYGKIMKSV.GFLSGLLAVILLL..........................................
A6NV03_9FIRM/3-170                   ............................................................r-LLGAVLLTGGAGALGFGAAARL..NRRVHVLRLFTEALERMERELSFRLTSIPELFALLS...........DQL.SP.......PVGIF..FARCRGNLFR..L.........GEERLEDLWRNTLAES....--D....LELEPEE...QQILETLGGILGRYDGEGQTQALALARAQLEQCLEAAVAERNKMGKVYGAL.GLAAGAFLVIVLL..........................................
X0R4D8_9BACI/2-170                   .............................................................KLLGAICILITATLIGFEYARKL..SERPKQLRLLMSAMQSFEAEMLFGLTPLAEASQKIA...........KQI.PK.......PLSHF..FQAFSSQLY-..D.........KQDTAYKAWERSLEET....WGE....TALLETE...KEIMRQFGSTLGQQDHEQQTKQMKLTLMHLEREELEARDKQRKYEKMFKSL.GFLSGLLIVVILI..........................................
R5JGP9_9FIRM/1-168                   .............................................................--MGAGIIFAACVLLAVRYAHYR..NSLFRQLKGLISLVEITEGELRYSSTLLWEIFDRAV...........PRL.DP.......CFENW..LNYLKDRLVN..T.........DMATFAEIWADGEAVL....FAD....TFLMEAY...GEYVEELGGVLNYLDVTTQLSRIEYLKSKLMDELDRLKEDNARNIKLAYYI.CILAGAFLVILLW..........................................
Q818Q4_BACCR/10-168                  .........................................................sapf--------------SGFRYAKRY..SERPRQLRLLKSALQSLEAEIMYGHTPLSEAAERLV...........KQM.PK.......PLNWI..FQSFAKKLES..-.........GEQTVREAWIDSLKEN....WKL....TAFQQTE...YEILQQFGETLGQHDRESQQKHIRLCITHLEREEEEAKALQLQYEKMIKSL.GVLAGLLIVILLL..........................................
A0A094JM94_9BACL/3-172               .............................................................KVLGAVLILMATSKLGFDSARQL..RKRPRQIQELRSGLAILKTEINYGTRPLAEAFERIA...........EAA.SG.......ELKPV..FLEAGRNLKS..S.........DGKSTYECLKKAIEDK....WKK....TVMGEEE...KGIVLKLCQVLGSSNRSDQLHHLDLAQENLQMEENKAREEQETYEKMVKTL.GVLSGALLVILMF..........................................
E6SL65_THEM7/3-171                   .............................................................-WVGFVLVVTACSAWGWQRATEL..GRRPGDLRILRTALQALESEIAFGAVPLPEAFARIA...........GFY.PD.......PAATL..FRTAAARLAP..P.........RSLGAAAAWDEAVAAA....VRT....GGLTPDD...RAILRAVGPYLGATDRDDQVRHLRLAMARLEAAEAVARDLDQRWGRIYRYG.GLLAGAFIGLLLL..........................................
R5LF31_9CLOT/5-172                   .............................................................KITISILIILLSAYIGNIKASKL..KNREYILRDMLTFLELVKNEISYMLSYLPNAYESSR...........QKL.NT.......TLKDA..IGNIVVDMLN.tD.........STYIISKSISENIGNI....---....NELTEYD...KNVIISTLNNMGRSDLDSQVNIINNSISILENQIKEANEIKLNNSKMYKTI.GVIAGIMVVVIFI..........................................
A6LU35_CLOB8/3-172                   .............................................................KLILIVCIFIISTYIGFAYGETF..KKRQEQLKEILKSLTILQNDIVYGTTPLPEALENLS...........HKV.CK.......PLSNF..IELVVNRLLK..G.........NVESVYEAALEEFEVL....ENE....FYLERDD...RKIMSDFFKSLGESGVYGQEKIFLLAIEGIKINLSDAEENAKKNTKLYRYL.GVCLGAMIIIFMI..........................................
F0T0S3_SYNGF/3-169                   ............................................................v--IGYLGLIAGLGCLGLLQASRI..KRRPKELREVINAMALLDTEIVWGITPLPEAFGILK...........ERS.EE.......PWNQF..FAELEKQLL-..-.........KGENMRTAWLDTTKKL....RSR....FCLSEDD...WKVIMDISKGLGRSDKAEQHKQLALAQKHLEAIKESAGEDAEKKAKMWSYL.GFLSGAALVILII..........................................
A0A0K8JJI7_9FIRM/4-173               .............................................................KLLGSLLIIFAGTSIGCSFANRC..SERPKQIRHILNCLASLRSYINYAAIPLPEALKLCT...........NST.EG.......VIRDL..FEGMSGILER..T.........GWITPKDAMLQAIALF....EKN....MALDKPE...LEMLVLLGANLGTADHTEQEKFLSMIQSELEKIEQNAIKLRDQNVKLYRYL.GICGSLAVIICL-v.........................................
C0CY20_9FIRM/4-40                    .............................................................KYLGAALILISAPGLGMYLAGQW..KERLRLLEKLRQMI----------------------...........---.--.......-----..----------..-.........----------------....---....-------...---------------------------------------------------.-------------..........................................
R7C103_9FIRM/3-172                   .............................................................KVLGSLIVIFAGIGFGFHKAAKE..QRRLEQGIAIKRMLYLLQGEIRYGFTPLPEAVLKIS...........TKT.EK.......EYQPF..LKNVAKQLET..H.........SEESFAKVWQQAAEKK....LKQ....VIYEPKF...YEILKNMGETIGYLDQQMQEKTILLTIEQLDDQIFLMKDQVVKNCKMYRSL.GISLSVLIVIILL..........................................
R4KAY4_CLOPA/3-171                   .............................................................KLIGGIIIIAASTLGGFIYAQSF..INRVKELNEMERCIYQLQNEIVYTHTPLPEALTNVA...........IKA.KD.......PIADI..FNKTSQELES..N.........IYDNVYEAFKNAFKGN....-NN....LNLKNED...INLILDLSKSLGESDITGQINIFSLTMENLKKIIAQAEITMKKNVKMYRYL.GFGIGAMIVIMLI..........................................
A0A162URE0_9CLOT/3-172               .............................................................KILGCIMILCASTGMGFTYGERF..KKRTKQLNEIQRCIHQLQNEIVYTHTPLPEAILDVS...........KKS.IN.......PIKNI..LEQVSSLLFF..N.........EVDNVYQAFKKVIEEQ....KDN....LNLKKED...INIIFDLSKTLGESDIDGQQRMFSLTLENLKKQLKSSEDLMKHNVKMYRYL.GFSLGAMLVIILV..........................................
V9H3G9_9CLOT/3-172                   .............................................................KITAVIIIFLSCTYIGFYYGEIF..KKRSKQLNSILKSVLFLNNEVIYANTPLPEALKYIS...........LKV.EA.......PLNSI..LSAVSDKLLK..G.........ESTSVYEAFESEYKKN....KSE....FNLNEED...KRLVNDFLRPLGESGVYGQDKLFNLTIENMKLNCRSAEELAKKNVRMYRAI.GVCIGAMISIFLI..........................................
A0A0M2VMT7_9BACL/3-172               .............................................................KLLGAVIVLVAGALAGFYQAQQF..ASRPRQIRELILALQRLETEISYGYTPLPQALDRIG...........KSL.RD.......PLRTL..FTDAARHMSP..R.........YGLSAQESILKALNGH....WKQ....TSMKASE...REVMEQLSGVLGTSDRQDQMKHIALAAGQLRHEEAAAREDQAKYEKMSKSL.GLLVGALIVILI-f.........................................
A0A0Q9LRZ7_9BACL/3-172               .............................................................KLLGAVLILFAGTMIGFQQAAKF..AERPRQLRQLAHALQRLETEIGYGHTPLPEALERTA...........AAA.PE.......PLASI..FRKAASGIWE..T.........ESFTFRDSWEQAIKSQ....WEA....TSMRKNE...QAVLIRLGSTLGISDKEDQMKHIHLALLQLKAEEDAAREDQGRYEKMWKSL.GILIAVLIVILMV..........................................
B0PBE3_9FIRM/2-166                   .............................................................KIGGMVLVIACTTSIGISFARAL..TERVRELERTLAALSSLGTELSYSLAPPAEAVAKLD...........ERE.TE.......--SAA..FIPACASLC-..R.........RGKPFPQAWREAALMF....--H....GALSQED...AEILAGLSDTLGQCGLEGELSSLEHTRTLLSMQLDTARARSATHGRLYRTL.GLLTGAFVIIFFI..........................................
T0PFZ4_9CLOT/3-172                   .............................................................KIIGILLILISSTVIGFMYGETM..KNRVKELNEIQRGVLILKNEINFMHSLLPDALMRVS...........EKC.TG.......SVSKI..FKDASHILMT..N.........EEIDVHASFKKSVDLN....KSI....LNLKKED...ISIFLDLSKSLGELDVEGHNDMFNLVSDNLDKAIVGAENNLDKNIKMYRYL.GFSFGAMIAIILI..........................................
B0TEH5_HELMI/3-172                   .............................................................KLVGAALIVGAFSAGGFMTARDL..RRRRQILASLQSALAMLATEVAFRATHLPEALVQVS...........RTA.GP.......PVNAL..FAEAGNRLRR..A.........EGQAASAIWLQSVGDW....LPR....TPLHPSD...GEELARLALGLGAAPREDQLHRIEEVKNRLAYLEQEARERETRMAKVWSYG.GVLLGAAVVLTI-w.........................................
R5P7W4_9FIRM/3-172                   .............................................................KFIGAVLVIISGTGIGFKASENL..ILQNVQLKKLKELLIILRGEIRYNNTVMPQALRNIL...........KKS.DK.......VFEKF..LLYVADNLDK..Y.........QGKTVADIWNEGVDKE....LSK....LMLSKKH...IEKLKDLGNTLGFLDKEMQISYFNLMIEQLDTDIEDNNKRCRDNCKLYRTL.GIMGGILVVLII-v.........................................
I0JNW2_HALH3/2-169                   ............................................................e-WIGAVLILTVTTLAGFDIAARF..KQRPGHIRQWKNALQMIEAEMVYGQSSLWEVCENLA...........RHL.PP.......PTSQF..FEKINQDQ--..E.........PCSDFASLWESRLKKH....WSS....NAMGKSE...WEILLQFGRTLGQHDLEQQQKQIQLALHHLDRELQEALDGVDQYQRMARGM.GVLSGLLVIILII..........................................
R8W8I6_9CLOT/5-173                   ............................................................a--MGAMLTLGACATLGMAARGKL..RRRISVLSSMLDACTFLRAEIEGPHTPLPDLIEVLA...........HSQ.NP.......DQRRL..FGEMKKRMEQ..S.........PGMSLGYHWSSTVRDL....REE....LQLGEEA...AAILRDASAFLGRYDTSQQLQCLSYAMTRLESCRQQACEAYRRHGSVYRTC.GIAAGIFVVLILI..........................................
R6ICS7_9FIRM/2-169                   ............................................................n-LIGAMLIMLSCTAAGLMKARSL..SELDKTYGTLIAMLTLIKNEIVTLSAPLDEAFERAA...........GLA.NG.......DVGRF..MSQVRRDFEK..L.........GEDSFCGIWRSAARDD....L--....QSLSERA...LSAVEELGASLGRYDSTMQCTAIDRCINEISLEQQTLRLSLSSNKRMYIGI.GGAMGLIIAIVLI..........................................
B8I3C0_CLOCE/4-172                   .............................................................KIIGSVLLICATSLIGFSLAADC..SKRPKVLRELQVLLQMLENEISYLSNLLAQSFERIY...........TSS.KT.......DASLI..FKEAAENLS-..L.........PGITADTAWEKAVENT....YSK....LGLNKED...KGILITFGKMLGSSDLEGQINNINLVSSQLKLQEMKAEQMRQKNEKMYKSL.GVLSGLAIVVVLF..........................................
Q894F9_CLOTE/4-173                   .............................................................KLLGALLTIASSTAIGFLYSNKF..KKRVYQLKSIERAVYEIKNEILYTYTPLPELFSKTS...........EKS.SF.......PINKL..FESISNLLKT..N.........AVNSVYEAFIKGFQKV....EDK....MELKKED...KDLILNLAKTFGESDVQGHMNIISLTLEGLKKQITEGEIAMKKNIKMYRYL.GFTIGMMIVITLF..........................................
A0A117KYG3_9THEO/2-171               .............................................................KLAGAGLVILSCGFLGIGLAQAY..FERPRQLRTLSAALKMLETEIVFGATPLPLALARIG...........GRL.EE.......PVALL..FRVSARLLQE..E.........RGITAAEAWEGGLEVL....RDK....GSLTPGD...LDILRILGQGLGVSGREDQAKNLELARQHLHRQQAAAEEDANRQGRMWRTL.GFLLGAAVTLLM-y.........................................
A0A061NV86_9BACL/2-170               ............................................................r-WIGAIILLVGMTTIGFEWARRL..SQRSKQIRELTTALQHFEAEVMYGHTPLIHVANRIS...........STV.SS.......PLSQF..FKDFGTRLKE..-.........GNHDVQSAWQESIAIN....WDK....TAMKIKE...KEALLQFGQTLGQHGRYEQQKYIQLTLTHLRAEEINAREEQLRYERMAKSL.GFLGGLLAIIVMI..........................................
R5T8Q3_9CLOT/7-176                   ............................................................r-LLGAVLVVVSCSGMGFFLAGQW..GERLKTMEHLRKMIFLLKGEIVYARSALPESFERTG...........KKG.GG.......EIGDL..FVRVAGRMEG..Q.........RGEPFYDIWQEEIEKL....PKA....FCLSKED...RQSLKGLGEHLGYLDLEMQERTILLYLEQLDLTIGYLREHKQERSRLYTSL.GIMGGIFLTIMM-y.........................................
R6JN57_9CLOT/1-147                   .............................................................------MIVLFCGAIGISLAVDV..GRRCERAQLLCRLGEQVRLLLDYSMTDTGAIFAQLA...........SDP.RF.......APFGF..L---------..-.........QGCDPAK----TVTV-....--A....TGLTARD...DQELADFLQRLGKSDLQNQLRLTDGYIAFAKGRAEEYAARCKRQKQLYVAF.GLSGGLIAALLL-a.........................................
R7GAR3_9CLOT/5-119                   .............................................................KYFILFLIFILSNIIGKSIAKKY..TYRLEELKEMKSALNIFKTKIEFTYEPIPEIFLEIS...........KNT.SK.......TIANI..FEMAKLEM--..-.........DKTDAQTAWQKAIDES....--E....NNFKEED...KKTLKVMAKML----------------------------------------.-------------rkv.......................................
R5XPI3_9FIRM/3-172                   ............................................................r-IIGGILVIAATSGIGFLYSKEL..QIYLEKMLYIRHLIYLLKGELEYCVAPIGEVFGKIA...........QRV.KQ.......PYKNW..LLAMQKQVEN..R.........EADEFFTIWMRTIDQY....LGE....LSLKPSH...LIQLKELGCYLGQNHTAVESRNLQLYIERLELEIEKMREGIETKRRIGSCL.GVMAGIFLVVILL..........................................
W7YYL3_9BACI/2-170                   .............................................................KWLGALIIICCTTLYGFYRANAL..KERPKQIRQLRSALQSLEAEMLYGQTPLAKASLNIS...........QQF.SG.......PVSHF..FQQFARKLNE..-.........KETTAKKAWEESIQLV....WEE....LSLKTNE...REVLFQFGATLGTMSREQQQKQLKLTQTHLERDELEAKDLQMKYEKMIKTL.GFLAGLLIVILMI..........................................
R5ECS1_9FIRM/4-170                   ............................................................r-WFGAALVIAGCGGFGFSIASGY..KREEGILRQLLRALNYMEWELQYRLTPLPELCRQAG...........KET.RG.......TLREV..FFNLARELEW..Q.........TSPDAASCMTAALKRS....---....HELPRRI...RGIMKQLGHTLGRFDLPGQKQGLEEVRESCRMELEALGKNRETRLRSYGTL.GLCAGAALAILFL..........................................
R7FH89_9CLOT/5-123                   .............................................................KYCMLFFVFLIATLIGKNISQKY..KFRLDELEELKNALNIFKSKIKFTYEPIPEIFVGIS...........NNS.NK.......NISNL..FNMAVDKM--..-.........KTESAGVAWERAVDEF....--Q....SNLNEED...RQALKTLSKLLR---------------------------------------.-------------snrytg....................................
A0A0M0KYS1_9BACI/2-170               .............................................................KLIGAVMVLVACTLVGFEFAKRL..SERTRQLRQLKAALRSLEAEIMYSHRSVGEASATIA...........AQI.PK.......PLSML..FTLFADKLE-..D.........EEVSVKSAWFASVEES....WGK....TALKKPE...IEILKQFGETLGQHDRYSQQKHILLALNHLEREEADAVDQQNRYERMMKSV.GFLAGLLLIILLM..........................................
A0A0N0YD81_THEVU/2-171               .............................................................KLIGGLLVILATSWLGFTFAGRV..RDRPKQLRQLRSYLAILKTEIEYGTRPLAEACANIA...........SQE.ET.......AVSRL..FQASADQLLR..G.........DGSSTYECFRRAIEQE....WQR....TALQQAE...QTVLLQLCQVLGSSDRQDQAHHLTMACNQLELEENRAREEQDRYEKMYKTM.GVLTGVLLVILMI..........................................
A0Q091_CLONN/4-173                   .............................................................KILGSILVLLSSTLLGFICGENL..KRRFLQLEEIEQALYQLKNEIVYTHNSLPEIFMSVG...........SKG.TK.......PIGDI..FKRVSSLLYD..H.........EVESVHEGFKKALNEN....KKQ....LNLKKYD...IDILLNLSKSLGESDIEGQQNILTLTIRNIKSQLDSAKNVMEKNIKMYRYL.GFSFGAILVIMML..........................................
R7FQQ8_9FIRM/2-167                   .............................................................KAVGAALVFFAAFTCGLLAGKRE..QRRIDEAEAFLALFEYIKNQVGYFLTPTKLIYRGFE...........NKV.LS.......DVGFL..-----DRLCS.hE.........NDEIYFDAWGDAFRAC....EGE....LHLSAEE...KRTVLRFGECIGKSDEHMQLKSFDYYIGLLSSELEKARSETAKNKKVYRTV.GFAIGAMAAILLI..........................................
L0F7P7_DESDL/3-169                   .............................................................-WAGAFLLIMGCGSIGLYRAALI..RKRPVELRECLTALALLDTEIFWGSTPLPEAFAILR...........ERT.DG.......IWSDF..FAELSERLQ-..-.........GGEGASSAWNATIDHQ....IPR....FCLKSGD...WQVIKDVGKGLGRSDRQEQHKHIELVKQQISLVKEQATQSSEKQAHMWSYL.GFLGGIAGVLFLI..........................................
J1H3U7_9CLOT/1-146                   ...........................................................me-------------------SRKL..GGRVRELEAFYSFLCLTREEIRYSGMPVERIIEKHG...........---.--.......KNQRF..LVLCAEYC--..R.........KGESFPRAWEHGMDDG....LLT....TGMNRQD...LEYIRDFGLGFGASDTEGQLAHCQLYLGFISSALTHAREERDKKAKLYFML.GLFGGIAAALLL-s.........................................
Q5KX94_GEOKA/2-170                   .............................................................KWFGALLILAASTWLGFAAARVL..HERPRQLRQLKAALRALEAEVMYGHTPLADAAMHLA...........RQT.AA.......PLSEL..FERFAAALCT..-.........EETSAAEAWEKSLRAV....WGK....TALKQGE...FEVMKQFGATLGQYDRLTQQRQIALALAHLEREEAEALDNQARYAKMAKSL.GVLAGLLLVILLM..........................................
R5LXU5_9FIRM/1-158                   ............................................................m---------ISTTLYGYRMSLDL..KAEYNELLEIKKMMFLLKGEIAYGSCTINEALANIS...........TRC.GM.......NIDNI..LENIASD---..-.........TEGNFYENWEQKWNDG....FLN....MHLSKNI...KADILNFKDVLGLADKSGELSQIDLFLSRLQNEIDNTENILPQKCRMYRCL.AVGAGIILSIIII..........................................
R6EIE9_9FIRM/1-164                   .............................................................------MILCGCLGLGMWYRGQF..LMRLHMTRELICLLDQWISEIRYNRSTLPEGCRQIG...........RQR.ED.......RLGEI..CNRVYREYAE..A.........GGTGFLEIAGESFRRQ....LEA....LPLKKEE...IDQFLIFAGKEGYADETMQIRAMELSKEGLERTATAQQREITQKCRLAVGL.GAMSGMFLVLLLL..........................................
M1ZJT6_9FIRM/98-266                  .............................................................KGFGALLVLLMATLAGFLISNRF..SGRTKEIRQLENLLLALETEILYGAKPLGEIIRRIG...........ERE.KG.......PIAHI..CQRIAVRLKE..-.........REFTFWQVWEEELRRG....WPT....THLKGDE...QEVLLQLGSVLGLSDRETQRNHLRLALAHLRAEEKEAMDDQAKYEKLSRTL.GFLSGLLLVILL-y.........................................
R7I7Q5_9CLOT/3-172                   .............................................................KIIGSICILFGCSAVGFCLVDQM..RKRLQELLFLRKQLAFMEGEIRHGLRNLPEIMFSME...........QRC.TG.......EWKVF..FHRVAEKMYE..E.........KNAPLTEIWKDTMREV....LQV....SRLTVKQ...KKEWEELGENLGYLDCEMQLVLLQICQEHFQDFIREEQEKYKKHARLYQTM.GVMSGIFLVVIFI..........................................
A0A0L0W7F4_CLOPU/5-174               .............................................................KIIGCLLTLSSCSLLGFNYSKRY..ANRLNNLVFIQNCIQLLETEIIYSANPIPEALENTY...........KKG.NK.......KVSFI..FKDIKDHLIS..N.........KNISLYESFKYNFYLS....KDK....LYLEEED...IEMMLLFGRNLGLSDRMDQQKHFKSILMNLKTQQDDAEDKKNRNAKMYKNL.GVLLGLALVLIL-y.........................................
F5SB01_9BACL/3-172                   .............................................................KMIGACMILLSTTAFGFRKARAY..AERPRQIRQMRGALSLMRTEISFGSRRLDRICEQIG...........HRE.KE.......PVRSL..YARCAHYLRE..M.........DGVSTFECWKRAVEET....WPA....TELKQPE...KEVITDFGKTLGISDREDQLAHLARTQTNLEVEEGRAREEQERYEKMCKSL.GILGGALIVILI-y.........................................
A0A084GWE3_9BACI/3-171               .............................................................KLLGAVFILLATTWAGFETAKHI..SERPRQLRQLKVALQALEAEIMYAHTPLKEAAATLS...........KQM.PK.......PLSWF..FEVFSKRLSA..-.........GHTSVRAAWENSMQEV....WRM....TAFKQGE...YEIMKQFGETLGQHDLLSQQKHIRLALAHLEREEADALDRQSRYEKMLKSL.GFLSGLLLVILLM..........................................
R6ZUU8_9FIRM/4-173                   .............................................................KIVGSLILLVGTAALGVYYAGQY..MERLRNLMEMKKALMQMQGELRYLHSAMPDLLETIG...........KRT.RG.......VLSPF..FLSLAKEMDK..K.........EQGDFASLWCSQIKKK....IPL....SALEPEA...RNLLFETGRQLADNDRQSKEEGLTFALKQLEDMIHRRNKEKQNRLKLYYVC.GIMVGAMLTILLV..........................................
E6TXN9_BACCJ/2-170                   .............................................................KLLGALLIIATTTMFGWEFSRRL..TRRTKQIRYLKIAFEALETEMTFSMTPLPDACEKVA...........HQL.IA.......PLNIF..FEDVAERLKK..-.........EEKSATSIWNSSLKKW....KGK....TDLNTAE...LNILNQFGQTLGQQDLESQRKQIRLAISYFNQEEKQALEDQQKFESMYKSL.GFLGGVLLVLIML..........................................
R5PDC9_9CLOT/1-166                   .............................................................--------------MGILRAMAI..RRRVKEMQEYARVLSVATAELRYRRDILAQVFVRVA...........KKC.RQ.......PYAAW..LSELSQALME.aQqrqaysyteVAADFDQIWIEHADKL....YES....SGLKQED...MEYIYNLGQTIGYLDVQAQEEGLALLQADLGRHIRELEAEAKDRMRLSLVV.GSVAGVLLIIILI..........................................
R5HGP6_9FIRM/4-169                   .............................................................-LLGKTLLFAGCTAFGLLRGSRL..RQRTACLGEFRRTLAGLARELAFSLRPVSDLMAGAE...........AGT.QG.......PTAAF..FRTCRRRFAE..G.........GQESWAESWTEALEQV....--A....LPLEEAD...LRLLQEAGDVLGRYDGESQRQALEGLLRGLEGQAAEAAERARRLCRVYLAL.GLAAGLFCLILL-..........................................
R5VM52_9CLOT/3-170                   ...........................................................fg---GFLMIWGGCLGTGIWCCCRY..LRGIRTMMHLEVLLLLMEERMRYGRNSMTTVLQELS...........NKS.QG.......EMKKF..WQSMIEPDF-..S.........GEESFAQKWRRQACQH....MKA....ACLKGEA...LEEFAELGSYLGNQNLNQQLLSLEQYRSRLHASLLEQQKLKPKYIKLYPVM.GGCLGLILCMLMV..........................................
A0A151AQ92_9CLOT/22-191              .............................................................KIVGCTLILICSSLIGFLYGESL..KKRVFQLKEIEQALLELKSKIVYTNESLPKAFQDIG...........YKC.NK.......PIGDI..FVEVSNLLYN..N.........EVDSVNEGFKRMFKQN....RDK....LNLKQSD...IDIMLNLSKSLGESDVEGQKSILLLTLENVKKQVYDAEIEMNKNIKMYRYL.GFSFGAILTIMII..........................................
N4WWI6_9BACI/2-170                   .............................................................KWIGFVCVIGAMAWIGHEVATKL..AQRPKLIRMLKNALQIFEAEIVYSHATIQEACQQIA...........TQI.PD.......PLSQF..FQHVTDRLDK..-.........NPDSLYAIWKEEVNNC....WQT....TALMNSE...KEIILQFGRTLGQHDIVQQQKYIQLAQTHLDRKLADAEEMNHRYGRMTRSL.GFLAGLFIALLLL..........................................
A6TR28_ALKMQ/4-173                   .............................................................KLLLSILIVICSGLIGIIYAKAY..IDRSKLLRDLISTLQMLETEIMYGATPLPELMVLLA...........AKS.ER.......EIARL..FQMTAHNLQK..H.........DGHTFASVWRKSVNVM....GKE....TVLKERD...IALLVSLGNNLGISDQENQVKHIRLTMEEMRRNYDEAIMLQRKNEKLYKSL.GVLFGLTVVIVFF..........................................
Q8RAD9_CALS4/2-170                   .............................................................KLIGVILTIFSTTSIGYLMAMKF..KARRWILKSLISALNLLKLEITYSRTPLERALKKVA...........LSS.DK.......TVGEL..FQRASLHLGE..Q.........SGLTAGEAWEKALNEW....-ER....GYLSKEE...KEILRAFGTILGISDAGNQEKNFNLTMDLLKRQLNLAEEEGKKNEKLYQNL.GFLLGLAIVILFL..........................................
R7ISW6_9CLOT/6-170                   .............................................................KTILLFAIFSLSTGIGILISKMY..ENRVKELRQFKNILNIIKTKIKFTYEPLTEIFNQIS...........QEK.SS.......KIEEI..FENMTYKL--..-.........EFENVKYSWMDAIQEA....--D....ISITQED...KDILKELGKVLGQTDADSQVNEIEVTESFLNMQIEKAEEARKKNQKMYKTL.GVVVGLVFVIILI..........................................
R5RJJ1_9FIRM/3-172                   ...........................................................rc--TGALLLFFACCGMGFWKSRQC..TGRVHQLKELIKMGYFLKGEISFARTTLPEALGQMG...........EKV.EF.......PFSEF..VRILSERMKK..Y.........SGENFSHTLRAVMEEK....LKD....TYLETVD...LEEFYSAACNLGYLDKEMQIHILDRYLKEQAQKVEMLTVQMPKQQKLFRSL.GILGGAFFVILFW..........................................
R7FEP9_9FIRM/3-167                   ............................................................r-LAGLACLVLCGGGAGWYAAMGL..QRTRTAAECLSRMLREMAVQMEFRALSMQELLERLS...........QES.SY.......GMFRF..PATAAQRMA-..-.........QGDSVCQAWQTGLTQD....---....KAVPELM...RRILLPLGEELGASDLAGQAETLEQYRMQLEPYTAAAAERCQRLQRLYVSM.GVLGGLLLAILL-c.........................................
I8J694_9BACI/4-171                   ............................................................f--LGASLILFSTSWMGFAMAKKV..KERPKQLRELKVALQSLEAEIMYGHVPLDEAFGHLS...........RQL.NE.......PIAAF..FGELAGALQE..-.........TASSVPILWEEALTRL....AER....SSLKKAE...LEVLQQFGSTLGRHDRDNQKRHIQLTLSHLERELDEATAAVATYEKLYKSV.GVLSGLLLIILLI..........................................
D4J409_9FIRM/1-138                   .............................................................-----------------------..---------MQRSLRMLHGEIRYTGAELPEAIDQIA...........LRQ.EK.......PFSDF..YHGLSEQMRR..M.........DGQSLKTLWQTEIEKC....LNN....TYLTKED...KQIFLESGSQLGYLDRQMQLSSLEACMAQIEDNQNMIRKNMKEKQKLSVAL.GLLSGFFIIILLI..........................................
F3AI40_9FIRM/4-173                   .............................................................KGIGIILIVLGTSGIGYLTAADL..KRHLNDLKCLRRILLLLKEEIAYTHAPLEEAFARIS...........RKV.KA.......PYCLF..LTQVSGQLAR..R.........AGSSFAEIWSCAVEER....LCT....TKLTREE...LEELKEFGNSIGYLGGHAQEGAIDLYLEQLKVEVQDVREGLAAKQKLCSCL.GVMSGIFITILLI..........................................
R5TCB0_9CLOT/5-172                   .............................................................KIIIGGLIVAVTTYIGFLVAKKL..QKREETLRETILFFDMVENEIRYMLNVLPNAYESAR...........QRL.KG.......DLKIV..IGQIVVDMLA.sD.........NYELSGKTISSNINLL....---....KELTSYD...KEVIISTLKNLGRSDVDAQVNILENAKRTIQVQIDEAIEYKNKNSKLYKAV.GTIAGMMIVIILV..........................................
A0A0D1XUH5_ANEMI/3-172               .............................................................KLLGASLIILAGTLSGMQLGGYL..AHRPLQIRQLRTGFTLLETEIIYGSRPLPEALASIS...........RRL.TG.......SGALL..FSRTAEMLAQ..E.........PEWPVSECWHSAVQQV....WPK....TALKGPE...KEIVLQLGSVLGQSDREDQRKHIRLACANLEHEEASARDNQQRYEKMCRSL.GVLSGILLVILL-y.........................................
A0A151B703_9CLOT/3-172               .............................................................KAIGCLLIIVGCTFVGFMYGEKF..NKRVIQLNELDKSIIQLKNEIVYIYTTLPNAFLNVS...........KKC.MY.......PIGDL..YIDARNLLVD..N.........KVDSVYEAFELSIKKN....EDK....LYLNDND...IKILSDLTKNLGESDIEGQISIFELTLKNLEKQIKTAESLRNKNLKMYRYL.GFTVGAVIVIILI..........................................
A0A0C7NK31_9THEO/3-172               .............................................................KMVGGGLIILTCGFLGLEMARGF..SARIEQLRQLNAGLKMLETEIIYGATPLPLALTRVG...........NQL.AG.......PVALF..FQAVARVLQE..N.........AAAGALAAWERGLEEL....GQK....GALQPGD...LEILKALGPMLGNSGASDQVKNLELTRQLLGQQQQAALEENNRQGKMWRTL.GFLLGITLVLLL-y.........................................
A0A0J1GC07_9FIRM/3-172               .............................................................KMLGIGMVIATSSAIGFSMSKDL..EKRVVQLTELKRMFVMLQGEIKYGKTPLAEGFGKVG...........QRS.GP.......LFQGF..LQYLSEEMEK..R.........DGRSLSRIFEEGVDLK....LEH....CYLAKED...LEQLKTVGSHLGYLDIDMQLRNIDLYLEQLNENCIQARQNYQNKSRVYHCL.GVMGGLFLAIILI..........................................
A5I318_CLOBH/3-172                   .............................................................KILGSLLIFVGSLYWGITTANKF..KYRRDELLELERCINELKNEITYTYTSIPDILMNIS...........LKS.KK.......PISTL..FKKISNMLYD..N.........KVNSIYEAFSKGFSEE....KDN....MALKEED...IDIILDLSKNLGQWDPKGHENIIELALYNLKKQSDRAEESMIKNMKMYKYL.GFSIGAVLVIIFI..........................................
A0A074LPW3_9BACL/3-172               .............................................................KLVGGLLILAASTMAGFRMANRY..AERPKQLRQFVSALKVLETEIFYAATPLPDACQRIA...........ARL.PA.......PVGEF..FHKISDKLRD..G.........RGLTGDGAWQEALDEM....RSS....LVLKDGD...RDVLRQFGRTLGVSDRSDQIKHIHLGVAHLTAEEASAREDQARNEKMWRYL.GALVGLAVVILL-y.........................................
A0A0L0QPG1_VIRPA/3-170               .............................................................-WIGAILFIATTTWIGFEWSNRL..ANRPKHIRQVKNALQILEAEMMYSHLPLQEAFYTIQ...........KQT.PF.......PIHAF..FDRLYKNMN-..Y.........ESKDFQVVWENSLDAF....MDI....SCLGKNE...QEILRQFGQTLGKHDFLQQQKHIQLAASHLERELEAANEQYQRYGKMTKSL.GILCGVFVVLLLL..........................................
R6G6F9_9FIRM/3-172                   .............................................................KVSGALLVFFAGWGMGNWRSRQY..QQRIKDLQILQLIISCLIGEISYARNTLPEAFSRIS...........EKV.AS.......PFREY..LQSVAKRLKE..Q.........TGETFVRILKEQEQTV....REK....TSLREED...WDLFLQTLGHLGYLDAKMQIQLLESGKTELAMREEKLRHQLPEQKRVWQSL.GILGGAFLVVILI..........................................
A0A0F2SK18_9FIRM/3-169               .............................................................-ILGCIVLIAGCGSSGLWLANRI..RRRPSELRELLMALALLDTEIVWGATPLPEAFGIVK...........ERT.DT.......PWQEF..YKELQDRLQ-..-.........RGESAGIAWKETILAQ....KAN....FCLKPED...WQVIRDVGKGLGRSDRTEQHKQLELVLRQLTMIKEQADVWSVKQAKMWSYL.GFLGGIAGVLILI..........................................
A0A0J6FU45_9BACI/2-170               .............................................................KLLGAILIILASTWAGIEWSRTV..SERSRQLRQLKAALQSLEAEIVYGMTPLSMACGHIC...........RQV.GH.......PVSWF..FDSFRKKLDA..-.........GHSTAYEAWIESMDEV....WKY....TAFKQEE...KEIMKQLGATIGQQDREHEQKQLKLALIHLEREEHEARNNQTKYERMFKSL.GVLGGILLVILLI..........................................
R6DUF9_9FIRM/4-160                   ............................................................a--AGAVLVLSAAILALRRYYARQ..RRCRDLLWSFAAALGEMESAIRWQRTPVLPLLEMLQ...........--T.RE.......HCGVW..FCQIRDKVQ-..-.........SDMTLQLAWENTFHQL....---....-----SD...AELRDLLCRISWSGDAQRLESTIARARAEAEQLYEKRREADRHSRR-VTTT.ATLCGAGLMIILLl.........................................
A0A140LC95_9THEO/3-172               .............................................................KLVGSALVIFSCTMIGLIMAGYY..QHRPKALRNFQTALSMLETEIDYGQSPLPEALNNVS...........KRC.DP.......TISMF..LRKVRQLLLS..M.........EGYTASEAWEISLNEF....KSQ....IPLNDSD...FEILTSFGKYLGSSDKEDQIRNLKLTLSQLKQQENLAVEEKNKNEKLWKYL.GVLTGLTLVLLL-y.........................................
A0A094WJF3_BACAO/10-178              .............................................................KLLGAVLILLTTTFVGFEYARRL..SERPRQIRQLMSAMQSLEAEMLYGLTPLSEACSNIA...........KQI.PN.......PISSF..YEAFANKLLA..-.........KEDSAYLAWEQSLDEV....WPN....TALLETE...KEIMKQFGATLGQQDHEQQKKQIQLVLTHLKREELEARDKQAKYEKMIKSL.GFLSGVLVVIVLI..........................................
N9Y2A4_9CLOT/3-172                   .............................................................KYLWLSLIFFFCAYLGIIRGRTY..VNRHKNLSEVNKYMLILQNEILYKNTPLPEALKELS...........FRS.EE.......YFSKI..FSQVSDDLIS..G.........NKYTAYDSFKEIYKEY....KEE....FYFTKED...EKVIGDFLKVLGESGLYGQEKIFELLKTNIETNLKDALEVSKKNSKLYSYL.GVLTGAMIVIFLI..........................................
R7KYP0_9FIRM/3-173                   .............................................................KITGIMLLLFMSAMTGFFAADSL..RRRLCGLKALRNMLESLRLMVRYEALEVTEMVRRLC...........EGE.IS.......SEISF..ISALNELIQS..Ev......etGNMTFSEAWSMAVNEN....--G....GAFTEDD...KALICRVGNVLGSCSCDGQLSALSLACEETDRLIIDAGEQYKAKGRLYRAL.GAIAGAVIAVII-v.........................................
C0ZBZ1_BREBN/3-172                   .............................................................KLMGAVLILFSASMVGWQIGKYY..ANRPVQLRALLVALQMLETEIVFGMTPLQRAFVKVG...........HRV.SE.......EVGKV..FLLAAEFLQT..E.........KAHSAEEALQQAMNRL....WTQ....TALRRQE...REVLESLGQVLGSSDREDQQKHLRLAVTHLRGLEEEARAEQEKYEKMYKSL.GFLGGLLVVILMF..........................................
A0A085L6A9_9FIRM/3-172               .............................................................KIAGCLLIMSAGSFAGISMARNY..ARRPGELRSMVTALQMLETEISYTATPLPEALARIA...........ARC.DK.......AIAPL..FSRASEELYA..Q.........TGCTAGEAWETALNKF....YAL....SSTLPSD...LAVLRNLGTVLGISNGEDQCKHLRLAKEQLKGEIITAEQQAAKYVKLWNYL.GLLGSLALILLL-y.........................................
R7NNJ7_9FIRM/1-133                   ............................................................m-------------------SYKL..QRRRKYLSTILLFLNRLQATITFRKDDIEEIVFNLA...........---.--.......-----..-----D----..D.........ELVPLKNAENNHYEKI....IET....LNFNNKD...KELLSSFFKDLGTTDIDGELSHIKMYQELFSEQYKLSKEDIKNKGKLYRML.GLFSGLAFVVLFI..........................................
R6GNP4_9FIRM/6-157                   .............................................................KLIVFVLCAFVGCMAGLLCARRI..CEKENYYKELSNFCSHFKSCVAFRNDEIANVINGFP...........CRS.TL.......-----..-------LK-..-.........SQLYAKANATNEC---....-DQ....GFLNTEE...YSVVSDFLYNLGRFDEQTQIEDVMRNKEIFEDNYKSLKEKNAVKRPMYIKL.GLLFGALVGVL--tm........................................
Q24UX9_DESHY/3-169                   .............................................................-WVGALLMIMGCGSLGLYSAARI..RKRPVELRECLTALTLLDTEIFWGNTPLPEAFSILR...........DRT.DG.......AWSGF..FAELSERLH-..-.........KGEGAYGAWNETIEQQ....KKN....FCLKTED...WQVIKDVGKGLGRSDRQEQHKQIELVKQQVSLVKEHAAQWSEKQAKMWSYL.GFLGGAAVVLFLI..........................................
A0A0B3VWT7_9FIRM/4-173               .............................................................KIFFIGILIGSSYLIGDIIHKSF..IKRHKELNEVIRILEIIRMDLAFGLYTLEEIFYRAS...........LKK.DY.......CLCNF..CKDMQEDLSK..E.........DGRTLEEMLNKNIIKL....KKE....TNLQNKE...IEELKKMFLTLGQSDIESQQRLIDLTCENLKKLTSDSKEEIFKKGSLYKKL.ITFIGICIGIILI..........................................
U5MT08_CLOSA/3-172                   .............................................................KLIFMIMIFTTSSYIGFMYGETF..RKRMNELKEILKALLILENDIIYGTTPLPEALENLC...........FKV.EE.......PIKKI..TKAIEERLIK..G.........NVESVYEGAREEFKVL....ENE....FYLDDSD...KKIISDFFKSLGESGVYGQEKIFTLAIEGIKLNLKDAEEIAKKNIKLYRYL.GVCFGAMITIFLI..........................................
R1ASY0_9CLOT/5-174                   .............................................................KIVASLMIISSCTLIGYFLGMTY..SKRVENLILLQNCIRILETEIVYSATPLPEAFNNVY...........LKG.NK.......KVSYV..FNDIKKYLIQ..N.........KDATVFDVFVSVSKTL....SDE....LHLKKED...IEIILSLGRVIGNSDRLDQQKHFKMIHTQLENQCKEAEESKKKNEKLYKNL.GVMSGLAITIILF..........................................
R5HZJ8_9FIRM/3-172                   .............................................................KVLGSMLILLASVGFGFQIQMDL..RNHLRLLYDIRKLLLDIANETAYTMDPMEVVLEHAI...........HSR.NP.......YLNEI..CKEMGEGLQK..K.........ERGCGQELWQERIEAW....QKR....LGLSLEE...KEIFAGAGCAFFGKSMGENEKSLEHYLERLDYVIDQVRGEQKEKQKVYQTV.SVMCGLIIILLFL..........................................
U5RXC4_9CLOT/3-172                   .............................................................KFLGCIITICASTGIGFIWGENL..KGRVKQLRELQRCINQLQNEIIYTHTPLPEAILNTA...........SKS.VN.......PIKDV..LEEISHMLKE..N.........SVDSVYEAFNVIFEKK....KDV....LNLKNED...IDALIDLSKTLGESDIEGQKRMFSLALENIKKQIEISEISMNKNLKMYRCL.GFSLGAVVVIILV..........................................
A0A0U2L054_9BACL/3-172               .............................................................KLLGAMLILLAGTLLGFYQASQL..SRRPKQISELIRLLQRLETEIVYGFTPLPEALRQTG...........RAG.TH.......PVGSL..FLDTAAELVK..P.........DGRSVQTIWEQTLTAG....WRN....TSMKPNE...KEVLLQLGSTLGLTDREDQVKHLKLAVNQLQGEADCAREEQQRYERMWKSL.GLLMGLLVVILM-y.........................................
A0A117KX88_9FIRM/1-161               ............................................................m----------TCSFIGLMISYKY..ALRPMQIKCFRFALQMLETEIYYSLTPLPEALFRVG...........KRF.EN.......EIGQF..FLQVSQLITG..K.........DILTADEAWKQSLNWL....KEN....SFLSESD...IDILEKFGYNLGCSDREEQIKHLKLVQQQLLHQEDNAEKEREKNERTWRLM.GFWGGLLIVIIL-c.........................................
R5Y7U2_9FIRM/2-153                   .............................................................KYAGLLFVNAACAFAGVFAALRI..REKSRVARLLIEMANMMESMLSFGSEDSVKIIRTLS...........NEK.AF.......-----..----------..-.........AELTFLK--NMDIENI....AVS....TCLNESD...NERTALLFKMLGSTDVPSMMNSIEGYKASMELSACKYDEYCKSHAKLFVAF.GLLGGLLLTVLIL..........................................
A0A0C2UP39_9BACL/3-175               .............................................................KFAGILLILFAGTMIGFLQAAKF..AARPRQIRQVLHALQRLETEISYGQTPLAEALSRIS...........ELV.PV.......PMSRI..FADISRSLRP..Ea......sgAGETVSECWQRAVNAG....WPS....TAMKEAE...REAFLRLGATLGGSGREEQLKHIRLAMLQLQAEETTAREDQQRYEKLSRSL.GVLGAALVVILLI..........................................
S0FJJ5_9FIRM/4-172                   .............................................................KMIGAVVLTGATSLIGFLLAADC..SKRPRTLRELQALLQMLENEISYLSNLLAEAFFRIY...........ETS.KV.......DAAIL..FKAAALNLQT..-.........GGVTADMAWDKAVNEY....YSK....LSLNRED...RAILITFGKMLGNSDLEGQLNNIRLVSSQLKLQEAKSEEMKRKNEKMYRTL.GVLSGLALAIILF..........................................
R6XJJ5_9FIRM/3-172                   .............................................................KVLGSICVLGTSALLGIQKGAEI..QRVYEELLYLQRILYQMQSEIRYLRAPLGDIAGRIG...........RES.RD.......PYKKW..LLSLEREMKQ..R.........DGKSFSTLWEQGVRKH....LGD....IHFPERE...ISRLCALGSQIGNADMEFQMRTLSLYQEQLAQTLEELRRTMDGKVKLCRSI.GVIGGIFLVILLL..........................................
C5D483_GEOSW/2-170                   .............................................................KLVGALLILLTTTWAGFEAARML..HERPRQLRQLKAALQALEAEIMYAHTPLSEAALHIS...........RQI.SS.......PLSKL..FAQFAAKLQV..-.........GETSVHQAWEESLQAV....WKE....TALKQGE...LEIMKQFGETLGQYDRLTQQKQIALALAHLEREEADARERQARYEKMAKSL.GVLAGLLLVILLI..........................................
I4D8X5_DESAJ/3-169                   .............................................................-LFGCIALIAGCGSMGLWLAQRI..RRRPEELREFLVALTLLDTEIVWGSTPLPEAFSVLK...........ERT.GA.......PWQSF..FSELQKRLE-..-.........RGEPASTAWNEEIVLQ....SSR....FCLKQED...WRVIRDIGKGLGRSDSHEQHKQLQLVSRQLSMLKDQVGIWAEKQAKMWSYL.GFLCGVAGVLILI..........................................
A0A0K2SMU5_9FIRM/4-171               .............................................................--FGAGLAVLASTLAGQTLSWAL..SRRVRLLEAMEHGLALLEGEISYGQTPLPEACRRVA...........AQV.GA.......PWDRF..WVRVAAELGP..P.........ACRLPREAWLLGVDDL....DRR....AGLTPED...RVAIARLGDRLGVSDSRDQVRLLELTRRRLADHRRAAERRWEREARLWPFA.GFSAGALVVLIL-y.........................................
A0A0Q3THZ2_9BACI/3-171               .............................................................KIIGAIFIIFSTTWAGFEISKHL..TERPKQLRWFKSALQSLEAEIMYGHTPLHEAARKLS...........TQF.PK.......PLSIF..FSSFSAKLLT..-.........VETTVKNAWESSLQEI....WKM....TSLKQNE...YEILTQFGENLGKHDRLTEQKNINLTITHLEREEADAHERQQRYEKMVKSM.GFLSGLLIVILLM..........................................
G4KPT5_OSCVS/2-164                   .............................................................KALGSLLILAGFSAAWAGELRRW..RRETETLFQLTAALEALSGGIRLTRTPLPRLFRELG...........RAR.QG.......VVAAW..LTELAEALE-..-.........RGELLRPAWNTACRH-....---....LPVEDDV...REVIAELGYKLS-GDEMEICKGIDLVTSWLRKKSEERLRKKRDWTRQATAV.CFSGAALLIILLL..........................................
R5WWV3_9FIRM/3-172                   .............................................................KFAGILMIFIAGTGMGTAKSMEL..TKRERNLKKFLWLTSCLKGTVRCGNSCFPEAFLEIS...........EKF.DG.......MYQEF..LQSLADRLKG..Q.........KGQTLGQIFRDCAKKE....FRT....AGFSAEE...MELIASLGDRLGYLDREMQLRQLDIFEEELCRRLDFLACQLPEKKKLCRNL.GILGGIFLGVLLW..........................................
W6S2T8_9CLOT/4-171                   .............................................................KIIGSLIILGSTTIAGFILGDIV..KARFEQLMELQKAINIIKNEMIYSFDVLENILLTTS...........KHV.KG.......SISLI..FKRASEIIYA..K.........EVDNVKEAFDKALEEI....--S....HNLNKED...IEVIRAMATSIGNFDVDGESELLNLTLINIERQLKESEELKNKNLKMYRSL.GICIGLIIVIFI-f.........................................
A0A0K9GAL6_9BACI/3-171               .............................................................KLLGAVLIVFSTSWIGWDFSKRL..IARPKQIRDLRAALQILEAEIMYGHMPLREAVLKLA...........KQI.PE.......PVARG..FTLFADYLNE..-.........ENQTVTNAWRQSIEEM....MKW....TELEDKE...AEILLQFGETLGKHDRDTQRKQIQLALTHLEREEMLALDKQMKYDKMVKSL.GFFSGLLIAILLL..........................................
R5Z1B3_9CLOT/5-169                   .............................................................KIVMLFAVFGTISTIGVKISNRY..TERANNLKQIKKALNIFETKIMYTYEPIPDVFLEIS...........KKI.KG.......DVGKL..FWDASRNM--..-.........SLDFAGDAWEKSLNNS....--N....IMLLEDD...KEALRSLGKLLGSTDIDGQLSQIRLVNGFLNEQIKEAIEQKDKNETMYKKL.GIIVGLAVVIVLV..........................................
A0A150KLN0_9BACI/4-171               ............................................................v--IGAIFIILSTTWAGFELSRHL..SERPKQLRMLRTALQSLEAEIMYGHTPLHEASRKLA...........AQL.PK.......PISII..FERFSQKLTT..-.........METTVKIAWEESLQEI....WKI....TALKKSE...YEILIQFGETLGKHDRATEQKQIILTLTHLEREESEARDKQQKYEKMMKSL.GFLSGLLIVILLL..........................................
Q5WF48_BACSK/2-170                   .............................................................KWFGAALILLCSTLYGLEQAKKL..RDRPQQIRQLRVALQALEAEMLYGQTPLAQASENIA...........KQL.EG.......AIGDM..FACFAANLRA..-.........RKQTAMDAWREALEAV....WEE....TALKSGE...REVLHQFGATLGTMDRSQQQKQLKLAQTHLEREELEAKETQLRYEKMAKTL.GVLAGLLLVILFV..........................................
U2SH45_9FIRM/3-165                   .............................................................KLVGAVCILGAGTWAWRRSAAER..RRELDTLADLTALLDRMGEEIRLRRTSLPRLLGSLG...........RDR.TG.......PVRDF..CTSVAASLA-..-.........RGAPLGQSWRSAAEA-....---....LPLGPES...RTALTALGDSLQ-GDEESVCKALTLAGKILEKNLAAARDHRQETEKRSAAL.WLSSAALLVILLI..........................................
Q0AZG9_SYNWW/5-174                   .............................................................KLMGAASIITGFGCWGLKAARRM..DRRVEQLQELRLALGFLEKEISCIYSPLSQALAKTA...........DFS.RP.......PVSYL..FAASSSLLQE..K.........TGMTAAEAWNAGIEGL....RLH....SDLQEME...IGLMATASLQLGISDASQQKKLLTLLQEELALLEQKAMQQAEGGRKMWTYS.GFILGAMVVLLLI..........................................
A0A177L048_9BACL/2-170               .............................................................KWAGAFFIILASFLIGQRKSKAY..TNRVLHIRQFESALLTMQSAILFGADSIEATTRFIA...........ETI.EK.......PAALF..FRDFAEQLSS..-.........TETSATRIWTHTLQRH....NDF....FALNPSD...IRLIEQAGNMLGSCTQEAEERRIKHVLKQLEKRREEAVAEEQRFAGMVRAI.SVLSGLLTAILLM..........................................
S2KVU5_9FIRM/3-172                   .............................................................KLSGALLLVLGCAGFGWCTCRDM..ERHIGQLHLLSRAFSMLESEVGYSRATLPEGLIRVG...........NRL.GG.......RLGEC..FINVGKKAQG..P.........EGITFAAAWDEEVAGF....LKE....TCLDKKE...EELLLSFPGFTGFVDGQMQLISLEQFGKEIRRAEEKARKETESRKKAVLSV.SMAGGLLIAILLI..........................................
W9AG63_9BACI/2-170                   ............................................................q-WIGALLFVITSTWVGFEWSSRL..SNRPKQIRQLKNALQILEAEILYSQLPLNEAFLVIA...........KQT.PQ.......PISKF..FDTLYYELEQ..-.........DKRDLFSVWEQSVNGL....MKY....SSLGSNE...QEIIKQFGRTLGQHDFHQQQKHIQLTLSHLERELEEARDHHLKYGKMAKSL.GVLCGLFVVLLLL..........................................
A0A147K7R9_9BACI/3-171               .............................................................KLIGAAFIIIATTWAGLQASSYL..SERPKQLRSLKSALQSLEAEILYSHTPLHEAARKLS...........RQL.TK.......PLSWF..FEAFSSKLTT..-.........KETTVQEAWEESLEEV....WKF....TALKKSE...LEILKQFGESLGRYDIATQQKQIVLALTHLERVEKEAHETQQKYEKMAKSL.GVLTGLLVVILLL..........................................
R7N9T8_9FIRM/3-173                   .............................................................KLSGAALIITACTYYGFYLSSNL..YMRTRIIQSLITALHYIKAQIGYASSTLPDIFRDLS...........VNS.DN......cYVQEM..FSYAAKTLSD..E.........GIVTYEAVWEEAVNVL....NRR....KILKKDE...LNVMYELSHFNSYIDKNMQVQNLELSIERLKRINENVAMDIAPRMKICRIG.GITAGVFIAIMLI..........................................
R6P608_9FIRM/3-172                   ............................................................r-LIGAVLILFGTVGIGYDRMRQI..KRHYEGLLDWRECMLKIQGDMQSLKKPLPDIIAELG...........HHA.PE.......VFQSF..FMQVHKELMQ..Y.........ENCSPKSCWKEAWKSW....ENR....EIFTKEE...GQLFLECGRLLEQGSGGMFEKEAELLIERINILIQREQTEMRERIKVSMYL.CATAGIFLVLILV..........................................
R9N4J9_9FIRM/3-171                   ............................................................r-IMGCLLVIIGSIGFAQSICREG..KNRLEMLKQMRGIFETMKYYIAYQKAAIPEALWKLS...........DKS.DD.......LISAA..FREIYNRVYE..-.........KGESLPTVWQVQMEAV....LMK....SALSKEE...KKMILDFPACLGFMEENAQAGAVDELLREINLHIKELTEEQKNKNKMIMSL.GAAVGVLLSILLI..........................................
R9M0Z1_9FIRM/7-172                   ...........................................................ka--GGMVLILFCTTSIGMALAREL..SRRVEQLETAVTMLDAFEGELSYSLSPPDEIAGRLE...........QRD.SL.......SDAAY..LPLCSSL-C-..R.........QGVPFPEAWKQAVTHQ....--P....GSLSGED...AGILAELSDTLGQFDLETQLSQIRNIRSRLQLQLDGARVRCQGYARLYRTM.GLLSGAFLVIILI..........................................
A0A139CXH0_9FIRM/3-172               .............................................................KILGSVMIVIASSWLGFLSAKQL..ILRVKQLQELQLAFQLLEAEIMYAATPLPQALKRVG...........EKI.NL.......PIAQL..FINCTEILQE..N.........IGVTADQAWQQAVKEV....RTQ....TALKLDD...QEVLINFGKHLGKSDREHQKKNLQLAQKQLKLAIKDSLAIKDAKVKQRRYL.GVLGGLVVVILL-y.........................................
C9R8Z9_AMMDK/3-172                   ............................................................r-WLGAGLVVLAGGMAGQELSRDY..LCRPRELRGLLGGPNLLQTEISY-ATPLPEALARVG...........KRL.KG.......PVGEL..FCLVADRLAA.gA.........GGNGAGVVWEEALDSF....RSR....MALKEED...LEVLRLLAGVLGTSLKEEQERHLTLARERLKLALTLAEEEARRYARLYRFL.GWGAGVGLAVLLL..........................................
R5NHY8_9FIRM/3-172                   ............................................................r-IVGCILLVAAGTGMGFSGSMKL..SERIYTLEMLLRMGIFLKGEIRCGNMSLPDAFYGVA...........GRM.DG.......KYREF..LISAADRMKS..G.........TGETLSQICRECAETS....LKK....SCLTSGE...KDAFFSLGEHLGYLDLEMQMKQLSLYEENLEEEISRLKEEASVKKRLYRSL.GILGGLLLAVLLI..........................................
R7N2Y4_9FIRM/4-171                   .............................................................-IMGSLLVILGAFGFSVSLCLEY..RMRLMLLKQIRGVYEYMEFQISYGKLPIPEILRKLS...........FKD.EL.......CFRQE..FGRIAQRMEE..-.........GGQELAVIWKEELGPS....LRK....SGLKKKE...QEWLLAFPLKQGFLIGQAQAESLGEIRRELEDGIQSLQQEQKSRSKVIMSV.GVAGGVLLSILFL..........................................
A0A117LJE9_9FIRM/1-154               ............................................................m-----------------LVARGY..SLRPVELRSLKSALQMLETEITYAATPLAEALGLVA...........ART.DC.......RLAPL..FEETRKELLS..M.........SGCTAKEAWEKALFKF....YPR....SSLIGCD...ISILRSLGGALGISDSSGQSKHLRLAMEQIGAELEKAEVSALQHVKLWNYL.GFLGGLVIVLIF-y.........................................
A0A0X8VB18_CLOPR/5-173               ............................................................g--IGAILILAATTLCGFAFAAKE..KYRLKDLEEIERGILLMKNQISYLGTPLTELLEQIS...........WKT.EG.......ITGLA..FQEISRQMEE..R.........RGNSAEEIWEGAWLKI....GKK....SYLTAVD...LEELVSFGRTLGFIEKEQREGSMDMLLHYLREKQEGIKKRLEKNGRLYYSM.GVLSGLLLVITLL..........................................
A0A0F2PSX6_9FIRM/3-172               .............................................................KLAGALLIIVAGGAAGIIRAREY..MRRPGELKSILASLQMLETEITYAATPLAEALERVA...........AAG.GR.......EMGGL..FAGAAAELRA..M.........SGCTAAEAWQKSLQSF....YPA....SALRESD...LSILYNLGSALGISDRQDQSKHLRLASEQLKLEAARAGDEATRNVKMWNCM.GFCGAAALVFLI-y.........................................
A0A075R476_BRELA/3-172               .............................................................KIGAAIVVLVSASLIGIQLGKRY..SDRVKELRALLHSLQMLETEIVYGATPLSLAFEKIS...........VRV.TH.......SIGNL..YKRASELLQT..N.........AGESTQMVWQTALEQT....WSL....TALRKEE...KEILKNLGYVMGNSDREDQKKHLQLTVFHLRGLEEEAKEEQLKYEKMYKNL.GFLGGLLIVILMM..........................................
A5D344_PELTS/3-172                   .............................................................KLAGAALIVAASGLSGMAVAGSY..SRRPGELRALRAALQMLETEIAYGASQLPEAFSRVA...........GCC.EE.......AAAPL..FRRAAAELSA..M.........SGITAAEAWEKSLAGY....YPG....TALKPRD...LSILRNLGSSLGISDRNDQIKHLNLAKEQIELEAVAAEAEASRNVKLWSYL.GFLAGLAAVLVL-y.........................................
I7LKN7_9CLOT/3-172                   .............................................................KLIGGLIIIIASTITGFYISHLL..YEKVRQLRELQYALQILESEIIYSAEPLYVALSNLS...........LKV.NE.......PLKAL..FIDLANSIKD..F.........EKDTLHDIFINSFDRH....KDR....FLLEKEE...IEVLVSFFSSLGTSDLEGQKKNFNLTMKKLDMLEKKADDKRQRNDKLVKYL.GFASGILIVVILV..........................................
Q9K954_BACHD/2-170                   .............................................................KLLGAIFILMATTWAGFELARRL..HERPRQLRQLKVALQSLEAEMVYGLTPLAEATGHIA...........AQM.PK.......PVSYL..FEHFSYRLKE..-.........KEETVYDAWEAAINET....WKY....TALLASE...REVILQFGATLGQHDREQQQKQVRLTLAHLEREEGEARDKQYRYERMMKSL.GVLAGLLIILMML..........................................
V6MD78_9BACL/3-172                   .............................................................KLIGALMVLVSASMVGWQISRTY..AKRPVQLRALLVALQMLETEIVYGLTPLQRAFVKVG...........QRV.NK.......EVGNL..FLLAAELLEQ..E.........RALSAEESLQKAMKRH....WPQ....TALRKQE...QEVLASLSQVLGSSDREDQQKHLRLAVTHLRGLEEEARAEQDKYEKMYKSL.GFLGGLLVVILMF..........................................
G8LWK3_CLOCD/4-171                   .............................................................KIVGSLIVFVSCTLLGYSHAQTY..AQRPQELKTLQMLLQIFENEISFLSNVLQEAFQKVS...........SCT.DS.......SVAVF..FEAAVENLK-..-.........EGLCADEAWTKAVKEN....ISG....TSLNSED...EAIIISFGKMLGSSDLEGQIKNIRLTVNQLKIQEQKAEELRSKNEKMFKSL.GVLCGLAIIILLF..........................................
D4LPN5_9FIRM/3-172                   ............................................................r-IVGCILVVAAGAGMGFSGSMRL..SEQIRILEKLLQMVICLKGEIRCGNASLPDAFYGAA...........GRM.NG.......KYREF..LISAADRMKA.gT.........GEKTFTDMQGMCGKRP....EKK....LPYPWG-...KGRFFSFGEYLGYMDLEMQMRQLSLYENNLEAEILKRKAEVSGKKKLYQGI.GILGGLLLAVLLV..........................................
A0A075KBE0_9FIRM/4-173               .............................................................KIIGSILVLITSSYIGFKMAASC..QERPRHLRQIISCIASMRSYILYARVPLHEAVAQCT...........NGI.YG.......PVATF..FQKIAAMLEK..Q.........TILTPQEVISKVLHEM....QGS....LMLKTPE...IEVLHVLGGNLGHMNCTEQEKYLLLVIEQLERFENEATRLRDLNTKMYRYL.GVCGGMAIVIILV..........................................
A0A162MGV2_9FIRM/4-173               .............................................................KIIGGLLILFSSSSIGFIVAKYY..GERPKLLRQLQNALSMLETEINYSNSPLPEALRNVA...........LRC.DK.......DVSFL..FSKTKEYINS..T.........EGLTAAEAWEKALKAF....SRT....KSLNETD...MEILDAFGKYLGTSDREDQINKLRLTLSQLRSQEHKAIEEKEKNERVWKYL.GVMTGLLIVLLLI..........................................
N2ASA6_9CLOT/3-172                   ............................................................r-FIGGILIIIATTGAGILYGMEL..QGYLEKLLYIRHILYMLKGEMDYSSAPLSEIFGRLS...........LRV.KE.......PYKCW..LSAMEKQVEN..R.........EEDAFLKIWMRSVDKH....LKE....LHLKSAH...SIQLKELGTCLGQMDGASESRNLQLYLGRLELEIEKVREGMAAKKRIGNCL.GVMGGIFLVVVLI..........................................
W4QWP9_BACA3/2-170                   .............................................................KLIGAVIIILVTTWIGFELAKRL..SERPRQLRQLKVAIQSLEAEIMYGLTPLAEASDHIA...........KQM.PK.......PISYF..FEHFADRLI-..H.........KQETAFEAWEESLKET....WHL....TSMLESE...REVMMQFGSTLGQHDREQQQKQIKLTLSHLEREESEAKDRQHRYERMIKSL.GFLTGLLIVILML..........................................
R6SV52_9CLOT/5-158                   .............................................................KIIGTLFVCGAGIGFTVFAIRFE..RCKLQILDAYIALIFYIKGQIDSCAMPIGEILRGAG...........RAL.AE.......----F..-PALA-----..-.........----VISPDEDPIDKS....-SV....YYLDRES...LRLLRSFFSELGSLYREEQLRRCDYYIEALTSQRQKLHEMLPARLRLVCTL.VLCTAAGITILLW..........................................
A0A0M3R9K2_9BACI/3-171               .............................................................KLIGAVFIVLSTTWMGYEYSKTY..SERTKQIRQLMYALQSLEAEIMYGFSPLNIASARIA...........TQT.PD.......PVSTL..FAGFSDRLMK..-.........GEDTASKAWEESLACI....KHK....TSLKQSE...IEVLKQFGETLGLHDRESQQKHIRLTLTHLEAEEKEAGIVQGKYEKMVRSL.GFLTGLLLILILM..........................................
R6VE33_9FIRM/3-172                   ............................................................r-VAGACLILSASSLLGVQKSRQF..TKRIEQLQELQRIVLLIQGEILYKNAALPEALRSSA...........GKV.KV.......PFDSF..LRQTAGRADA..F.........DGVRFSDLFETEIKEQ....LKG....TALTKED...KEEFARFGESLGYLDVEMQKNAMKLYLKELEQKIEYLQKEIPPKRKLYQSL.GVMGGIFLLILLW..........................................
R6CWK5_9CLOT/3-162                   ............................................................l--WGRVLLFLCLSSIGITMGTRV..HKRRELLLLSSQLLGTLSAELTFCQKSADALILELA...........AKS.PF.......DSLGY..LRKFCSL---..-.........PKAPFPKRWKQAVEQ-....---....SVQGGED...REMLLLVGQVLGAYDLNTQLKELCQLREKMTAKAQELLEEDIRERRLYTAL.GPLMGLAVCILI-..........................................
R5K248_9CLOT/5-174                   .............................................................KILGMLLVVAASYGIGKTIGVYQ..NRRVEDIYELLIFVRMANGHLAYSASEITEIIREGS...........DKA.GG.......RIGDW..LAGLALQFRT.eE.........YASSFEQIWTGSIGSL....MEH....SYLTDAQ...IGAVKELGKWLCYMDVDMQIRNLKLWEQNMQAEYEEQKDRARRINKVSRSL.GLLGGIFLIILI-..........................................
K6UC52_9CLOT/3-172                   .............................................................KLILAMCVFLISTYIGFSYGETF..RKRQAQLKEILKALTILENEIVYGATPLPEALENLS...........HKV.DK.......PLSDF..IKAISDRLIK..G.........DVESVYEGALEEYSRF....KNE....FFIYDDD...KKVLGDFFKSLGESGVYGQEKIFFLAVEGIKMNLSDAEDNAKRNIKLYRYL.GICLGAMIVIFII..........................................
C4Z0I3_EUBE2/4-172                   ............................................................y--IGGILILSGCFMYGLSYSQRL..KNRIIILKDMVRMLSVMNNHIGYSLIDMTQIFERLG..........dFDM.CS.......YVRNF..TGYIYEALNK..S.........DIDTFALIWNEAADKA....-FA....GILGKRQ...LEIIKEAGSISTFIDKDSQLKHIQSVVCELNEELDVVKTNAAGKMKAYIVT.GISAGLILVIVLI..........................................
A0A0F2NK71_9FIRM/3-172               .............................................................KIIGSLMLVTAGGVAGMMVAREY..AKRPGELKALLSAIQMLETEIMYTATPMAEAMERVA...........AGA.DR.......RVAGF..FRDAALDLKS..M.........AGRTAGEAWQAAMDRF....YPR....CSLSGGD...MSILGNLGGALGRSDREDQAKHLRLACEQIKMEIIKSEEDASKNTKMWNYL.GFCGALAAVIIL-y.........................................
R9JFM0_9FIRM/4-173                   .............................................................KFIAGACVMTGALGFGWSLCGEM..NHDIALLKQQKQILLYMIGEITYLHRPMEEIFDLIA...........LKA.DP.......PYNLF..LAEIAQKMKE..R.........DGRSLIQLWNEAVHDR....QDK....TELSQTG...KSYLLKMGNCFEYEGEQLQAEALGLFGTELDSEIDRLTAKKNENSRLIKAL.STLTGILCIILFL..........................................
A0A089ILM4_9BACL/3-172               .............................................................KLFGAVLIVLAGTLAGLQFAKQY..ADRPRHIRGLIAALQRLETEIMYGFTPLPEAMRRIG...........IQS.KE.......PLKTL..FIKTAEEMSP..P.........HDRSAQDAIQRAMDSH....WKS....TALKGTE...KEILRQLSCTLGTSDRSNQSTHIALALQQLKQEESVAREDQGKYEKLSKSL.GLLLGALIVILI-f.........................................
I9AZW5_9FIRM/3-172                   .............................................................KLIGSLLVLLVSSYIGFKMASRC..QERPRQLRQIITCVGSLRSHIIYSCLPLHEAIANST...........NGI.YG.......PVAEF..FQQVANLLEK..N.........ASLTPQEIIKKVLREM....EGS....LILKRPE...IEVLYVLGGNLGVMNCKEQEKYLSLVIEQLERFENEATRLRDLNTKMYRYL.GICGGLAIIIILV..........................................
R6B816_9CLOT/5-171                   .............................................................KYILIFFVFLAFTYIGNTYSKKY..VNRVQELEKMQNLLNIFKSKIKFTGLTIQEIFNQIY...........DDN.KD.......VVGDI..FKRASLNM--..-.........ENMSAKDGWKKAIEES....QDK....LSLNKED...FTAIETLGKMLGNTDVEGQVSQIELTEKLIEDQIENAKIEKQKNTKLYKTL.GVTVGLTAVILLL..........................................
F2JME2_CELLD/3-173                   .............................................................KLLAIGLVLIGCILGGIWLDEDQ..KKRIEELGKFIYLFELLKAEIDYRLTPLKEACLIVG...........KRT.NN......kSIDAV..MMGFAKSLED..K.........ESVRVEEMWENAINAQ....KQA....FHLQAED...YKLLYSFGGACGYLDKNMEKRNIEMVLEQLRQSTKEAKEKYQKTSKLNRSL.GVLVGLGLSIFLL..........................................
W4QIX9_9BACI/1-155                   .............................................................--------------MGFEYAKRL..SDRPKQLRQLKVAVQSLEAEMMYGLTPLAQAAEHIA...........KQL.PK.......PVSTV..FDLFSEKLLE..-.........QEHSAFDAWQASIEVV....WPR....TALLDSE...REVMLQFGATLGQHDRDQQQKQIHLTLAHLAREEQEARERQHRYEKMVKSL.GFLAGLLVVILLV..........................................
R5DS37_9FIRM/4-164                   .............................................................KLIGCLLVVCTGTMIGFVLSGRL..YKRRDFLKSFTEFISLLATNLRYSGDDIFTLVNSCA...........ENS.SL.......DLLLF..----SE----..-.........CDRPFDELWLERVKRL....SSE....IPLSKSD...ISMLNDFGGQLGKTDTEGQLKHLELYEVSFSKQLSSALDAITKKSKLYKTM.GFFAGSAIALMMI..........................................
A0A0J1DN12_9FIRM/2-170               ............................................................q-FIGAALIMLACGMMGLTVARSY..VSQAENIKQLITMLQLLETEIGYARTALPEACRRIS...........AQL.PG.......AVDSF..LTAVLEHIHA..H.........PGEAFGDGWHAGLGRL....-GA....WGLPAVV...LNDLTVLGEALGVSDVEDQRRHLQVTRLRLEDAYRQAEQEWRTNWKLWSYL.GFAAGLLILLLI-f.........................................
#=GC seq_cons                        .............................................................KhlGullllhusshhGhhhupph..pcRscpLcplppsLphLcsEIhYutsPLsEAhpplu...........pph.st.......slsth..Fpphucplpt............pstshtpsWppulpph....hpp....ssLppp-...hclltphGpsLGppDtpsQh+plpLshppLcpp.ppAccppp+ppKhh+sL.GhlsGlhllIlLh..........................................
//
DBGET integrated database retrieval system