GenomeNet

Database: Pfam
Entry: Spore_III_AB
LinkDB: Spore_III_AB
Original site: Spore_III_AB 
#=GF ID   Spore_III_AB
#=GF AC   PF09548.8
#=GF DE   Stage III sporulation protein AB (spore_III_AB)
#=GF PI   spore_III_AB; 
#=GF AU   TIGRFAMs, Coggill P
#=GF SE   TIGRFAMs
#=GF GA   29.00 29.00;
#=GF TC   30.10 29.70;
#=GF NC   28.60 26.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF DR   INTERPRO; IPR014198;
#=GF CC   SpoIIIAB represents the stage III sporulation protein AB, which
#=GF CC   is encoded in a spore formation operon: spoIIIAABCDEFGH that is
#=GF CC   under sigma G regulation [1]. A comparative genome analysis of
#=GF CC   all sequenced genomes of Firmicutes shows that the proteins are
#=GF CC   strictly conserved among the sub-set of endospore-forming
#=GF CC   species.
#=GF SQ   367
#=GS R6MSD6_9CLOT/1-156       AC R6MSD6.1
#=GS A0A0M2U9Y5_9FIRM/3-172   AC A0A0M2U9Y5.1
#=GS A0A060M3B6_9BACI/2-170   AC A0A060M3B6.1
#=GS Q3AAK9_CARHZ/4-167       AC Q3AAK9.1
#=GS R6GYS5_9FIRM/2-84        AC R6GYS5.1
#=GS E2ZIP5_9FIRM/6-154       AC E2ZIP5.1
#=GS A0A0D3V885_9BACL/3-172   AC A0A0D3V885.1
#=GS K0J3W9_AMPXN/2-169       AC K0J3W9.1
#=GS R5GVQ0_9FIRM/2-162       AC R5GVQ0.1
#=GS E0ICJ9_9BACL/4-173       AC E0ICJ9.1
#=GS A0A0A1MFD3_9BACI/2-170   AC A0A0A1MFD3.1
#=GS L0K8Q9_HALHC/2-169       AC L0K8Q9.1
#=GS R5F3J4_9CLOT/5-177       AC R5F3J4.1
#=GS K4ZMZ1_PAEAL/14-185      AC K4ZMZ1.1
#=GS R5YCP8_9FIRM/3-171       AC R5YCP8.1
#=GS R5AIK6_9FIRM/3-172       AC R5AIK6.1
#=GS R6BL76_9FIRM/3-172       AC R6BL76.1
#=GS R7CGF4_9FIRM/3-172       AC R7CGF4.1
#=GS R5L5F8_9FIRM/4-170       AC R5L5F8.1
#=GS R5TET5_9CLOT/3-174       AC R5TET5.1
#=GS B1CBV6_9FIRM/4-171       AC B1CBV6.1
#=GS A7GSL0_BACCN/3-171       AC A7GSL0.1
#=GS L7VLP1_CLOSH/1-123       AC L7VLP1.1
#=GS E5WIG1_9BACI/3-171       AC E5WIG1.1
#=GS R6C8V0_9CLOT/3-172       AC R6C8V0.1
#=GS D5WV73_KYRT2/5-174       AC D5WV73.1
#=GS R6XSG3_9CLOT/5-169       AC R6XSG3.1
#=GS M1LTX3_9CLOT/3-172       AC M1LTX3.1
#=GS C2WBX9_BACCE/1-159       AC C2WBX9.1
#=GS R5QAL0_9CLOT/5-169       AC R5QAL0.1
#=GS A0A0H4KML3_9BACI/2-170   AC A0A0H4KML3.1
#=GS Q18B53_PEPD6/4-173       AC Q18B53.1
#=GS F7NJX1_9FIRM/4-173       AC F7NJX1.1
#=GS C4IL69_CLOBU/3-172       AC C4IL69.1
#=GS C0CY21_9FIRM/1-137       AC C0CY21.1
#=GS B2A544_NATTJ/3-171       AC B2A544.1
#=GS R5HAM8_9FIRM/3-183       AC R5HAM8.1
#=GS R7MAA7_9CLOT/5-169       AC R7MAA7.1
#=GS A0A0H3J7T1_CLOPA/3-171   AC A0A0H3J7T1.1
#=GS C0C3R2_9FIRM/3-130       AC C0C3R2.1
#=GS R7ANQ8_9CLOT/4-98        AC R7ANQ8.1
#=GS K0AX56_CLOA9/5-174       AC K0AX56.1
#=GS A0A0D5NQ32_9BACL/3-172   AC A0A0D5NQ32.1
#=GS F5LLP7_9BACL/4-173       AC F5LLP7.1
#=GS E6UIW0_RUMA7/4-157       AC E6UIW0.1
#=GS R6QGT5_9FIRM/35-140      AC R6QGT5.1
#=GS R6S2Z2_9FIRM/3-172       AC R6S2Z2.1
#=GS A0A024P6N4_9BACI/2-169   AC A0A024P6N4.1
#=GS K8EK41_9FIRM/3-172       AC K8EK41.1
#=GS R5E6Z4_9CLOT/6-130       AC R5E6Z4.1
#=GS R5JZC4_9CLOT/8-177       AC R5JZC4.1
#=GS A0A0H4P1T1_9BACI/2-170   AC A0A0H4P1T1.1
#=GS R6PVL4_9CLOT/3-172       AC R6PVL4.1
#=GS W1SJW1_9BACI/3-171       AC W1SJW1.1
#=GS B2TRQ2_CLOBB/3-172       AC B2TRQ2.1
#=GS C7H7R4_9FIRM/5-151       AC C7H7R4.1
#=GS E6U545_ETHHY/1-162       AC E6U545.1
#=GS R6RQG1_9FIRM/6-175       AC R6RQG1.1
#=GS R5B586_9CLOT/4-166       AC R5B586.1
#=GS R6EGF6_9FIRM/2-166       AC R6EGF6.1
#=GS N0AW00_9BACI/3-171       AC N0AW00.1
#=GS G9YNK0_9FIRM/3-170       AC G9YNK0.1
#=GS V9WA33_9BACL/3-171       AC V9WA33.1
#=GS R6R0I7_9FIRM/5-152       AC R6R0I7.1
#=GS F6DUB5_DESRL/3-172       AC F6DUB5.1
#=GS R5V793_9FIRM/3-166       AC R5V793.1
#=GS R7A9L2_9CLOT/1-70        AC R7A9L2.1
#=GS R5R841_9FIRM/2-169       AC R5R841.1
#=GS A0A0N0E9T5_9BACI/3-171   AC A0A0N0E9T5.1
#=GS R7IEQ3_9FIRM/3-163       AC R7IEQ3.1
#=GS A0A0A2U025_9BACL/3-172   AC A0A0A2U025.1
#=GS R5YYR7_9FIRM/4-174       AC R5YYR7.1
#=GS Q67N97_SYMTH/4-173       AC Q67N97.1
#=GS R7JTR0_9FIRM/2-171       AC R7JTR0.1
#=GS R7C531_9CLOT/4-172       AC R7C531.1
#=GS A0A0E4CY64_9BACL/3-172   AC A0A0E4CY64.1
#=GS D9RXK2_THEOJ/4-173       AC D9RXK2.1
#=GS R5AZ05_9FIRM/5-70        AC R5AZ05.1
#=GS R7IT11_9FIRM/2-171       AC R7IT11.1
#=GS H6NL71_9BACL/3-172       AC H6NL71.1
#=GS R5IDE5_9CLOT/4-176       AC R5IDE5.1
#=GS I3VWP6_THESW/3-171       AC I3VWP6.1
#=GS R6U904_9CLOT/1-144       AC R6U904.1
#=GS A0A0M2SKV4_9BACI/3-171   AC A0A0M2SKV4.1
#=GS D4JTI1_9FIRM/7-167       AC D4JTI1.1
#=GS R6LSA2_9FIRM/3-176       AC R6LSA2.1
#=GS Q97HC0_CLOAB/3-172       AC Q97HC0.1
#=GS U5LFJ2_9BACI/3-171       AC U5LFJ2.1
#=GS R5FJL2_9FIRM/3-166       AC R5FJL2.1
#=GS D4K6A0_9FIRM/74-154      AC D4K6A0.1
#=GS A0A089LXB1_9BACL/3-172   AC A0A089LXB1.1
#=GS R5E180_9FIRM/5-176       AC R5E180.1
#=GS W0EEB0_9FIRM/3-169       AC W0EEB0.1
#=GS D5X7K6_THEPJ/3-172       AC D5X7K6.1
#=GS A0A0F5IBG9_9BACI/2-170   AC A0A0F5IBG9.1
#=GS A0A0M3DK21_9CLOT/4-173   AC A0A0M3DK21.1
#=GS R6WPP3_9CLOT/4-166       AC R6WPP3.1
#=GS R6P931_9FIRM/4-171       AC R6P931.1
#=GS R6GID0_9FIRM/4-161       AC R6GID0.1
#=GS E9SG86_RUMAL/3-157       AC E9SG86.1
#=GS A0A0F2PIV7_9FIRM/3-172   AC A0A0F2PIV7.1
#=GS R6WDE6_9FIRM/2-161       AC R6WDE6.1
#=GS A0A0M2PRE6_9BACI/3-171   AC A0A0M2PRE6.1
#=GS Q65HH7_BACLD/3-171       AC Q65HH7.1
#=GS C0GE42_9FIRM/4-174       AC C0GE42.1
#=GS R5A8B3_9CLOT/1-129       AC R5A8B3.1
#=GS D9R8Q1_CLOSW/7-176       AC D9R8Q1.1
#=GS C6J3S9_9BACL/3-172       AC C6J3S9.1
#=GS C4ZD12_AGARV/5-141       AC C4ZD12.1
#=GS F6B9Z4_DESCC/3-172       AC F6B9Z4.1
#=GS R6GQG8_9CLOT/3-172       AC R6GQG8.1
#=GS D4KWV7_9FIRM/3-172       AC D4KWV7.1
#=GS R6M5Z4_9FIRM/3-163       AC R6M5Z4.1
#=GS R5AL47_9CLOT/3-171       AC R5AL47.1
#=GS R7QX72_9FIRM/3-172       AC R7QX72.1
#=GS F4LVG6_TEPAE/4-173       AC F4LVG6.1
#=GS G2SX17_ROSHA/3-172       AC G2SX17.1
#=GS A0A077J4C1_9BACI/3-171   AC A0A077J4C1.1
#=GS Q8XJC8_CLOPE/2-171       AC Q8XJC8.1
#=GS A0A075JPU8_9BACI/3-170   AC A0A075JPU8.1
#=GS A0A0D8IDS1_9CLOT/4-173   AC A0A0D8IDS1.1
#=GS SP3AB_BACSU/3-171        AC Q01368.2
#=GS R5BU12_9FIRM/3-172       AC R5BU12.1
#=GS R6LJ97_9FIRM/4-172       AC R6LJ97.1
#=GS F0Z5K1_9CLOT/1-162       AC F0Z5K1.1
#=GS R6N5J7_9CLOT/1-160       AC R6N5J7.1
#=GS R6KNG9_9CLOT/5-177       AC R6KNG9.1
#=GS X5A1K0_9BACL/3-172       AC X5A1K0.1
#=GS R6N2U0_9FIRM/6-167       AC R6N2U0.1
#=GS A0A024QBV3_9BACI/2-170   AC A0A024QBV3.1
#=GS B8D2E8_HALOH/4-173       AC B8D2E8.1
#=GS R6RFZ5_9CLOT/2-178       AC R6RFZ5.1
#=GS A0A0F0C844_9CLOT/4-176   AC A0A0F0C844.1
#=GS Q8EQ30_OCEIH/2-170       AC Q8EQ30.1
#=GS G9RYK2_9FIRM/7-173       AC G9RYK2.1
#=GS F6CL76_DESK7/3-172       AC F6CL76.1
#=GS C0EFZ6_9FIRM/3-167       AC C0EFZ6.1
#=GS F9VKT2_ARTSS/2-170       AC F9VKT2.1
#=GS A8FF26_BACP2/3-171       AC A8FF26.1
#=GS A0A0F2Q9S8_9CLOT/3-172   AC A0A0F2Q9S8.1
#=GS A5N7I0_CLOK5/3-172       AC A5N7I0.1
#=GS R7K2T2_9CLOT/9-177       AC R7K2T2.1
#=GS R6AIN6_9CLOT/3-164       AC R6AIN6.1
#=GS A0A090J2B4_9BACI/3-171   AC A0A090J2B4.1
#=GS R6QZU0_9FIRM/3-172       AC R6QZU0.1
#=GS R7K6U9_9FIRM/2-155       AC R7K6U9.1
#=GS R6IBL3_9FIRM/1-144       AC R6IBL3.1
#=GS R6K031_9FIRM/3-175       AC R6K031.1
#=GS C6LAC8_9FIRM/3-172       AC C6LAC8.1
#=GS G5IBS7_9CLOT/4-173       AC G5IBS7.1
#=GS A0A0E4C8J6_9FIRM/5-174   AC A0A0E4C8J6.1
#=GS D4LX74_9FIRM/3-172       AC D4LX74.1
#=GS A0A0B7MGY8_9FIRM/21-190  AC A0A0B7MGY8.1
#=GS A0A075LK92_9BACI/2-170   AC A0A075LK92.1
#=GS R7G1Y7_9FIRM/1-164       AC R7G1Y7.1
#=GS R6GD52_9FIRM/3-78        AC R6GD52.1
#=GS R7F5R2_9CLOT/5-169       AC R7F5R2.1
#=GS A6NV03_9FIRM/3-170       AC A6NV03.1
#=GS C6CU13_PAESJ/3-172       AC C6CU13.1
#=GS R5JGP9_9FIRM/1-168       AC R5JGP9.1
#=GS Q818Q4_BACCR/10-168      AC Q818Q4.1
#=GS R6RT95_9CLOT/4-169       AC R6RT95.1
#=GS I3EAC8_BACMT/3-171       AC I3EAC8.1
#=GS F7KQ68_9FIRM/6-175       AC F7KQ68.1
#=GS A4XLD1_CALS8/8-165       AC A4XLD1.2
#=GS R5D5P6_9FIRM/3-172       AC R5D5P6.1
#=GS R6U276_9CLOT/5-172       AC R6U276.1
#=GS E6SL65_THEM7/3-171       AC E6SL65.1
#=GS L0EE69_THECK/3-171       AC L0EE69.1
#=GS R6R0H1_9FIRM/3-172       AC R6R0H1.1
#=GS A0A0N0Z5S2_9BACI/2-170   AC A0A0N0Z5S2.1
#=GS R5LF31_9CLOT/5-172       AC R5LF31.1
#=GS A6LU35_CLOB8/3-172       AC A6LU35.1
#=GS Q81M39_BACAN/3-171       AC Q81M39.1
#=GS F0T0S3_SYNGF/3-169       AC F0T0S3.1
#=GS A0A0K8JJI7_9FIRM/4-173   AC A0A0K8JJI7.1
#=GS C0CY20_9FIRM/4-40        AC C0CY20.1
#=GS R7C103_9FIRM/3-172       AC R7C103.1
#=GS J7IMK2_DESMD/3-169       AC J7IMK2.1
#=GS R7EXW3_9FIRM/28-183      AC R7EXW3.1
#=GS R6EWM6_9FIRM/1-169       AC R6EWM6.1
#=GS R4KAY4_CLOPA/3-171       AC R4KAY4.1
#=GS A6CTX3_9BACI/3-171       AC A6CTX3.1
#=GS A0A0M2VMT7_9BACL/3-172   AC A0A0M2VMT7.1
#=GS R5IB37_9FIRM/2-171       AC R5IB37.1
#=GS B0PBE3_9FIRM/2-166       AC B0PBE3.1
#=GS C5EH42_9FIRM/4-176       AC C5EH42.1
#=GS B0TEH5_HELMI/3-172       AC B0TEH5.1
#=GS R5P7W4_9FIRM/3-172       AC R5P7W4.1
#=GS I0JNW2_HALH3/2-169       AC I0JNW2.1
#=GS R7AJV0_9BACE/7-177       AC R7AJV0.1
#=GS K6DTD6_BACAZ/2-170       AC K6DTD6.1
#=GS R6ICS7_9FIRM/2-169       AC R6ICS7.1
#=GS B8I3C0_CLOCE/4-172       AC B8I3C0.1
#=GS R6GSG0_9CLOT/1-137       AC R6GSG0.1
#=GS A0A0F2JJL8_9FIRM/3-169   AC A0A0F2JJL8.1
#=GS A0A0C2UJ52_BACBA/2-170   AC A0A0C2UJ52.1
#=GS D9SLF2_CLOC7/3-172       AC D9SLF2.1
#=GS Q894F9_CLOTE/4-173       AC Q894F9.1
#=GS D3E6K9_GEOS4/3-172       AC D3E6K9.1
#=GS R5T8Q3_9CLOT/7-176       AC R5T8Q3.1
#=GS R6JN57_9CLOT/1-147       AC R6JN57.1
#=GS R5Q3H4_9FIRM/3-167       AC R5Q3H4.1
#=GS R7GAR3_9CLOT/5-119       AC R7GAR3.1
#=GS R7KC87_9FIRM/4-157       AC R7KC87.1
#=GS R5XPI3_9FIRM/3-172       AC R5XPI3.1
#=GS D7GUK4_9FIRM/2-178       AC D7GUK4.1
#=GS R5TLB9_9FIRM/3-172       AC R5TLB9.1
#=GS R5ECS1_9FIRM/4-170       AC R5ECS1.1
#=GS C8WXI3_ALIAD/2-170       AC C8WXI3.1
#=GS R5N5V5_9CLOT/5-169       AC R5N5V5.1
#=GS R7FH89_9CLOT/5-123       AC R7FH89.1
#=GS A0A0N0YD81_THEVU/2-171   AC A0A0N0YD81.1
#=GS R7FQQ8_9FIRM/2-167       AC R7FQQ8.1
#=GS A0Q091_CLONN/4-173       AC A0Q091.1
#=GS L0F7P7_DESDL/3-169       AC L0F7P7.1
#=GS R6N725_9CLOT/5-169       AC R6N725.1
#=GS R7BI57_9FIRM/5-177       AC R7BI57.1
#=GS C2X2E4_BACCE/1-164       AC C2X2E4.1
#=GS J1H3U7_9CLOT/1-146       AC J1H3U7.1
#=GS Q5KX94_GEOKA/2-170       AC Q5KX94.1
#=GS R5LXU5_9FIRM/1-158       AC R5LXU5.1
#=GS R6EIE9_9FIRM/1-164       AC R6EIE9.1
#=GS G7M110_9CLOT/3-172       AC G7M110.1
#=GS B5CM47_9FIRM/3-172       AC B5CM47.1
#=GS R7I7Q5_9CLOT/3-172       AC R7I7Q5.1
#=GS A0A089L3U1_9BACL/3-172   AC A0A089L3U1.1
#=GS F5SB01_9BACL/3-172       AC F5SB01.1
#=GS Q2RI95_MOOTA/3-172       AC Q2RI95.1
#=GS R6ZUU8_9FIRM/4-173       AC R6ZUU8.1
#=GS E6TXN9_BACCJ/2-170       AC E6TXN9.1
#=GS R5PDC9_9CLOT/1-166       AC R5PDC9.1
#=GS R5HGP6_9FIRM/4-169       AC R5HGP6.1
#=GS R6CNW8_9FIRM/3-160       AC R6CNW8.1
#=GS A9KMD0_CLOPH/7-176       AC A9KMD0.1
#=GS A0A078KSP3_9FIRM/4-171   AC A0A078KSP3.1
#=GS J3B0I1_9BACL/3-172       AC J3B0I1.1
#=GS R6TCG4_9FIRM/3-165       AC R6TCG4.1
#=GS R6Z5K6_9CLOT/4-173       AC R6Z5K6.1
#=GS R5VM52_9CLOT/3-170       AC R5VM52.1
#=GS D5DS81_BACMQ/2-170       AC D5DS81.1
#=GS A6TR28_ALKMQ/4-173       AC A6TR28.1
#=GS C5VSZ5_CLOBO/4-173       AC C5VSZ5.1
#=GS Q8RAD9_CALS4/2-170       AC Q8RAD9.1
#=GS R7ISW6_9CLOT/6-170       AC R7ISW6.1
#=GS R5RJJ1_9FIRM/3-172       AC R5RJJ1.1
#=GS R7GUZ7_9FIRM/2-166       AC R7GUZ7.1
#=GS R7FEP9_9FIRM/3-167       AC R7FEP9.1
#=GS R7BSC6_9FIRM/6-166       AC R7BSC6.1
#=GS I8J694_9BACI/4-171       AC I8J694.1
#=GS D4J409_9FIRM/1-138       AC D4J409.1
#=GS A3DDQ0_CLOTH/4-173       AC A3DDQ0.1
#=GS G7W852_DESOD/3-169       AC G7W852.1
#=GS E7GNS0_CLOSY/4-173       AC E7GNS0.1
#=GS R5N3Z3_9FIRM/1-102       AC R5N3Z3.1
#=GS R5TCB0_9CLOT/5-172       AC R5TCB0.1
#=GS F3AI40_9FIRM/4-173       AC F3AI40.1
#=GS C8W107_DESAS/3-172       AC C8W107.1
#=GS A0A0D1XUH5_ANEMI/3-172   AC A0A0D1XUH5.1
#=GS G4HEY2_9BACL/3-172       AC G4HEY2.1
#=GS A5I318_CLOBH/3-172       AC A5I318.1
#=GS A0A0M1UYE2_CLOSO/4-173   AC A0A0M1UYE2.1
#=GS A1HQ77_9FIRM/4-173       AC A1HQ77.1
#=GS F4A170_MAHA5/4-173       AC F4A170.1
#=GS R6G6F9_9FIRM/3-172       AC R6G6F9.1
#=GS R6GDG8_9FIRM/4-172       AC R6GDG8.1
#=GS A0A0F2SK18_9FIRM/3-169   AC A0A0F2SK18.1
#=GS R6TB59_9FIRM/3-162       AC R6TB59.1
#=GS R7HEM6_9FIRM/3-173       AC R7HEM6.1
#=GS K4LIS2_THEPS/22-190      AC K4LIS2.1
#=GS R5KKD4_9CLOT/5-156       AC R5KKD4.1
#=GS R6DUF9_9FIRM/4-160       AC R6DUF9.1
#=GS F8I9H1_SULAT/5-169       AC F8I9H1.1
#=GS A0A098F2A5_9BACI/3-171   AC A0A098F2A5.1
#=GS A0A094WJF3_BACAO/10-178  AC A0A094WJF3.1
#=GS R6ERA2_9FIRM/3-171       AC R6ERA2.1
#=GS R7KYP0_9FIRM/3-173       AC R7KYP0.1
#=GS A0A0E3JPE3_CLOSL/3-172   AC A0A0E3JPE3.1
#=GS B0K9D1_THEP3/2-170       AC B0K9D1.1
#=GS R5IGU5_9FIRM/1-147       AC R5IGU5.1
#=GS C0ZBZ1_BREBN/3-172       AC C0ZBZ1.1
#=GS R7NNJ7_9FIRM/1-133       AC R7NNJ7.1
#=GS A0A085L6A9_9FIRM/3-172   AC A0A085L6A9.1
#=GS R6GNP4_9FIRM/6-157       AC R6GNP4.1
#=GS R6R314_9FIRM/4-172       AC R6R314.1
#=GS Q24UX9_DESHY/3-169       AC Q24UX9.1
#=GS F4XAH5_9FIRM/3-169       AC F4XAH5.1
#=GS R7R618_9FIRM/4-173       AC R7R618.1
#=GS A0A0A7FV67_9CLOT/3-172   AC A0A0A7FV67.1
#=GS R6XGN9_9CLOT/5-169       AC R6XGN9.1
#=GS U5MT08_CLOSA/3-172       AC U5MT08.1
#=GS H3SFE1_9BACL/3-174       AC H3SFE1.1
#=GS R5HZJ8_9FIRM/3-172       AC R5HZJ8.1
#=GS U5RXC4_9CLOT/3-172       AC U5RXC4.1
#=GS R5Y7U2_9FIRM/2-153       AC R5Y7U2.1
#=GS D7CKG4_SYNLT/7-176       AC D7CKG4.1
#=GS R6H489_9CLOT/5-169       AC R6H489.1
#=GS R6XJJ5_9FIRM/3-172       AC R6XJJ5.1
#=GS R5Y419_9CLOT/4-173       AC R5Y419.1
#=GS R5QH78_9FIRM/3-172       AC R5QH78.1
#=GS C5D483_GEOSW/2-170       AC C5D483.1
#=GS I4D8X5_DESAJ/3-169       AC I4D8X5.1
#=GS R6NPU3_9CLOT/3-170       AC R6NPU3.1
#=GS R7DBE8_9FIRM/3-172       AC R7DBE8.1
#=GS R5CZB5_9FIRM/2-169       AC R5CZB5.1
#=GS G4KPT5_OSCVS/2-164       AC G4KPT5.1
#=GS R5WWV3_9FIRM/3-172       AC R5WWV3.1
#=GS W6S2T8_9CLOT/4-171       AC W6S2T8.1
#=GS R5UPW6_9FIRM/3-171       AC R5UPW6.1
#=GS D4LE91_RUMC1/3-165       AC D4LE91.1
#=GS R5Z1B3_9CLOT/5-169       AC R5Z1B3.1
#=GS Q5WF48_BACSK/2-170       AC Q5WF48.1
#=GS U2SH45_9FIRM/3-165       AC U2SH45.1
#=GS G2G096_9FIRM/3-169       AC G2G096.1
#=GS R6DUA5_9CLOT/3-171       AC R6DUA5.1
#=GS R4KFS4_9FIRM/3-172       AC R4KFS4.1
#=GS B1I3A8_DESAP/3-172       AC B1I3A8.1
#=GS Q0AZG9_SYNWW/5-174       AC Q0AZG9.1
#=GS R6YYS9_9CLOT/10-174      AC R6YYS9.1
#=GS S2KVU5_9FIRM/3-172       AC S2KVU5.1
#=GS D9QRW5_ACEAZ/3-172       AC D9QRW5.1
#=GS A0A0K0GEY4_9FIRM/2-170   AC A0A0K0GEY4.1
#=GS R6P608_9FIRM/3-172       AC R6P608.1
#=GS K4L1Q4_9FIRM/3-169       AC K4L1Q4.1
#=GS G2TPR1_BACCO/3-171       AC G2TPR1.1
#=GS E3E4Y7_PAEPS/3-172       AC E3E4Y7.1
#=GS A0A023CLT6_GEOSE/2-170   AC A0A023CLT6.1
#=GS R5UCV0_9FIRM/3-172       AC R5UCV0.1
#=GS R6DM84_9FIRM/3-171       AC R6DM84.1
#=GS C9R8Z9_AMMDK/3-172       AC C9R8Z9.1
#=GS R7N2Y4_9FIRM/4-171       AC R7N2Y4.1
#=GS R5NHY8_9FIRM/3-172       AC R5NHY8.1
#=GS D3FUV9_BACPE/2-170       AC D3FUV9.1
#=GS A0A0F2PSX6_9FIRM/3-172   AC A0A0F2PSX6.1
#=GS A0A075R476_BRELA/3-172   AC A0A075R476.1
#=GS R7A1H9_9FIRM/3-170       AC R7A1H9.1
#=GS A5D344_PELTS/3-172       AC A5D344.1
#=GS B7GHE8_ANOFW/2-170       AC B7GHE8.1
#=GS A4J3D9_DESRM/3-172       AC A4J3D9.1
#=GS R5WDN8_9FIRM/2-78        AC R5WDN8.1
#=GS I7LKN7_9CLOT/3-172       AC I7LKN7.1
#=GS G8LWK3_CLOCD/4-171       AC G8LWK3.1
#=GS Q9K954_BACHD/2-170       AC Q9K954.1
#=GS R5DH03_9FIRM/5-160       AC R5DH03.1
#=GS D4LPN5_9FIRM/3-172       AC D4LPN5.1
#=GS A0A075KBE0_9FIRM/4-173   AC A0A075KBE0.1
#=GS R6LMJ0_9FIRM/3-172       AC R6LMJ0.1
#=GS R6SV52_9CLOT/5-158       AC R6SV52.1
#=GS R6CWK5_9CLOT/3-162       AC R6CWK5.1
#=GS R6VE33_9FIRM/3-172       AC R6VE33.1
#=GS R6TRE8_9FIRM/3-160       AC R6TRE8.1
#=GS R7L7Y5_9CLOT/5-169       AC R7L7Y5.1
#=GS R5K248_9CLOT/5-174       AC R5K248.1
#=GS K6DNH1_9BACI/3-171       AC K6DNH1.1
#=GS K6UC52_9CLOT/3-172       AC K6UC52.1
#=GS C4Z0I3_EUBE2/4-172       AC C4Z0I3.1
#=GS A0A0F2NK71_9FIRM/3-172   AC A0A0F2NK71.1
#=GS A0A089ILM4_9BACL/3-172   AC A0A089ILM4.1
#=GS I9AZW5_9FIRM/3-172       AC I9AZW5.1
#=GS R6B816_9CLOT/5-171       AC R6B816.1
#=GS A8MFK1_ALKOO/4-173       AC A8MFK1.1
#=GS R5Y7F5_9CLOT/5-157       AC R5Y7F5.1
#=GS F2JME2_CELLD/3-173       AC F2JME2.1
#=GS R5ASR1_9FIRM/1-70        AC R5ASR1.1
#=GS R5DS37_9FIRM/4-164       AC R5DS37.1
#=GS R6PFL3_9FIRM/3-172       AC R6PFL3.1
#=GS A5Z6N6_9FIRM/4-173       AC A5Z6N6.1
R6MSD6_9CLOT/1-156                  .............................-------------MFGRYIWERY..MLRVKVLEEWQRMLIEINGEINYSAQSMSQICRQMS...........KTS.V-.......YGKKF..WDGIAKKTEE..R.........NAGLPGEFWGEHLREY...RYI....ELLSNEDKEIICQFGESFGTLDICSQINEIELFEKRLEKNLSDARQKMVEQKKICIVM.GVISGMMTGICL-l.........................................
A0A0M2U9Y5_9FIRM/3-172              ............................r-LVGAGLVVVAAGWLGLVVANNY..SRRPQQLRALRSALTMLETEIVYTATPLPEALARVA...........RCT.NP.......PVSNL..FWGTHEALGE..G.........RGYTAAESWEVGLGGI...AGE....ASLLPQDLEVLRSFGHSLGSSGPEDQVRHLQLAREQLKQLELAAEVERAKNERLWRTM.GFLVGLMLVLVL-y.........................................
A0A060M3B6_9BACI/2-170              ............................r-WLGALLIICCTTLYGFYQARLL..QERPQHIRQLRSALQSLEAEIVYGQTPLAKASINIS...........KQL.NG.......PVAAL..FKSFSLRLTE..-.........RKATANKAWEAAIEDT...WKS....LSLKEKEKEVLLQFGATIGTMDRNHQQKQLKLTQTHLERDEEEARVIQARYEKMYKTL.GVLAGLFIVILMM..........................................
Q3AAK9_CARHZ/4-167                  .............................KLLGACLTVTGTGALGFYLGNRY..LQRVRNLERLINLLNFLKTEIRYKATPLPEIFAKMA...........NSE.EG.......TVAKL..FEI-K-----..D.........RTLPVNQGLKKALAEG...FSQ....TALLKREQEILLAFAEKIGISDLREQENLLNYTCEQLKLVLAESRQEAEKNVKLVNYL.GVLVGAFLVLLFF..........................................
R6GYS5_9FIRM/2-84                   .......................tiyerl-----------------------..------------------------------------...........---.--.......-----..----------..-.........------------LKKT...WK-....EKFSKEEQNLFLNAGRNLLSDDMEYQREEIKQLSTYLNEKILQMKKEYTNKKKVVLIS.CLCMGALAVILLF..........................................
E2ZIP5_9FIRM/6-154                  ............................h-WAAAALLLLCGWLAGSAFQVRT..EQHILQLQRTVELLQRIRQEIAYRRLDLEQLQRCLV...........---.--.......-----..----------..-.........QEKLLESDAAPKLQEI...PAP....ERFDDAERLCFEQCFAGLGQSEAAQECERLDYYSARFEAFLHQAQQKAASGQGLPCRL.GLAAGAVAALILL..........................................
A0A0D3V885_9BACL/3-172              .............................KLLGAILILLSGTLAGFYKARQF..ERRPRQIRELILAMQRLETEITYGFTPLPEAMSKMG...........AQM.KE.......PLSTL..FTSAARSMNS..S.........QGLTAQESIAHALALH...WKN....TSMKTAEKDVLHQLSFTLGTSDRQDQIKHIALAAQQLKHEEAASREDQAKYEKMSKSL.GLLVGALIIILI-f.........................................
K0J3W9_AMPXN/2-169                  ............................n-LIGAILLIIATSLIGFEKAARL..KKRPDQILQFKGALQVMEAEILYSQRLLADVCLQIS...........TQI.PA.......PVSHF..FRKIGEEIG-..-.........HHHDLPKLWIDELKHL...LSY....SALKHDEINVLKQFGQTLGHFDLINQQKQIQLAIVHLDRILIEAQNEYLIFSKVYRGI.GVLSGILIALILM..........................................
R5GVQ0_9FIRM/2-162                  .............................KLAAGLMILFICGGWGLAQRIKL..RRRCELLRELRLMLEQYSIKISCTAPTL----EQLA...........QES.EG.......VFGSI..LRECAA----..-.........ETPDIRSAWSSSVQRL...SAL....PCCGKEEAKMLAELGRALGTCPAESEISLLRLYSGQMDRLCDEAEKTSEQKGRLYSSG.GILAGLAAAVLLL..........................................
E0ICJ9_9BACL/4-173                  .............................KMIGAALILFAGTLIGFLQAARY..ADRPKHIRQLAGALQRLETEIVYGRTPLPEAITRIA...........ANV.QQ.......PTARL..MEAVTAQLQQ..S.........DGRTFNECWEAAIRSQ...WPS....TAMRSAELTVAIRLGSTLGISDKDDQLKHLRLAAVQLKAEEDAARDEQAKYEKMSRSL.GVLLAILVVILMV..........................................
A0A0A1MFD3_9BACI/2-170              .............................KWIGVLLLISMSTVLGWEWGRSL..KQRPKHIQLLLQSLQILEAEMVYSQVPLQEAFQLIS...........KKL.QG.......PTALF..YQELAEELEN..-.........KEKDFDEIWEECAQRL...IGQ....SALQKSDLEILLQFGRTLGQHDIEQQKKHIKLTNLYLEEQWKNATERFQTYGKLSNVL.GLLCGIFLALLFM..........................................
L0K8Q9_HALHC/2-169                  .............................KLVGTILIIISSTGLGFVVARQF..ILRSKQLKQIKLALELLQTEISYGITPLPQAFEKIA...........SEL.DA.......PVDNF..FVEAREGLK-..-.........AGQTAKDAWQQAVKKV...ISQ....TALGQTEEDVLLDFGCNLGQSTSDDQLRYLNLAQDHINNLHQEAITDQKEKVKLWRYL.GVLGGLFIVILI-f.........................................
R5F3J4_9CLOT/5-177                  .............................KWTGAILVLFSAGGLGIWSAMQW..KGRLRMLETLRQMIYFLKGEITYSRAPLAEALERVG...........KRE.PG.......PLGGL..FEGAAEGIYM..Q.........EGESLQEIWKRQVMNL...NTDs.gpIPLEQEDLEQLAHLGEHLGYLDVDMQERTLKLYLEQLDLTIDYLRQNQREKCRLYTSL.GIMGGMFLVIVMF..........................................
K4ZMZ1_PAEAL/14-185                 .............................KLLGAAILISAAAGIGWVQAAAY..AARPKQLRLLHHALARLETAIVYGQTPLSTAFYDIA...........QQM.PA.......ALRDI..FISASKAMGH..Sa.......aFPLTAREAWQQAWDHY...GSN....TALSKEDLRIVKELGYSLGISDREDQSKHIKLAIKQLEQEEWSAREDHSRYGKMTRSL.GVLAGLLVVILM-y.........................................
R5YCP8_9FIRM/3-171                  .............................KLIGILMILCGCAGILYQWMKVQ..RCRALLMEEWIRIFAAFEYALEKEHVPIQRFFLRYD...........GRL.PE.......-VERF..FERVLQLLEK..N.........EYPSGQMVWGMVFKEW...EKK....FALKEEAGHTLRAAGDAFFGENSQENLRCMQGCRQRMEKCVEKEREEFVRQRSVYMPV.GMLTGLMLVILLV..........................................
R5AIK6_9FIRM/3-172                  ............................r-LLGSVLVLGATLWFGAYFAAKE..KYRLQELAELERAILLLQSQIAYLSAPLTEVLESVS...........WKA.EG.......VIGEI..FAQAAAVMAE..R.........ERASAEEIWTEAWSKR...RNQ....IFLTAEDLDMVLSFGKTLGYLDKAQQEGSICLLLRYLEEALAQGRKRSEKNGRLYYGI.GGLSGLLIIVTLL..........................................
R6BL76_9FIRM/3-172                  .............................KLFGAGLTMFSCFAAGCLICAEM..KKRIHILEELRRMTVMLSAEIGYANTMLDEAFGSIA...........KRV.SP.......PLSDF..LVHVQEKMQK..G.........EEANLGVIFEKQLEMD...LKG....TALKESDLASLRTLGGQLGYLDVAMQKKTLDYYLEQVSDACVQAKKEYREKEKMFRCL.GFGAGAFLVILL-y.........................................
R7CGF4_9FIRM/3-172                  ...........................rt--VGLCVIVISGVGCGFAMSNEL..GRRKKMMEMILRMIILLRGEIRYGNKSLYDAFTGAS...........GKL.EG.......KYREF..FILTAQKMKE..K.........TGDSFGTIFRESAGKC...LDL....DCLLQEERDRFYSLGDQLGYLGLDMQLKQMDLMEKETEYAIRELRKDFCEKRKLYRSM.GILGGIFVAVFFW..........................................
R5L5F8_9FIRM/4-170                  .............................KIFGCLLIFSGCGGIGFGMGRDY..NARISQLEQVKKMLFLLEGEIKYNNGGIYESMKKLT...........GIS.DN.......IMTGF..FEGVIKD---..-.........NVGTLKEAWQFNIEKS..fVSD....SKLSKEDIAIIEDLGNTIGMTDKETQIKNIDHAMECIDDNIGELKKGKTEKCRLYRTT.GIAAGAFLAILFL..........................................
R5TET5_9CLOT/3-174                  .............................KWIGCILVMTGCVGGGMVMAVGL..KRRIRILEELEVLLQRLYGEMEYAGNDMIDILKILQ...........VES.IY.......-FSEL..WQRIIERLER..G.........DSVRLWEVWREETKRKtglSPI....CFLGQEEQYILQEVGRALGQTDRKTQLHMLKLHEQRLHKVVNKIRSESQTQARVYRVV.GVTAGCFLVILFV..........................................
B1CBV6_9FIRM/4-171                  .............................KLPGMVCLFIFSVLFSRSITRKI..KNRLLELEEINRILNDFIVSINVGLYDVNFLITEAI...........KIT.KT.......TYHDF..LRDVKTTMIK..K.........DLSDFSAIWFECLNNH...--K....FNISREEMILLENIGVSLSFNDKNRMVKQLTLIQSGLTEAIKKAREDRDSKVSLYEKM.GVLFGSFLVVIFI..........................................
A7GSL0_BACCN/3-171                  .............................KIFGAVLIVAVTTFFGFSHAKRY..SERPRQLRLLKAALQSLEAEIMYGHTPLSEAAERLV...........KQM.PK.......PLNWI..FQSFSKRLEN..-.........GEQTVRESWLDSLKEN...WAL....TSLKQAEYEILQQFGETLGQHDRESQQKHIRLCITHLEREEGEAKALQQQYEKMIKSL.GVLAGLLIVILLL..........................................
L7VLP1_CLOSH/1-123                  ...........................mg-----------------------..-------------------------RPLGEALSQYA...........RNR.TS.......SLSEF..TGRVYEI-SV..N.........EGNGIDAAWRKGIEEF...RKR....WPMDQEEWNLLSQMGEVLGKTDRAGQSSFIKMMREKFAVQEKKAEEDRIRKEKLYRDL.GILGGLAIVLVLI..........................................
E5WIG1_9BACI/3-171                  .............................KVIGAVLIIVATTWAGFEASRHL..TERPRQLRQLKSALQSLEAEIMYGHTPLHEAARRLS...........AQL.SK.......PLSWF..FESFAKKLT-..D.........SETTVKDAWEESLKEI...WKM....TAFKQGEFEIMKQFGETLGRHDRLSQQKQIMLTLSHLEREEADAHDRQVKYERMVKSL.GFLSGLLLIILLM..........................................
R6C8V0_9CLOT/3-172                  ............................r-LFGAILIFAGCTALGLFYRTRY..YESIRLLKTMEKILDLFISEVRYGKSTLHECLFMIA...........EKT.EE.......PFRGT..LLSAGKLLQK..E.........DGRDFSACWEEAFAVL...LQK....LPLTKEEKESFLSFAKVKGLKDWQMQVRVMEGHRDAIKEARRIREQNVLQQGKLATGL.GIMGGLFLIIVLL..........................................
D5WV73_KYRT2/5-174                  ............................q-WVGSAFVLTASAGLGFYKAERL..RKRVEALRSVQGGLQLLDTEIAFSATPLPRALVRIA...........RVC.AP.......PASVI..FADAAEGLAS..R.........PEVGAGVHWEAAVGKR...CAE....LALAPADEEILVQFGRTLGVSDREDQRKHIRMALERLSVQEREAAGEAAQRVRMWRSL.GILAGLAVVVLLM..........................................
R6XSG3_9CLOT/5-169                  .............................KIVIYTFIFLSCSLIGILVSNKY..RNRVNELKEFKNALNIFKTKIRYTYEPIPEIFEQIS...........KNT.NS.......NISNV..FGVASEKM--..-.........KVLAAGEAWNLALNME...--E....LNINDEDRLALSNLSKLLGKTDVTGQLNQIELTTDFLEGQIKKAEQQRDKSEKMYRTL.GMLIGMAIVIILM..........................................
M1LTX3_9CLOT/3-172                  .............................KIIIAIGIFLISTYIGFIYGDTF..KKRQDQLREILKALTILENDIVYGTTPLPEALENLY...........SKI.NN.......PLNNL..IKAIADRLIK..G.........DVESVYQGALEEFKGL...ENE....FYLNEADKEIMADFLKSLGSSGVLGQKKIFALAVEGIRMNLREAEDIAKKNIKLYRYL.GVCLGAMIVIFII..........................................
C2WBX9_BACCE/1-159                  ............................m-----------TTFFGFSYAKRY..SERPRQLRLLKAALQSLEAEIMYGHTPLSEASERLV...........KQM.PK.......PLNWI..FESFSRRLES..-.........GEQTVREAWLDSLQEN...WKL....TAFKQTEYEILQQFGETLGQHDRESQQKHIRLCITHLEREEGEAKALQIQYEKMIKSL.GVLAGLLIVILLL..........................................
R5QAL0_9CLOT/5-169                  .............................KGILIFFVFLIFVKIGSIYSKKY..INRASQLEQMKNLLNIFKVKIKFTCNTIQEIFNQLY...........EDT.PN.......EIGEI..FKKANEYM--..-.........ETYSAKEAWNTSLEEA...--K....TDLTKEDIETLKNLGKILGETDVEGQINQIELTETLLENQIKEALEEKLKNSKMYRTL.GVTVGLAISIILI..........................................
A0A0H4KML3_9BACI/2-170              .............................KLFGALFILVATTWFGFDLAKQL..NARPKQLRQLKSALRSLEAEIMYSHRPLPQIARLLT...........EQV.PK.......PIASF..FDSFATYLE-..M.........GQKSAGEAWLLSIEEN...WRL....TALKQGEKEALKQFGQTLGQHDRYSQQKHIVLTLNHLEREEADAVDRQTRYEKMVKSL.GFLTGLLLVILLL..........................................
Q18B53_PEPD6/4-173                  .............................KIIIIAFLIGSSYLIGEQIYKTY..TRRHKQLNDLIRVLEILRMDLSFGLYTLEEIFNRIG...........GNK.EF.......CFWKF..FYQISEGLHN..E.........QSKTLEIIISENIDVL...SKE....TYLGNKEIEELKNLILTLGKSDIESQQRMIDLSIENLKKQTYETKEDINKKGVLYKKL.VTFIGIGICIILI..........................................
F7NJX1_9FIRM/4-173                  .............................KLTGSVLIVAAGSLFGFELAKRY..IERPKQIRQLMNGIRSLQSYIHYAAMPLSEAFSQAA...........RGV.AA.......PVSDL..LTATGAIMQK..D.........TYLTPQEAITLAVKEM...RCR....LALNKAEVDDLILFAANLGFMNREEQQKYCGMILSQLEKYEQEALKVKEQNVTMYRYL.GVCGGLTLVILIL..........................................
C4IL69_CLOBU/3-172                  .............................KLVIACALFSICSYVGFEYGEGF..NRRMIQLREILKSLIILQNDILYGSTPLPEAFENFS...........YKV.EE.......PIHSF..INGIREKLVS..G.........SVESVYDGVAEEYREL...KGK....FSLNDNDIKILGDFFKSLGESGVFGQERIFSLAIEGIRMNLKDAEDTAKKNVKLYRYL.GVCVGGMITIFV-l.........................................
C0CY21_9FIRM/1-137                  ............................i-----------------------..--------------YFLKGEITYSHAPLAEALERVG...........RRG.GG.......PLGDM..FVRASERICT..Q.........EGESLQEIWSGETRTMaagAKN....LPLTRADLEQFTALGEHLGYLDVDMQERTLLLYLEQLDLSIEYLQAHRQEKCRLYTSL.GVMGGIFLVIVM-c.........................................
B2A544_NATTJ/3-171                  ............................r-IVGAGLILFSTMALGNQVAHKY..KMRPKLLRQLEVLLEMTGSEINYAAVPLPELLSKIG...........RRF.PK.......GAGKI..FHRVNEHLK-..H.........NGVTPEEAFYKTKQQL...QHE....LSINEEDWQVLENFASYLGKSDSGEQLKQVELCLSHIRANQKIAMEDQRKNERMWRYL.GVLAGLMLVILIW..........................................
R5HAM8_9FIRM/3-183                  ............................r-LIGICLTLAGSFGSGLAFCREK..SRHAGTLFLLAELFLRMAEEIGYSAERLPDVFSQMSvwlakdaendrKEE.AS.......ALAEA..LLHCADRLEQ..E.........RSEPLEVVWNAELGAW...AAQ....TVLSREEAEKLLSFAKEQGFPDRERQRQWMLRLSGEFKSRAESVFEKAASEKRMVLSV.SLAAGALVVVLFW..........................................
R7MAA7_9CLOT/5-169                  ............................r-LFILAMIIVVSSIIGILFSKRY..ANREKEIKEMKNALNMFSTKIKFTYEPIPNVFMEIA...........NKI.DG.......NIGTI..FNVAANNM--..-.........KEMSAGEAWRKALLI-...-SK....NNLNKEDVATIQNLSRLLGQTDIEGQISEVEVVNNFLTVQLENASEERRKNEKMYRTL.GLVTGLTIAIILI..........................................
A0A0H3J7T1_CLOPA/3-171              .............................KIIGSILIIIASTFGGFMYAQCF..VNRVKELNEIERCIYQLQNEIVYTHTPLPEALVNVA...........VKS.KE.......PIADI..FNRSSHKLKS..N.........RYDNVYEAFKEAFREN...-SN....LNLKEEDINLMLDLSKSLGESDITGQINIFSLTIENLKKIIAQAEITMKKNVKMYRYL.GFGIGAMIVIMLI..........................................
C0C3R2_9FIRM/3-130                  .............................KIAGALLLTAGTTLMGMRAASGI..QDEYRQIQYLQQIMYLLLSEIRYSRAYLGEAFLHIG...........GQV.RE.......PYSKW..LAQMSRRMDS..R.........DEGIFSDIWENSAEEY...LAD....SGLPGEEISRLKALGTRLGAADMDMQLK------------------------------.-------------t.........................................
R7ANQ8_9CLOT/4-98                   .............................KLLGICLVCVSCAGIGGGEALRL..IGRRRFLEEVKRIAAGLRGEIGYTQAVLPL------...........---.--.......-----..----------..-.........----------------...---....----------------------------------------------------------.-------------xhrqfflwycagrghagmekrgsyfwwqesgwkriqsvrlgv
K0AX56_CLOA9/5-174                  .............................KILGCLFVIISSTMIGMEYSKKY..TERLNNLVYVQNCIQLLETEIVYSCNPLPNALENVY...........NKG.NK.......KVSFL..FEEIRKYLLE..N.........KDKTLFESFEYSLSKF...KDK....LYLEDEDTEIILSLGRVLGVSDRLDQEKHFKTILVNLEMNHKDANEKKSKNAKMYKSL.GVLFGFALVLIL-y.........................................
A0A0D5NQ32_9BACL/3-172              .............................KWIGAILILAAGTMIGFLQAARF..AERPRQLRQLAHALQRLETEIGYGYTPLPEALRRTA...........GHV.PA.......PVASI..LSGAAERLLA..P.........EGPAFRECWEESVRSC...WPQ....TAMRSGEQAVLLRLGSALGLSDREDQIKHLRLAMLQLKAEEDAAKDDQARYEKMSKSL.GILVAALVVILMV..........................................
F5LLP7_9BACL/4-173                  .............................KLAGAALVLGAGAGFGFAKARRY..RRRPQQIREMIQALQRLETEIVYGSTPLPDAIATLS...........EQT.RA.......PLAGV..FREVADRLSE..P.........QDDTLSAIWRDAVQHG...WRN....SAMKPAELQVVLRLGQTLGASDRTDQAKHLRLSVLQLQAEETTAAEEQKRYEAMWKSL.GVLVGALIVILM-y.........................................
E6UIW0_RUMA7/4-157                  .............................-IVGFILITSAGVIVGENAVLGL..KKRENELRELSGLMARIDIYLTSCCLDTTELFGRIS...........-SE.GG.......CYDRL..FSSVEEDI--..-.........-TESVSYRIRTS----...---....-GLE--MCDVLADHIAKFGCTDLDGQLAQNALIRCDVDAALEDACKRRIKYTGIYRAV.GVSAGLTAALLMI..........................................
R6QGT5_9FIRM/35-140                 mvllkttnpetekifdllnnseklkdidl-----------------------..------------------------------------...........---.--.......-----..----------..-.........-------------NNI...ISS....SPLKREENEKIYDYINSIGKYDSQTQINEANEFCETFRILKDYYQQYYTAHYKIIYAL.GLGIGCLIAILLI..........................................
R6S2Z2_9FIRM/3-172                  .............................KFLGSLFIVSSMTGIGIWKAEEV..KHSYQALGKIYHLIGMMKNELSYAGSEFGEMFECLS...........KKV.DA.......PYRNW..LLGMKIQMER..R.........DGKTFSEIWEDNVNGF...LKE....SGLGMEALNHLKMLGRNLGGADRQMQIWSMERYLKQIELQMDEMRKDIQMRMKVRICL.GASAGILITIFLI..........................................
A0A024P6N4_9BACI/2-169              ............................q-WIGAVIILTVTTWAGFDMASRF..KKRPGHIRQWKNALQMIEAEMVYGQSSLLEVCENLS...........THL.PK.......PIQSF..FVGILKE--E..G.........VWDDFFSLWSTQLKKH...WTM....NAMTKNELEILMQFGRTLGQHDLEQQQKQIQLTIHHLDRELHDALEVGDQYQKMAKGM.GVLSGLLVIILII..........................................
K8EK41_9FIRM/3-172                  .............................KFIGAAAVLLSCTLMGLLVAGSY..SRRPVEIRCLLNALQMLETEVTYGATPLPEALAAVA...........ERC.DP.......RVALL..FNRAAQELLT..M.........RGLTAREAWEAALREF...YPG....SALTNSERAILLELGNSLGISDRSDQVKHLVLAKEQLKLEQAKAEEASLKNSKVYNYL.GFLGGLTIVLILI..........................................
R5E6Z4_9CLOT/6-130                  .............................KIAGTLFVLGSSGYSAYALNGKI..DQRKAELRRLYSILLQLKSEIQYMGNPLPLSFEKMA...........EQE.QY.......PFSVW..FGQMADRLQE..K.........EKVQFADLWEEEILHL...YEI....SALKREDLEPLLSLKEKLGGIDK-----------------------------------.-------------gqa.......................................
R5JZC4_9CLOT/8-177                  .............................KMAGILCILIAAAGLSAGNNRRL..HRQVREIRQLQQLLQLLQGELEYQCAALPEAFRRCA...........AHL.QG.......ECAIW..MQRMGQRLEE..Y.........EGLGFQEIWEQELERF...YGN....TVLSEECLMNLKQLGSQFAFVDRDTQLRGIRLCAMRLEEEESRLTQELPRKLKMGTGL.MLLAGCFLVILLI..........................................
A0A0H4P1T1_9BACI/2-170              .............................KWIGAILILGSACWFGFEQAKQL..ADRTKQLKMMIAALQSLEAEIMYGHTPLHEAARKIG...........HQF.GF.......PVSQL..FLTFAETILS..-.........TEISVDEAWKNSLHFI...RNK....AAFKRPEYEIIEQFGGSLGKHDLLTQQKHILLTLAHLQREEEEARENQKKYEKMYKSL.SILVGLLLVLLLF..........................................
R6PVL4_9CLOT/3-172                  .............................KIIGAILIILASGGIGVTKGLEL..QKYLRELELLKQLFWMLKREIQYTKAPFSEAFSHIG...........RRM.EG.......AQGEW..LLYLAEQIEE..K.........AGATFFELWTESIDRC...LIK....SQLKNKDKEELKAIGMQMGYLDEQMQLGTIDLYLEQLSFVIQKTREELVMKKRLCNCL.GVMGGIFLVIILI..........................................
W1SJW1_9BACI/3-171                  .............................KLIGAIIIIVATTWTGFEAARNF..SDRPKQLRALRSALQSLEAEIMYSHTPLHEAARRLA...........AQL.SK.......PLSLF..FEAFGKKLT-..D.........TETTVKDAWETSLKEV...WKS....TALKQGEFEIMKQFGETLGRHDRFSQQKHIMLTLTHLEREEADAIDRQAKYEKMVKSL.GFLSGLLLIILLF..........................................
B2TRQ2_CLOBB/3-172                  .............................KLVLIFMLFVTASYIGFLYGETF..RKRYIQLKEILKNLIILQNEILYGSTPLPEALSNIQ...........KKT.MK.......PISTL..IGNVNEKLCE..G.........EAESVYSAFSSEYALL...EEE....FYLSNSDKNFLIDFIKSLGESGLYGQEKIFELVIENVRSNLKEAEEESKKNIKVYRYL.GICIGAMITIFLI..........................................
C7H7R4_9FIRM/5-151                  ...........................rw--LSVCCFVVCGWCAGDSFHQQA..QAHLEALRKTLDLLETLHQEISFRRSDLNLLCRKLI...........---.--.......-----..---------Q..D.........GQLPPETVSLQTLEPF...---....PSLTLEERTRFSECFSGLGRLEAEQECRRLELYQAQFQAALQEGEAAARTQSMLSHKL.GLAVGLAAAILL-..........................................
E6U545_ETHHY/1-162                  .............................------MLFGVCTTAGLLKSASF..SKRVRQLEGFTGALDSIATEIRYFAAPLEDIMAKCD...........ALP.EY......gELRV-..FGLCRKI-F-..M.........EERDFPAAWEKALGQA...KPS....LALDAGDHEALSWFGRVLGTTDVDGQTANCARYGELLRQRLERAREDRARRGKMYTSL.GVLAGIFLVVILF..........................................
R6RQG1_9FIRM/6-175                  .............................KICGIAFIVFSTSAYGWVLSRDL..KRRLLELRELKKIMFLLRGEIGYGMTPLLEAAGSIA...........QRV.TA.......PFNGI..LVSLSNRNSE..I.........KECPFGQMWEEEFTKG...LVM....SHLSAAEKERLVALGNSMGLSDGRTQQNVIDAYMQEVETAISDMEKCLPAKTRLYRSL.GVMLGVVISIIII..........................................
R5B586_9CLOT/4-166                  ...........................gl----AAAALIICISMGYMACSRM..RDRVDKLNALCAEIRTLGDSMELSQYRLSEMLDRLG...........---.--.......--GEL..WREYTAALT-..G.........EQLGAGEAWAATVQKE...ADGg.slSGLDKQDIAALITLGEAFSSISRAAQADHARLTLRQMEARAADAEKALMGKGKLYSTL.GVLAGFAAALMMI..........................................
R6EGF6_9FIRM/2-166                  .............................KILSLIAMGLACTMIGRYIAYKL..SRRVRILEKIALMLEIAENEIQFLNRPTFELIELLS...........KKE.EL.......AELDF..LQRCLDNVN-..-.........DGRDINDAWAQAIHES...---....ESVGGEDTCILYSFGESLGRSDADGQIASCRYHERLTQERLIEAREKRKRYASLACGL.GMLSGIGVFIILF..........................................
N0AW00_9BACI/3-171                  .............................KIIGAVFIIVATTWIGFEASRHL..SERPRQLRLLKSALHSLEAEIMYGHTPLHEAARRLS...........TQM.AK.......PLSWF..FESFAGKLTS..-.........SETTVKIAWDESLNEI...WKL....TAFKQGEYEIMKQFGETLGRHDRVSQQKQIMLTLSHLEREEVDAYERQSKYEKMVKSL.GFLSGLLLIILLM..........................................
G9YNK0_9FIRM/3-170                  .............................KLIGALLLAGGAGALGCSAAAQL..SRRVAVLRALLGALEGMEREIAFRLTPMPELLERAA...........AES.PP.......PVCTL..FARCRTLLDE..L.........GERSMAELWREALEQV...--P....LGLDGPGRLALEELGEVLGRYDGDGQREALAHTRAELSRALEQAREAREKQGRMYQVL.GITAGAFLVILLL..........................................
V9WA33_9BACL/3-171                  .............................KMLGAVLVLGAGTLYGFVQAMHY..ARRPKQIRQLHQALQRLETEIVYGYTPLPEALLSVS...........MQI.NE.......PLSSM..FAELGGSLA-..R.........EERTVREVWEGTLRKY...WGH....SSMKSVEFQAMLQLGYTLGLSDREDQVKHLKLAAAQLHAEEKQAADEQKRYEKMWKSL.GLLMGALVVILM-y.........................................
R6R0I7_9FIRM/5-152                  ............................r-LVGTFFLVVCGWCAGDAVCIRT..QEHLEALRQTIALLEEIEQEITFRRADLNMLAKKLQ...........---.-R.......EH---..----------..-.........KLFCSAKMIQTAIPP-...---....QSFSPQEAACFAECFSALGHTEAEQACSRLAFYQERFRSFLQQQEKAAQSRLVLAPKL.GILLGLTAAILLF..........................................
F6DUB5_DESRL/3-172                  .............................KLLGALMVIFSCSLMGMTVASNY..RRRPGEIRALQNALQLLETEISYGATPLPDALTYVA...........ERC.DQ.......RVSPL..FGGTGRELLT..M.........RGKTAREAWAMALEEY...YPR....SALNRSDRTVLLELGNSLGISDREDQIKHLSLAREQLKLEQAKAEEDSARNTRVYHYL.GFLGGLTVVLILI..........................................
R5V793_9FIRM/3-166                  .............................KGIGLLCLVLCGGICGFLAANRI..RQKQEQLVHLAAFLHELEIRMWCHGGTLQELFQQLS...........EQE.TY.......QTFSF..LSNTLIA---..M.........QQVSFTEAWKTSVQAD...---....KELSPDSQQMLCELGEELGISDLYTQKEILERYRSRMQQMEAEQRETSRKKIRLYQSM.GLLAGMAVAILL-c.........................................
R7A9L2_9CLOT/1-70                   ............................m-----------------------..------------------------------------...........---.--.......-----..----------..-.........----------------...---....--LGTEEWELMCRFGNSIGYLDLEMQQKTLALYLEELERAIEQLRREEPEKKRLCWEL.GILGGLFLAVVLM..........................................
R5R841_9FIRM/2-169                  .............................KWIGFFLVLIGSGGIGFSLVLEY..TGRLRELTTVRQMIHYIADAIIYDGLPLAEAFFRCS...........MRM.EG.......AYGAF..LEKTAQQIET..F.........CGEDPAWLWKSNAAML...--S....DRLKKKDWEKFADCMAQTGFSDPGGQVQVLRLYEEELSDQIIKLEKQKEEKCKLYQTI.GIMAGVFICILLF..........................................
A0A0N0E9T5_9BACI/3-171              .............................KLVGAVLILVATSWAGFEAARHL..TERPRQLRQLKVALQSLEAEIMYGHTPLADATKNIS...........KQL.EK.......PLSWF..FESFAHKLDK..-.........ASLTVKEAWQESLDDV...WKN....TAYKTAELEIMKQFGETLGQHDRYTQQKHIQLALTHLEREELEARDKQNRYERMVKSL.GVLSGLLLVILLI..........................................
R7IEQ3_9FIRM/3-163                  ........................rllfp-----ICAALLSTLAGLHLSTHL..RQEEQRLARWGEVLPHLHLLMASCAYSLPEAFRLCA...........-DG.NH.......PPDTL..LRQLADALER..Ap......lsSPGALTDRLCPAISE-...---....-------KDIISRMMHLLSRGSLESRLLAVENARQEVTLMHEKAARKADKDARLYQTL.GWIGGLCLLLILM..........................................
A0A0A2U025_9BACL/3-172              ............................n-MLGAVIILLASTLAGFYKARQY..ALRPRQLRELIAALQRLMTEINYGLTPLPDAMGKMG...........AQT.KE.......PVRTL..FLHAARQMEP..P.........HGHTALESLQSGIEEA...WGR....SAMKADEREVMLQLSFSLGTSDRQDQTKHISLAIQQLMHEESRAQADQMKYERMCRSL.GMLVGALIVILI-f.........................................
R5YYR7_9FIRM/4-174                  .............................KFIGAAFLIVAGCMSGKEISSNY..LNRLRQLEEIKKTIIFICGEIKYNNSNLDYVFTKIS...........KNS.KE.......FIKEF..LESVVKDLNG..N.........TEREITDVWCENVEKK..iKTK....TSLEASDLNDLKDMGNLLGITDKDTQINNMNLYLEKIQLQIDKLEKEKDEKCRLYKTV.ASMFGLLIVITII..........................................
Q67N97_SYMTH/4-173                  .............................KLLGAALTVLAPSWIGFQIAARY..ARRPAELRGFQNGLAVLVTEVEYGATPMPDALRSAA...........RAS.GP.......VAGAV..LADAADRLEG..G.........GGITPGEALAAALEER...RGA....TCLTPADQEILAALVPVLGASDRRDQVRHLRLALERLAAAEAEATDERRRYEKMYRYV.GVLSGLALVLILI..........................................
R7JTR0_9FIRM/2-171                  .........................rlav----LLAASLACVGIGFAKSAAL..SAHVKDLETLQKIIQYLRGEIVTAASPLPDAFWETG...........RRM.RD.......PYRDF..LQDISEDMRR..P.........DGKTLPAILEENTAVH...LAD....TRLTKEEKEELQEAGCSLGTGDRAMQKVNLDRYEARLVQRIAELQKGLPERKRLCQSL.GIMGGLFLFLILV..........................................
R7C531_9CLOT/4-172                  .............................KFLGMIFVLLGSFGIGIFYRIRY..GNRLHNMQDCERALLILQGEMEYGHTPLMEACEEVS...........VRI.GG.......IVGSF..FAQIAKKLNT..-.........HEGALETIWCQTARKV...LTK....SQMEKEEREEWEKLGGTLGYLDLEMQVSTIQIYVRRLKLRMEQTEKESHERLRMYPVI.GAFSGVLICLLLV..........................................
A0A0E4CY64_9BACL/3-172              .............................KLFGAVLIVLAGTLAGFKRAAQY..ADRPRHIRGLIAALQRLETEIQYGYTPLPEALRRIG...........MQS.KD.......PLKAF..FTTAADEMSP..P.........LDRSAEAAISKAMEEH...WKT....ASLKGTEKEILRQLSCTLGTSDRSNQSTHIALALQQLKQEETAAREDQGKYEKMNKSL.GLLLGALIVILI-f.........................................
D9RXK2_THEOJ/4-173                  .............................KILGAILVIFSSTMIGFIIAGYY..QQRPRTLRNLQQALSMLETEIDYGQTPLPEALKNVS...........RSC.DP.......EISKF..LERVRQLLLS..I.........EGFTAGEAWEKSLREF...RSQ....FPLQESDFEILTSFGKYLGSSDKDDQIRNLKLTLSQLRQQEVLAVEEKQKNEKMWRYL.GVLTGLTVVLLL-y.........................................
R5AZ05_9FIRM/5-70                   ............................h-WLGAALLFLGSTAAGFALRQEL..RLRLRLLTAVIDSLNLLRSDIVGCCAAISS------...........---.--.......-----..----------..-.........----------------...---....----------------------------------------------------------.-------------avccrcrrrcaiw.............................
R7IT11_9FIRM/2-171                  .............................KMAGAVLVLLAALGIGFQNAARI..RKSYEELVYLKKIMIMLRGEISYQISSMEEICIHMG...........EHT.RE.......PYSRA..FQNLAEALGS..G.........EGGNFSPMWNETVIKT...LRQ....VIPQENDLDRLKELGENLGYLDKEMQMNYINLYLENLELSITEKGEKVRTDEKLNKIM.GCVMGLLVIVLLW..........................................
H6NL71_9BACL/3-172                  .............................KLLGAALVLLAGTLMGFHQAAQL..ARRPKQIADLIRLLQRLETEIVYGFTPLPEALRRTG...........GTC.AA.......PVGTL..FLETSRELER..A.........EGEQAAGVWERTITRG...WRA....TAMKPQEREVLLQLGTTLGLTDREDQVKHLRLAVSQLQAESETARDEQQRYERMWKSL.GVLLGALVVILM-y.........................................
R5IDE5_9CLOT/4-176                  .............................KWTGGLLILFAGSGMGVWLAWGY..KKRLSTLENLRRMIYCLKGEIVYSHAPLEEAFERIG...........KRE.KG.......VLGEL..FTQTAEKIGC..H.........NGETFSKIWEQTIEEM...EKNg.ksLFLEKEDREKLLSLGGQLGYLDTQMQERTLLLYLEQLELSVSRLRGEIREKCRLSTVL.GVMGSLFLVIVML..........................................
I3VWP6_THESW/3-171                  .............................KIVGMVLVLISSAMIGYMKALKY..TLRRQTLRSFLSSLNLLITEITYSQITLSEAFAKLS...........ETS.ES.......GVGRF..FLLVSRILNS..N.........EGYTAGEAWEIALDKV...-EN....INLSQDDIKILKSFGKGLGNSDIYNQEKNFKLASELLKKQLTDAEESSRKNERLYKSL.GILIGIAVVIIFL..........................................
R6U904_9CLOT/1-144                  ............................m----------------------I..KRRIRLFNTLALLAGNVSAAIRYSGDDITKILLQEG...........LLL.KL.......---DF..IKNAVSCVE-..-.........KGEALEKGWQESVDGI...PVF....CGITKEDRALIKQFGSKLGTTDVYGQTDHCEYFKELFHSRASKLAQECVGKSRVYRCL.GFFSGAAISL---avi.......................................
A0A0M2SKV4_9BACI/3-171              .............................KLLGAALIITATTWTGIEASRHF..SERPRQLRQLKSALQALEAEIMFGHAPLHEASRKIG...........NQL.TE.......PVSSI..FATFANKLES..-.........AETTAGAAWEESLKLT...WKD....TALRRGEFEILKQFGETLGRHDRYSQQKQIILTMTHLEREEADACDRQLKYEKMVKSL.GFLSGLLLIILLM..........................................
D4JTI1_9FIRM/7-167                  .............................-IVIFLLITLSGGATGMYFSGRL..SERCRVINSYISLVQSMNCYIGFSGYKLAEIFRAEQ...........KSS.GC.......YISDK..LVELSE----..-.........NGGDISDEWDICVSKS...---....GYLKEDDRQILSELGRTIGKSNTDGETAVLALAGQRLSFQLKTAEEERKRKGRLYTTL.GIMLGAAVGIMLI..........................................
R6LSA2_9FIRM/3-176                  .............................KMAASLLLILGGAGIGYARSREI..TEREKNLEILLQILFFLKGEIRCGNSSLPDAFREIA...........AKI.SG.......PFEMI..LRDAAQEMED..T.........GGKNLEEIMESCIQRN...FYQgnpgGSQRKEEMEILRTLGRRLGYLDREMQIKQIEFLETDVEEQRRQLREKMPEQKKICQSL.GIMGGILLAVLFW..........................................
Q97HC0_CLOAB/3-172                  .............................KFVGCILIITSSTIVGFRYAEHF..RKRVKELKEIHNSLYELRNEIIYTHTPLVEAFKNIS...........DRS.NY.......PVNLF..FKLAAENLCY..K.........ETDNVYSAFKCVFDTD...KFQ....TNLNNDDKKILLNLSKSLGETDIEGQVKVFELAIKNIENHITEAEEIMKKNVKMYRCL.GFCVGAMITIMI-v.........................................
U5LFJ2_9BACI/3-171                  .............................KIIGACFIILATTWAGFEASKHL..NERPRQLRQLKSALQSLEAEIMYGHTPLHEAARRLA...........AQL.SK.......PLSWF..FESFSKKLT-..D.........SETTVRAAWEESLKEV...WKL....TAFKQGEFEIMKQFGETLGRHDRFSQQKQIMLALSHLEREEADAYEKQAKYERMVKSL.GFLSGLLLIILLI..........................................
R5FJL2_9FIRM/3-166                  .............................KVIGGGLLCLASGYVGIQIEKRY..KERASFYEDFKSYLEFSENRISAFKSPVTEILKEYR...........-NV.EK.......KSKEF..-SRMISEV--..-.........-EHAFGAAGGREKISA...ITS....KTLKKSDVKLFCDYFKNVGKTSLTDELNLLGAVKNIAAENLKTAKNETEKKGKMYFKL.SIVLGLAAMLVV-i.........................................
D4K6A0_9FIRM/74-154                 ...................ggtlqqlpap-----------------------..------------------------------------...........---.--.......-----..----------..-.........----------------...---....WQLSAEERACFAECFSGIGRAETAQECERLGYYTARFEDYLQQARRTAQRQAGLPHRL.GLAGGMMLALLFW..........................................
A0A089LXB1_9BACL/3-172              .............................KLLGAILILASATLGGFTAARRF..AQRPRSIRGLIAALQRLESEITYGYTPLPEAMGRIA...........AQS.LE.......PLRSL..FLDIADDMGD..P.........HNRTAREAVERAVRSH...WQA....TAMKAPERESLRQLSFTLGVSDRQDQANHIALALRQLAQEEQTAREEQAKYEKMSRSL.GVLLGALIVILI-c.........................................
R5E180_9FIRM/5-176                  .............................KITGAAVVLMSSFMLGMYFVVVN..KTRIKNLADIDETWRTISAEIRFQSGSLPEIFKRFA..........sHEY.SF.......GIKAL..YKDVYENMVV.dS.........EKAAFDIIWRESVRNN...ASK....SCFLREDEEFLMQFGNMPVHLDIQTQTDFVNHMISMLDDRIKKAQDKTDSQCRIYRCM.GIAAGVFLVLVLI..........................................
W0EEB0_9FIRM/3-169                  .............................-ILASIILILGCGSLGLYLAARI..KKRPVELRDFITALTLLDTEIIWGGTPLPEAFALLK...........HRS.EG.......AWKVF..FAELERRVQ-..-.........EGESANTAWSETIRIQ...EKR....FCLKSEDWQVIQNVGKGLGRSDRQEQHKQLELVKQQIRDVQEQALIMCDKQAKMWSYL.GFLGGIAGVIFLI..........................................
D5X7K6_THEPJ/3-172                  .............................KLIGAFLAVAACGGIGLTVAQHY..IQRPKQLRAMLSALQMLETEIVYGATPLPDAMENVG...........RNC.DE.......KIARI..FLAARDFLCS..A.........EGLTAGEAWHLAVEKY...GYD....LAFIREDLSVLKRISGFLGCSDRDDQSKHLQLTREQLRYEIAKAEAAAQSNGKVWKSL.GFLFGLVLVLM--vy........................................
A0A0F5IBG9_9BACI/2-170              .............................KWLGILLILTASFWIGMEQSRKL..SDRTKQIRLLRTALQSLEAEIVHGFTPLHESARKLS...........ERL.PQ.......PLSEL..FASFSELLMS..-.........TEWDAKEAWKASLNQV...WPR....TALTQNEWNILIDFGETVGKYDRLTEQKQIAIAMSHLEHQEEEAREKQRRYGHMIRSL.SWLGGLLIVLLLF..........................................
A0A0M3DK21_9CLOT/4-173              .............................KIALISILVACSYLIGEYLYKAY..TKRHKQLNELIRILEVMRMDLSFGLYTLEEIFYRIG...........ENK.EF.......SLGSF..FKHMSIDLKE..D.........NSKTLETILSKNADFM...IKE....SYFQDKEVDELKKLILTLGKGDVYSQERMIDLSIENLKKLTTESKEDVEKKGIVYRKL.STIIGLVIGILLI..........................................
R6WPP3_9CLOT/4-166                  ..........................vls----GALLMAASSLIGIAIKRIF..RVRYAYFSDAVDFLNLYKREISSLQTPLEDVIKTFV...........SSS.KG.......AFSDS..LQKFADGLPA..-.........GYKNVEE-----VQKT...IKN....VMIKEKDSLLVAAFLHSLGKSNLENEITNTVRYLDVFNEKKSKSAIELNKKGEMYYKL.FVVLGVTLMLIV-v.........................................
R6P931_9FIRM/4-171                  .............................KITGAVLIIITSCIIGYLLSIKE..DLRCKDLTEIEKILQNIFSQIDYKKEVLTVAIDNSI...........ENS.NI.......YIKNI..FEQISTAIK-..-.........NNTSVSTAWRVSFENN...YQF....TDISKEDATKISALGEVLTSGDIDFQEKGFKGAITYIHNTIQTSKEKSLKDKKIYRCL.CSSLGLLIVILLF..........................................
R6GID0_9FIRM/4-161                  .............................KLLGGGLVLLGTALLCRAETRTR..RQQTERLTELSAALSEMAAGIRSLRRTLPCLLRQQT...........RRP.LC.......--GAY..FGAVLEGLE-..-.........SGQPLPDAWADAFRQL...---....---EPPEAGRVLRDTELTG--DEERIVSALTSAACRLDRLADTRRRDRRQQERLLWTAaLSGAGLFIILLM-..........................................
E9SG86_RUMAL/3-157                  .............................KFIGAVLVTAAGAFAGEMEVCRL..KDRVIQLTELVELLEQIQLYLSAYGASTEELFKMLS...........SKQ.GE.......-YHSC..FQT-------..-.........SSSELTQEVCAALRES...---....---SLEMKDALADYIYDFGKTTLDGQLQKTSILMSDVNAVLRSVKEKCEKNTKLYRAA.GFSIGMMAAVLLI..........................................
A0A0F2PIV7_9FIRM/3-172              .............................KLIGAILLVSACGYAGWHVSRSY..ARRPVELRQFMTALQMLETEITYAATPLPDALSGIA...........ERV.DA.......RVSSF..FAHAAKELQT..T.........RGTSARQAWSAALDRY...RTG....STLDRGDLGILNSLGHNLGISDRDDQAKHLRLTLEQLKMAQARAEETASKNVKLWNYV.GLLGGLIIVLAL-y.........................................
R6WDE6_9FIRM/2-161                  .............................KLFGAFLLVTAGFAAGNLAAKAK..KDTLDRMEAVAGLISHLLRRIESSNTLLFDAINEYK...........SDM.LK.......KCGFY..--TAFDG---..-.........GRTSVNRAWQNAVYT-...---....LSLPPEANAVLLSLGDGFGLMCREKQLEALKRTQSGLETLISAAAEKLAKISRCYGLL.GALAGLLAAILI-a.........................................
A0A0M2PRE6_9BACI/3-171              .............................KWMGAILIILATTWAGFEMAKHF..SERTRQLRQLKVALLSLEAEIMYGHTSLIIAAQNIS...........KQL.PK.......PLSMF..FEDFSKKLVK..-.........GHTSVKEAWEESLQSI...WRM....TALKQGEFEVLKQFGETLGQHDRISQQKHIKLALSHLQREEADAIDRQNRYERMMKSL.GVLAGLLVVILLM..........................................
Q65HH7_BACLD/3-171                  .............................KLLGAVLILAAATWTGFEMAKPF..RERPKQIRQLLAALQSLEAEIMYGHTPLRQASKQIA...........HQL.TE.......PVASL..FQTFAEQLEK..-.........GSASAGTAWEDSLEKV...WPE....TALKKKEYEILRQFGETLGRHDLISQQKHIKLALTHLETEEAEANLAQAKNEKMVKSL.GFLTGLLLILLLM..........................................
C0GE42_9FIRM/4-174                  .............................KWLGALLILGAAAAWGNLQAAQL..RRRVKELEEFRLGMRLLAAEIGYTSTPLPRALEHVQ...........ERL.PG......gGVSVF..FTRAGELLRN..P.........EVADANAAWSRAADEV...KEE....LALTREDWPVLLRAGAGLGSMGRENQIKQLEAAEVQLASHAATAAARCESGEKMWRYL.GVMGGLAVVILLL..........................................
R5A8B3_9CLOT/1-129                  ..........................mld-----------------------..---------LKALLQGFQTGIRYAAGSVAELILERE...........---.EC.......P----..FCRLAER---..-.........DGEFLLD-PVDALSRA...GEC....LLWDGGDLEWYRGFVAGLGVSDTQGQLEHIGLYRSLLEPRLAQAQEEAKQKTKIFIAV.GLFAGVTLSLLLI..........................................
D9R8Q1_CLOSW/7-176                  ............................r-IVGAVLVILSSSGLGFFMAAQW..NEHLKTVEKLRKMIFLLKGEIVYANSPLPEAFERTG...........KKA.VG.......ELGAL..FENVSERLSG..Q.........QGESFYTIWQEEIDKL...PGE....VCLSKEDKQNLKGLGEHLGYLDMDMQERNILLYLEQLDLTIGYLRKHKQERSRLYTSL.GIMGGLFLTIVM-y.........................................
C6J3S9_9BACL/3-172                  .............................KMFGAALVLLTATMAGWLQARQF..AARPSQIRRLILALKRLETEIMYGFTPLPDALRRIG...........EQS.GE.......PIRAI..FVRAADHMSS..A.........HPLTAQESLEQAVTKL...WSY....TAMKAPEQEVIRQLSLTLGTSDRKDQLGHIATAVRQLESEESAAREEQARYEKMYRSL.GLLCGAFIVILF-y.........................................
C4ZD12_AGARV/5-141                  ..........fmlllekgafylagermka-----------------------..----------------------------PQFFNSIR...........GKS.EV.......-FNEG..CRRMGEVLSN..R.........SCKSGEEGWKAVWEKV...LWG....RVSDEKINKMIVEMGGAFFEKNAAAMEQRLKECALDIHKQIDFYRKDYVEKMKVICPV.GILGGIMISIMLI..........................................
F6B9Z4_DESCC/3-172                  .............................KLLGSAVVVLSCTLMGMTIASNY..SRRPGEIRALRNALQMLETEISYGATPLPEALALVA...........ERC.DS.......RVARL..FRRASEELLT..M.........RGVTAREAWETAIADY...YPK....SALNRCDRAILQELGNALGISDREDQVKHLVLTKEQLQMEQAKAEDASARNTKVYNYL.GFLGGLTIVLILI..........................................
R6GQG8_9CLOT/3-172                  ...........................ry--LVLVCIFIICSYIGFVIGENY..KKRSVNLKEFQKAILLMNNDVIYTNIPLMEALYDVS...........EKV.SG.......ELSQM..FREIASTLEK..G.........EANSVFDIFNNIYGKY...END....LSFKKEDYSIVSDFFRTLGETGVFGQEKIFKLASEQVKLNYQEALKEAKVNIKMYRTL.GVCAGALIVIFFI..........................................
D4KWV7_9FIRM/3-172                  .............................KLIGGILVAGSGVGLAVNMIAEI..RQHLLRLYEIRQLLINISGEAALALLPMEHILNQPT...........LTN.DV.......VLQKV..CGQIADRLAA..K.........KGESGGEIWWDIFWKN...RKE....LGICASELEIIANAGNAFFGRNIKENERMLSIYLERLDFVIEQERKEQREKQRVAGAV.SVIGGMMLVILFI..........................................
R6M5Z4_9FIRM/3-163                  .............................KILGAIMTGFACGYLGFKISFAM..KIRAESLNNIITSLEMLESEINFSMNKLKQAFMRVD...........-K-.--.......--CGL..FKFAAENM--..-.........DEKGVKTAWTNAVNEC...STK....LSLKDADKDILMTLGKNIGRTDTDDQIKNIKYIKSMIAEQEKQAQSEYRRFGKMYRNG.GVLVGLLIVIMLI..........................................
R5AL47_9CLOT/3-171                  .............................KIFAILIVFFACTAFGARSAARL..RQRATFLAALETALRRFLLAMEYEKKPLER---LAS...........KRV.YG.......EAQPL..FDAFAEALS-..-.........AGARPEAAMRQAVQGT...KDGarawLPLGDAEAALLSEFAAIVGTPSAGRYAEGAEPVLQRLHTAVEAAGAEERGKGRAYRAT.GMLSGAAIAILML..........................................
R7QX72_9FIRM/3-172                  .............................KVIGCTLILAGMTGYGVSSVCCM..KRHLEELVEYKEILYALLGEIQHYRKPLAEAFDTIA...........KKR.SE.......GYRQV..LEMIAARMKK..F.........EEANGSEIWKDSFLSY...NRK....FLFSREEEEIIQKSGHFLDAPDMESQKRELELYEAQIDYRIAEIQKTIGGKRKVCMYG.SVLGGLFLIILLI..........................................
F4LVG6_TEPAE/4-173                  .............................KMIGGATVVISCSIIGFIIADNF..KYRPKTLRDLQVALSMLETEINYGHSTLPEALRSIS...........RKC.EK.......DVAEL..FVLTTNNLAL..R.........NGFTACEAWEKALNKF...YSN....SYITKNDYEILIAFGKYLGFTDKKDQIKNIKLTVDNLKQQEILALEEKQKNEKLWKYL.GILSGLMIFLLL-y.........................................
G2SX17_ROSHA/3-172                  .............................KIMGSILVFAAAAGMAGTYKREL..ADHLALLYALRKLLVDLSCYGNGTRQPVEVLLGCFV...........RTP.DE.......RLNEI..CRKIADCLIE..K.........NEKNGEQVWKRVFEEY...RKK....LCLTGEESALIGEAGGALFGRSEEENHRRLTLILEQLDDRIKTVRGELGEKQKIYATV.SMVMGGMLVILLI..........................................
A0A077J4C1_9BACI/3-171              .............................KLIGAIFIIVSTTVIGFEAARHL..SERPRQLRALRSALQSLEAEIMYGYTPLHEASRRLA...........AQL.SK.......PIATF..FESFSKKLT-..D.........SETTVKDAWEASLKDV...WKS....TALKQAEFEIMKQFGETLGRHDRFSQQKHIMLTLSHLEREEAEAIQAQGKYEKMMKSL.GFLSGLLLIILLF..........................................
Q8XJC8_CLOPE/2-171                  .............................KVFFLLIIVLLSSLIGYLYGEGF..RNRLSQLRELKRALIDFENDIVYTYTPLPESIESIA...........LKA.KS.......PIKEL..FNEISFKLKN..N.........EVENVYMAFKESINEH...KKE....MNLRNKDFEILLDLSKSLGETNVEGQIKIFNLAKEKLDIELEIAEDECNKNTKVYRYL.GVAVGAMIAIFLV..........................................
A0A075JPU8_9BACI/3-170              .............................-WVGALLLVGTTTWMGFEWSNRL..EKRPRHIRQLKNALQILEAEMIYSQSPLKDAFTVIS...........KQV.PE.......PTRTF..FAGLDDFLN-..D.........NNKDLFIVWNNAVNKL...MEV....SSLDRNEKEILLQFGRTLGQHDFVQQQKHIQLAVGHLDRELEEARDNYLKYSKMAKSL.GFLCGVFIVLLLI..........................................
A0A0D8IDS1_9CLOT/4-173              .............................KLIISFIIIGCSSLIGIIYANTF..IERTKLLASVLSTLQMLETEIVFSATPLPELLSKVA...........RKS.RT.......EMGRI..LENTAEILRR..N.........EGYLFPEAWKKAIEGV...GDE....TVFAKEDLDLLLNLGNTLGISDTSDQVKHIRLTMEEIKRNYELSIIVQSKSVRLYRNL.GFLVGITIVIVFF..........................................
SP3AB_BACSU/3-171                   .............................KLLGAVFIVVATTWTGFEMAKIY..TERPRQIRQLRAALQSLEAEIMYGHTPLHTASQQIA...........KQL.AQ.......PVSTL..FSAFSDQLDK..-.........GSDSAKTAWEQSLKKV...WDT....LSLKKSEYEVLKQFGETLGIHDRISQQKHIKLALTHLEASEADAEQAQAKNEKMIKSL.GFLAGLLLILLLM..........................................
R5BU12_9FIRM/3-172                  .............................KGIGMLLILLSGAGLGFSSVFQM..NRRLRELKNLRRMALLLENEIGCAHTVLAQALERTG...........RKL.DG.......GCAVF..ARGLAKRLRS..G.........SGSSMEVMFREQAEEY...TRN....WELSQRDFELLCQLGMHLGRESRKVQIEQLQLFEKELEQEILSFEKTMPAKQRMYRSL.GILGGLFLAILV-f.........................................
R6LJ97_9FIRM/4-172                  .............................KMVGCLGIVAATSGYGYSRGMEY..QRQITDTGELQRVIRQLAGEMEYTYAPLAQVCASVS...........RRC.SQ.......NYRIW..LEHLAKELE-..M.........PSRSLAIIWERCCESD...LEC....LLLGREERVRLHELGMQLGSLDKKQETQIFLQYAEFLEEKRGGLLKEIQEKRRLCNLL.GVTAGLFLTILIL..........................................
F0Z5K1_9CLOT/1-162                  ............................m---------GATTGAGIAYGTEL..QRYLEKLLYIRHIVYMLKGELEYSNAPLGEIFGRVA...........VRV.KE.......PYRKW..LRVMERQVEE..R.........EEDEFAKIWNRSIDRY...LGE....IHLKSAHSIQLKELGTFLGQLDGDTSSRTMQLYLNRLELEIEKVREGMAAKKRIGNCL.GVMGGIFLVVILI..........................................
R6N5J7_9CLOT/1-160                  .............................------MIVLTGAAVGYLQSKRL..TARTLFFEEYQKFLSELTLQIRYDSSSLERILEKFS...........--D.YR.......RLAPV..LRICREKIQ-..-.........EGNSFFESWRQGVGKL...SKD....NGLLKGDIELLLDLGKGLGISDLEGQLSHLKLNSELTKLRLEEARECKVKKGKLYQML.GLSLGITTALLFL..........................................
R6KNG9_9CLOT/5-177                  .............................KWTGAILVLFSAGGLGIWSAMQW..KGRLRMLETLRQMIYFLKGEITYSRAPLAEALERVG...........KRE.PG.......PLGGL..FEAAAEGIYM..Q.........EGESLQEIWRRQVMDL...NTDg.grIPLVQEDLEQLAHLGEHLGYLDVDMQERTLKLYLEQLDLTIDYLRQNQREKCRLYTSL.GIMGGMFLVIVMF..........................................
X5A1K0_9BACL/3-172                  .............................KLLGAAMILLAATLAGFRRASQY..ADRPRQIRGLIAALQRLETEIMYGYTPLPEALKRIA...........VQT.RE.......PLRGL..LVTAAEGMSP..P.........QNLTAQEALDRAMKTH...WRA....TAMKIPEQEVLRQLSCTLGTSDRSHQTNHIALALQQLKQEEISAREDQAKYEKVSKSL.GLLLGALIVILI-f.........................................
R6N2U0_9FIRM/6-167                  .............................KIIGCILLVSATTLMGFKKAQRL..YKRRDFINDFLVFLDTLATNIRYSTDELSIILSKSE...........DRF.GK.......----A..IYGAYEK---..-.........YDGTFFKKWKNAVADI...SDG....YALKHEDKQLLCSFGEKLGITDVEGQLKHIELYKGLANAHLDDSKNEIKQKSRLYKTM.GFFVGTAAALVII..........................................
A0A024QBV3_9BACI/2-170              ............................q-WVGALLFICTTTWIGFEWSNRL..ANRPKHIRQVKNALQILEAEMMYSQLPLQDAFHTIK...........NQT.PF.......PIHAF..FDRLYKNMNQ..-.........ESKDFGIVWQNSLDEL...MDI....SCLGNNEKEILLQFGQTLGQHDFLQQQKHIQLAASHLDRELEDASEQYQKYGKMTKSL.GVLCGLFIVLLLL..........................................
B8D2E8_HALOH/4-173                  .............................KLIGSLLILISGSSLGWLIGFHY..LKRIKELKELQVAINIFDTEISYGRTLLPEALEVVS...........EST.HG.......SISNI..YMQLATGLKK..D.........RDKRFRDIFKEILSRY...EEE....VSLTPADIKILIEWSQQIGVTSLEGQRKANKMAIKRLEQVEKRAQDLADKRVKLSRYA.GVLLSLLVIIAL-y.........................................
R6RFZ5_9CLOT/2-178                  ............................r-YIGILMMAGALAAGGFWAADQW..KEKLELLLLFRQMMSYLKGQILYANATLPEALREVG...........GRY.AEgrsgflkEPGAF..FLRVAERLEE..Q.........GDVPFPVIWKEEAERF...PPG....FPLEAGDHKNLLALGENLGYAHKDMQERTLLFYLEETDGSIGFLKREMESRTKLYRCL.GMAAGLFLMVVM-a.........................................
A0A0F0C844_9CLOT/4-176              .............................KWLGSLLVLFAAGGFGVWSAMQW..RERLRLLEKLRQMIYFLKGEITYSHAPLAEGLERVG...........KRD.PG.......PLGTL..FTSAAEGICR..Q.........EGESLQEIWSREVGLLsspKVR....LPLTDEDLEQLTGLGEHLGYLDVDMQERTLKLYLEQLDLSIDYLRTNQREKCRLYTSL.GIMGGMFLVIMM-y.........................................
Q8EQ30_OCEIH/2-170                  .............................KWIGALLLIGTATTIGFEWSNRL..KQRPKHIRQVINALQVLEAEMVYSQVSLQAAFLIIA...........QKS.PD.......PIRLF..FQGMAEQMDR..-.........IPFDFDQIWQEQVSQL...LIN....SALQSSEEEILLQFGKSLGQHDIEQQQKHIHLTKVYLENQLTEAQDAYQHYGKLSKTL.GVLCGLFLVLLFI..........................................
G9RYK2_9FIRM/7-173                  .............................KCIGAILVLYTGAAMGWRKGNAA..MRRVQVLADICAFLGAVRDDLHFRCGRTEEILAAAQ...........QNT.RL......sALPLY..FSDLASGCG-..-.........LQTELDNALCRTEREI...--A....GVTRREERVLLRGALEGLGGCPAQEEEQRLAYAQTQLETALDAARAEAAQQRRLYRTL.GLSLGGAAALLLL..........................................
F6CL76_DESK7/3-172                  .............................KILGCALILLAGGGAGMTMAGHY..ARRPRDLRSLQAALKMLETEITYTATPLPEALGRVA...........ERA.GP.......RVALL..FNRAREELLS..P.........SGRTAREAWESALKAF...YPT....SALVPSDLAVLRQLGPALGISSVQDQSKHLHLAMEQLGVEMVRAEEEASRYVRLWNYL.GFLGGLALVLML-y.........................................
C0EFZ6_9FIRM/3-167                  ............................r-LAGALLLAACPAIIGILLSSGL..SRRRTELLQAIELIERLKTEISYSAREVNEIVRGLG...........EED.CF.......EKLSF..LRECSAQL--..-.........SKMPFPQAWRTAVQSA...--P....TAMSGDDLEQLASISRILGASDAEGQLSALEVVEQNLKRNLEQAQQLCTTRGKLYRSM.GALSGAALAILIL..........................................
F9VKT2_ARTSS/2-170                  .............................KFIALLIIFVCISLIGIILGNGY..KFRVKELQEFEAVFYSLKNNITFMRTPIAYALRESC...........-PQ.KS.......ELSIN..LHKIADEIEN..G.........DFYNLVDCVRRVFEKN...KLK....LYLNQSDLDMIYDFFNNIENSNLNSFENVFCIFTKRIEDQLIEAIEFRNKNKKVYSTL.GIGVGAMIVIFLI..........................................
A8FF26_BACP2/3-171                  .............................KLIGAILIVSATTWGGFEFAKRY..SDRPKQIRQLRFALQSLEAEIMYGQTPLARAAEQIA...........SQV.GP.......PVNRL..FEQFAEKLKV..-.........GTFSARHAWNESLEDV...WKK....TVLKKGEYEALKHFGETLGQHDVASQQKYIKLALGHLESEEKEAEIAQAKNEKMVRSL.GFLSGLLLILLLM..........................................
A0A0F2Q9S8_9CLOT/3-172              .............................KVTGAILVIMAMGTVGLVVARNY..SLRPQQLRYLLNGLQMLETEMLYCLTPLPLALKRVG...........MKL.PY.......PISQF..FLNTSTSLTN..G.........EGITAGEAWEMALGEL...AEE....SALLMEELDILLYFSQSLGVADREEQGKSLRLVKEQLMNMEKKAEELKEKNQKLWQYL.GFSLGAVIALVLI..........................................
A5N7I0_CLOK5/3-172                  .............................KFLGCMMILAASTGIGVIYGEGF..KKRVKQLKEIQRCMYQLQNEIIYTHTPLPEAISNTA...........CKS.VS.......PIKDI..FKDISQMLEK..N.........SVDSVYEAFSHTLKAK...ENT....LNLKKEDTAALLDLSRTLGESDIEGQKKMFLLTLENIKEQIETSQILMNKNLKMCRSL.GFSLGAVIVIILI..........................................
R7K2T2_9CLOT/9-177                  .............................KITGSIMALAGSWGCGMWLAARR..RRRIELLREMEQILIFLYGEIEYAAVDVAELFQILA...........GKM.CY.......-FGSF..FEELCRQFQG..I.........EQETLYDLWKKAIAGS...RLA....EGMDKEDVALWQEVGMQLGTLERKTQLQTLQVLRERLHRQALEAEAEYKAQARVYRLT.GVTGGIFMVILLL..........................................
R6AIN6_9CLOT/3-164                  .............................KLLLAAAAFCICMAAGRVAAEKY..KLRQKTLCGFLSDLKVLEAALKYERTDVKSLALLLA...........--A.RG.......SLREF..WRIMSDELT-..-.........NGAGFGEAWRRHRCE-...---....LMLNEDIGAIADGFAEHFGSNDAETELRRLEGTLKQLSEKEKIQCAIFMQKSRLAVSL.SALLGAAAALMII..........................................
A0A090J2B4_9BACI/3-171              .............................KIVGAICILIATSWIGFEASKAF..TERTRQLRMLKSALQSLEAEIMYGHAPLHDASRRIA...........NQM.SK.......PIETI..FENFSSLLLQ..-.........GDITAKEAWEISLKTI...WNR....TYLKKNELEILLQFGETLGKHDRVQQQKHIQLALVHLEREEVEARERQASYGNMVKNL.GFLSGLFIIILLM..........................................
R6QZU0_9FIRM/3-172                  ............................r-LMGTVLVLFSCTALGWSRSMTL..QKRLGQLREVEKMVHLILGEITYRKETLPEALLRIS...........EKT.AP.......PFSEF..LREVSRQASL..F.........QGDCFSKIFRETAQQC...LKD....SALHKKDLEAFSQLGEYLGWMDITLQKNTITLYQEQLKQEIQYLERELPGRKKMCQSL.GVIAGIFLSIL--cl........................................
R7K6U9_9FIRM/2-155                  .............................KLLLCAVLVAVCGCGGLFLSKKY..KRKERLFFDLNNFCCSFNANLGYERVPVEKLLENNE...........NLF.GK.......DFSQL..----AEG---..-.........--YLLDG--EQAAHS-...---....DILSDSQADKIEQFFGLIGRGDAAAQREAVSAYGEYFRNELKNAENENKSKGNLNRKL.GFLLGVFLSVLV-l.........................................
R6IBL3_9FIRM/1-144                  ...........................ml-----------------------..SLRVSLLEKICIMLRVVRTQLECCCCPVGDVLRILG...........--S.TP.......DLKELvfIPECIKL---..C.........DSEPFPQAWSDSLSAR...KNT....VGLTSSDVSRLVSFGRSLGTTALDGQIANCDMFCADFELRLSEAREKKKKYAKVLPPL.GALAGAVIVI---a.........................................
R6K031_9FIRM/3-175                  .............................KLSGAALIIVMTTYYGFYLAGQL..KERINVIDAYIYSLNYIQSQIKYGLTPLPVICSELS...........KSI.TN......sIVSSM..YEQVYIKLSDitQ.........KEDTFNEIWLSEAKKL...IKS....GIVKKEEISVIKELGNINTYIDRNMQLQCAGNVEYKLKNIYQRLQSEAGTRSKIYQIS.GVMAGIVITIILI..........................................
C6LAC8_9FIRM/3-172                  .............................KVAGMALIIISGSALGVCMSREL..AQRVRWLGELERLMQVLKGEIQYAATPLPEIFPELA...........KRT.EE.......PLESF..FASLASAMEL..R.........SKSTTGDIFAEQAEAL...LGF....GGLKERDVEALVRFGRRLGCPDREQQVQTIRLYQEELAAARAEAQEDYRQKAKVYQSL.GFLGGCFCVLLLL..........................................
G5IBS7_9CLOT/4-173                  .............................KIIGGICVIAATSGLGFWMAGQW..KAHLLAVEQLRRMIFMLKGEIIYANAPLEEAFYHVG...........RKN.DG.......ALGRF..FVAVARRIEM..Q.........QGEAFYAMWKEEIDKL...GND....SGLTGKDRQELAGFGEHLGYLDCDMQERTILLYLEQLDIAIDYLREHQREKSHLYTSL.GIMAGLFLVIVL-c.........................................
A0A0E4C8J6_9FIRM/5-174              .............................KTLGIVFIIAGFGSYGLMGARRI..EKRVEQIKNIRMALGFLEKEITYLQTPLYLALKKTA...........LLT.AQ.......PVKIL..FGESSRLLQD..R.........QGITVGEAWEKALQKL...KPA....CDLNQDDLEILKAVANQMGSSGIKEQIKLFQLIQEELQIQEENARDQMESGRKLWSYG.GFILGTMVVLLLL..........................................
D4LX74_9FIRM/3-172                  ...........................ra--IGAFLVFLASAGMGCQESRKL..SEHIQALEEFLQVIICLKGEIRYGGSSLPDAFRETA...........MHC.SE.......GYAAF..LKAVSEKMEN..R.........QVEDPGRIIQQCAKKY...LKE....NALSAEEQERIAQLGERLGYLDREMQLRQLSLYEDEFERMIQKAKEDAPAKKKLYHSL.GVLGGAMLAILFW..........................................
A0A0B7MGY8_9FIRM/21-190             .............................KMVGACLVIGSMGMAGMKVASFY..SRRSAELRFLQDALQMLDTEILYAATPLPSALKKIG...........QSG.GD.......IIARI..FAEAGELIAA..G.........QGCTVAEAWGKALQKN...WSS....TALNREDYAILYSFGELLGISDRQEQHKNIALTSLHLRKEEEKSRRDQEKNARLWQYG.GFLAGISIVLLLL..........................................
A0A075LK92_9BACI/2-170              .............................KWVGAILVLIAATWVGFDLSRRL..QQRPKQIRQLISSLQVMEAEILYSQTSIIETSDNLA...........KQV.PQ.......PAAAF..FQSLSDKLL-..L.........HPVDLYDCWEETTEAW...IDT....TALKTSEKDVWLQFGRTLGQHDFEQQQKHIQLAKTHLERELEESEEANQRYGKMIRNL.GFLTGLLIVLLLI..........................................
R7G1Y7_9FIRM/1-164                  .............................------MVILAGSGWGMLQAAKI..EECYRQMRYLRKLIFRIRSEIRYSRRVLPEAFLSVG...........SEA.QE.......PYKMW..LLSLYERLEN..R.........QGTSLAGIWEEETRTH...LPV....IGIPQDMLESLIRLGGELGTIDIEMQVRTLDLYLEQMEQKMEDMRTEQKEKIRLYQCI.GVTGGVFLAIILL..........................................
R6GD52_9FIRM/3-78                   .............................KILGGSLVLIAAYLFGMKLMEPA..AEHIRLLEEGDLLYRILESEIRNTRTPLPILFGELS...........DRT.NT.......RWHNF..FLSF------..-.........----------------...---....----------------------------------------------------------.-------------lsh.......................................
R7F5R2_9CLOT/5-169                  .............................KTILLIAVLGMCTVLGIMKANKF..KLRVIDLQEIKKALNLAITKIRYTYEPLPELFKEIS...........KDL.NE.......NISNI..FIKAHTYM--..-.........ENLNAGQAWEKAVDES...--S....NNFTNEDINIIKGLSKLLGKTDLEGQLMQIELTTKLVDEQIIEATNLQNKNTKLYKTL.GATAGLAIMIIFI..........................................
A6NV03_9FIRM/3-170                  ............................r-LLGAVLLTGGAGALGFGAAARL..NRRVHVLRLFTEALERMERELSFRLTSIPELFALLS...........DQL.SP.......PVGIF..FARCRGNLFR..L.........GEERLEDLWRNTLAES...--D....LELEPEEQQILETLGGILGRYDGEGQTQALALARAQLEQCLEAAVAERNKMGKVYGAL.GLAAGAFLVIVLL..........................................
C6CU13_PAESJ/3-172                  .............................KLLGAVLILFAGTMIGFQQAARL..AARPRQLRQLAHALQRLETEIGYGHTPLPEALERTA...........EAV.PE.......PLAEL..LRDAADRVQG..P.........EGLTFRESWEQAMTSG...WGT....TALRQTEQSVMLRLGSTLGISDKEDQLKHIHLALLQLKAEEDAARDDQSRYEKMWKSL.GVLIAVLVVILMV..........................................
R5JGP9_9FIRM/1-168                  .............................--MGAGIIFAACVLLAVRYAHYR..NSLFRQLKGLISLVEITEGELRYSSTLLWEIFDRAV...........PRL.DP.......CFENW..LNYLKDRLVN..T.........DMATFAEIWADGEAVL...FAD....TFLMEAYGEYVEELGGVLNYLDVTTQLSRIEYLKSKLMDELDRLKEDNARNIKLAYYI.CILAGAFLVILLW..........................................
Q818Q4_BACCR/10-168                 .........................sapf--------------SGFRYAKRY..SERPRQLRLLKSALQSLEAEIMYGHTPLSEAAERLV...........KQM.PK.......PLNWI..FQSFAKKLES..-.........GEQTVREAWIDSLKEN...WKL....TAFQQTEYEILQQFGETLGQHDRESQQKHIRLCITHLEREEEEAKALQLQYEKMIKSL.GVLAGLLIVILLL..........................................
R6RT95_9CLOT/4-169                  .............................KLIGLFLISVTGGLVGINASLRL..KSRTEFLEKYISLLSETKTRIRLSACDIRELFKNDS...........--G.YE.......PLDFM..TAEFTRNIK-..-.........NKSNVKISWERAVNSA...FRK....YRLSKADKELISDFGTDFGKRDIDGEISHIDLNIALIEDRLEKARTELTQKGKLYRTL.GIFGGITVSLIIL..........................................
I3EAC8_BACMT/3-171                  .............................KIIGALLIIVATTWTGFEASRHL..SERPRQLRQLKSALQSLEAEIMFGHTPLHEASRRLA...........AQL.SK.......PLSWF..FESFAKRLTN..-.........SETTVKDAWEESMAEI...WKF....TAFKHGEYEIMKQFGETLGRHDRMSQQKQIMLTLSHLEREEGDARDKQAKYEKMVKSL.GFLSGLLLIILLM..........................................
F7KQ68_9FIRM/6-175                  .............................KTFGAVLIIGATSLWGIRAADRI..NDQYVQMQYLKKLIYQLRSEIRYARSYLGEAFRHIG...........TSS.RE.......PYKGW..ILEIYDRLEH..K.........NRGTLADIWEDTVREY...LGA....SGLPDEELDKLINLGGQLGVADIEMQVKTLDLYLEEMSLSMEEMRGGMKAKVRLCHCL.GVMSGIFITVLLI..........................................
A4XLD1_CALS8/8-165                  .............................KLIGSSLIIFSSLLIGYSKTLKL..REQLRIINLFINFFSFARADILTTRLTLFEILNRFK...........SKV.FS.......AHTTI..LEYYYKQ---..-.........NGKPLLD-----VKNV...---....YQIDENVHKVILNLFNSIGYSSISEIDRIIDEGVRELREYYEIHKEKYSKNSKMFTLL.GLFCGVSICILLL..........................................
R5D5P6_9FIRM/3-172                  .............................KAIGAFLILFSASMEGTRHAHKI..REEYEELQKIRYLISLLKSEICYARSSLEEVFASVA...........EKC.ED.......PYRNW..LLMMRNEMRC..K.........KEKRFVKIWQESADVC...LVG....LMISRKEKENLKEVGARLGNLDLKMQIRSLELYEEKVEESLRQIQKQMYTKMRLYYLM.GIMGGILTVVLLI..........................................
R6U276_9CLOT/5-172                  .............................KIIISILIVALTAYIGSSKSRKL..KEREYVLREMVTFLKLVENEIKYMMNILPNAYEIAR...........QKL.NT.......ELKIK..IGQIVVDMLD.sN.........NMTYIEGSIEKNISEV...---....ESLEKYDKDIIISTLKNLGRSDIEGQINIIQNTINILENQINEANEIKNTNSKLYRTI.GIISGLMLVIIFI..........................................
E6SL65_THEM7/3-171                  .............................-WVGFVLVVTACSAWGWQRATEL..GRRPGDLRILRTALQALESEIAFGAVPLPEAFARIA...........GFY.PD.......PAATL..FRTAAARLAP..P.........RSLGAAAAWDEAVAAA...VRT....GGLTPDDRAILRAVGPYLGATDRDDQVRHLRLAMARLEAAEAVARDLDQRWGRIYRYG.GLLAGAFIGLLLL..........................................
L0EE69_THECK/3-171                  .............................KLAGAILVLLSGTLIGFRQAARY..ADRTAQIRQLLHVLQRLETEIGFGHTPLPEALERAA...........AGA.AG.......PVAAL..FRRTAERLRE..-.........GGAAVRDALRAAVDEG...WSL....TAMREPERSAVIRLGDALGISDREDQIRHLRLAAALLQAEEAGARDEQARYGKMWRSL.GFMAALLVVILML..........................................
R6R0H1_9FIRM/3-172                  .............................KLLGAAIVIISGGVLGFYRASRE..RKRLEQGIELKRLLYLLQGEIRYGLTPLPDAIGTIA...........GKM.NA.......EFSVF..LSDVSKKLSS..Y.........QEETFSQVWKNSVEKD...LTP....YVLEKKMLEPLITMGDTIGYLDKDMQVKTIDFTIEQIEERMYQIKDQVIKNCKLYQSL.GLSFGLLVVIILL..........................................
A0A0N0Z5S2_9BACI/2-170              .............................KWFGALLILAASTWLGFAAARVL..HERPRQLRQLKAALRALEAEVMYGHTPLADAAMHLA...........RQT.AA.......PLSEL..FERFAAALCT..-.........EETSAAEAWEKSLRTV...WGK....TALKQGEFEVMKQFGATLGQYDRLTQQRQIALALAHLEREEAEALDNQARYAKMAKSL.GVLAGLLLVILLM..........................................
R5LF31_9CLOT/5-172                  .............................KITISILIILLSAYIGNIKASKL..KNREYILRDMLTFLELVKNEISYMLSYLPNAYESSR...........QKL.NT.......TLKDA..IGNIVVDMLN.tD.........STYIISKSISENIGNI...---....NELTEYDKNVIISTLNNMGRSDLDSQVNIINNSISILENQIKEANEIKLNNSKMYKTI.GVIAGIMVVVIFI..........................................
A6LU35_CLOB8/3-172                  .............................KLILIVCIFIISTYIGFAYGETF..KKRQEQLKEILKSLTILQNDIVYGTTPLPEALENLS...........HKV.CK.......PLSNF..IELVVNRLLK..G.........NVESVYEAALEEFEVL...ENE....FYLERDDRKIMSDFFKSLGESGVYGQEKIFLLAIEGIKINLSDAEENAKKNTKLYRYL.GVCLGAMIIIFMI..........................................
Q81M39_BACAN/3-171                  .............................KIFGAVLIVAVSTFFGFSYAKRY..SERPRQLRLLKAALQSLEAEIMYGHTPLSEAAERLV...........KQM.PK.......PLNWI..FQSFANRLES..-.........GEQTVREAWIDSLKEN...WKL....TAFQQTEYEILQQFGETLGQHDRESQQKHIRLCITHLEREEEEAKVLQMQYEKMIKSL.GVLAGLLIVILLL..........................................
F0T0S3_SYNGF/3-169                  ............................v--IGYLGLIAGLGCLGLLQASRI..KRRPKELREVINAMALLDTEIVWGITPLPEAFGILK...........ERS.EE.......PWNQF..FAELEKQLL-..-.........KGENMRTAWLDTTKKL...RSR....FCLSEDDWKVIMDISKGLGRSDKAEQHKQLALAQKHLEAIKESAGEDAEKKAKMWSYL.GFLSGAALVILII..........................................
A0A0K8JJI7_9FIRM/4-173              .............................KLLGSLLIIFAGTSIGCSFANRC..SERPKQIRHILNCLASLRSYINYAAIPLPEALKLCT...........NST.EG.......VIRDL..FEGMSGILER..T.........GWITPKDAMLQAIALF...EKN....MALDKPELEMLVLLGANLGTADHTEQEKFLSMIQSELEKIEQNAIKLRDQNVKLYRYL.GICGSLAVIICL-v.........................................
C0CY20_9FIRM/4-40                   .............................KYLGAALILISAPGLGMYLAGQW..KERLRLLEKLRQMI----------------------...........---.--.......-----..----------..-.........----------------...---....----------------------------------------------------------.-------------..........................................
R7C103_9FIRM/3-172                  .............................KVLGSLIVIFAGIGFGFHKAAKE..QRRLEQGIAIKRMLYLLQGEIRYGFTPLPEAVLKIS...........TKT.EK.......EYQPF..LKNVAKQLET..H.........SEESFAKVWQQAAEKK...LKQ....VIYEPKFYEILKNMGETIGYLDQQMQEKTILLTIEQLDDQIFLMKDQVVKNCKMYRSL.GISLSVLIVIILL..........................................
J7IMK2_DESMD/3-169                  .............................-ILGCMVLIAGCGCLGLWFAYRI..RRRPQELRECSMALALLDTEIVWGATPLPEAFGILK...........ERT.DV.......PWQGF..FGELKERLS-..-.........QGESAGIAWKETMIAQ...NSH....FCLKSEDWNVIGDVGKGLGRSDRTEQHKQIELVQRQLMVIKEQAETWSGKQAKMWSYL.GFLGGIAGVLILI..........................................
R7EXW3_9FIRM/28-183                 .............................KLIGAALVVVSCLGVCFEARRAD..RERMALLDGFLRLAVFMRSEIDCFLTPQGRILEKCG...........AGL.LS.......DCGWH..--------EN..V.........PPRDLSELLSVVGDR-...---....--MEPQAYGILSSFAASLGRCFREEQLRNCDGCIDALTALRGRLETELPKRRRASLSI.VICAAAAAALILF..........................................
R6EWM6_9FIRM/1-169                  .............................-MIGSILVLTATSGAGFLYGMEQ..QDYLEKLLYIRHIIYMLKGELEYTKAPLGEVFGQAA...........VRV.RE.......PYKGW..LHGLERQVER..R.........KEDEFFKIWMRSIDRD...LHT....LHLKSEHVIQLKELGSCLGRMDSTSESLHLKLYVERLELEIEKVRESLSAKKRIGNCL.GVMGGIFLIVILI..........................................
R4KAY4_CLOPA/3-171                  .............................KLIGGIIIIAASTLGGFIYAQSF..INRVKELNEMERCIYQLQNEIVYTHTPLPEALTNVA...........IKA.KD.......PIADI..FNKTSQELES..N.........IYDNVYEAFKNAFKGN...-NN....LNLKNEDINLILDLSKSLGESDITGQINIFSLTMENLKKIIAQAEITMKKNVKMYRYL.GFGIGAMIVIMLI..........................................
A6CTX3_9BACI/3-171                  .............................KIIGAVFIILSTSWAGFEASRHL..SERPRQLRILKSALQSLEAEIMYGHTPLHEAARKLS...........KQL.QR.......PVAWF..FEVFAKKITT..-.........EETTVSEAWEASLKEV...WKM....TAFKSREYEILTQFGESLGKHDRLTQQKHILLTLTHLEREETEALEKQKRYEKMTKSL.GFLSGLLLIILLL..........................................
A0A0M2VMT7_9BACL/3-172              .............................KLLGAVIVLVAGALAGFYQAQQF..ASRPRQIRELILALQRLETEISYGYTPLPQALDRIG...........KSL.RD.......PLRTL..FTDAARHMSP..R.........YGLSAQESILKALNGH...WKQ....TSMKASEREVMEQLSGVLGTSDRQDQMKHIALAAGQLRHEEAAAREDQAKYEKMSKSL.GLLVGALIVILI-f.........................................
R5IB37_9FIRM/2-171                  .............................KTTGIILIIFSGTGLGLCKSMEL..SGRLKILERLAQLLLLLKGEIRCTGASLEDAFLDVA...........KKM.PG.......EYRLF..LEEMAGRIGE..R.........SGIAFEVIFRECAFKC...LPM....EKISPEEQECLLSLGEKLGYLDKEMQVAQLTLLEEELRERIRELKSGMPKRQKMYQSM.GILGGILLAVLMW..........................................
B0PBE3_9FIRM/2-166                  .............................KIGGMVLVIACTTSIGISFARAL..TERVRELERTLAALSSLGTELSYSLAPPAEAVAKLD...........ERE.TE.......--SAA..FIPACASLC-..R.........RGKPFPQAWREAALMF...--H....GALSQEDAEILAGLSDTLGQCGLEGELSSLEHTRTLLSMQLDTARARSATHGRLYRTL.GLLTGAFVIIFFI..........................................
C5EH42_9FIRM/4-176                  .............................KWIGSMLVLFSAGGFGIWSARQW..RERLRLLEKLRQMIYFLKGEITYSHAPLAEALERVG...........KRE.TG.......PLGKL..FTAAAEGICR..Q.........EGESLQEIWRREVQAL...SSPk.irLPLTEEDLEQLAGLGEHLGYLDVDMQERTLKLYLEQLDISIEYLRTNQREKCRLYTSL.GIMGGMFLVIVM-y.........................................
B0TEH5_HELMI/3-172                  .............................KLVGAALIVGAFSAGGFMTARDL..RRRRQILASLQSALAMLATEVAFRATHLPEALVQVS...........RTA.GP.......PVNAL..FAEAGNRLRR..A.........EGQAASAIWLQSVGDW...LPR....TPLHPSDGEELARLALGLGAAPREDQLHRIEEVKNRLAYLEQEARERETRMAKVWSYG.GVLLGAAVVLTI-w.........................................
R5P7W4_9FIRM/3-172                  .............................KFIGAVLVIISGTGIGFKASENL..ILQNVQLKKLKELLIILRGEIRYNNTVMPQALRNIL...........KKS.DK.......VFEKF..LLYVADNLDK..Y.........QGKTVADIWNEGVDKE...LSK....LMLSKKHIEKLKDLGNTLGFLDKEMQISYFNLMIEQLDTDIEDNNKRCRDNCKLYRTL.GIMGGILVVLII-v.........................................
I0JNW2_HALH3/2-169                  ............................e-WIGAVLILTVTTLAGFDIAARF..KQRPGHIRQWKNALQMIEAEMVYGQSSLWEVCENLA...........RHL.PP.......PTSQF..FEKINQDQ--..E.........PCSDFASLWESRLKKH...WSS....NAMGKSEWEILLQFGRTLGQHDLEQQQKQIQLALHHLDRELQEALDGVDQYQRMARGM.GVLSGLLVIILII..........................................
R7AJV0_9BACE/7-177                  .............................KICGMALVMASAVLTGRQIACGY..RKRLLELDALRRCMMILNNEIAYSSSALAECFEAAS...........ARCiDK.......EISEM..FADMSRLVSQ..A.........QGERASDIWDSCVNRH...EGS....LHLTDTDIAELYNFGKSLGYLNAQMQTDSIRLYMSVLETQISDAAAHVDNQCRAAKTL.SIACGAFVCIILI..........................................
K6DTD6_BACAZ/2-170                  .............................KLIGAILIIVATTWFGFEAAKKL..SERPRQLRQLKVALQSLEAEIMYGHSSLSEACNHIS...........KQF.EK.......PLSVF..FSRFARRLSE..-.........GETFVSSAWKESLDSI...WNK....TAFGQGEYEVLRQFGETLGQHDREHQQKHIRLTLIHLEREENDAVEKQGRYEKMVKNL.GFLTGLLIVILLM..........................................
R6ICS7_9FIRM/2-169                  ............................n-LIGAMLIMLSCTAAGLMKARSL..SELDKTYGTLIAMLTLIKNEIVTLSAPLDEAFERAA...........GLA.NG.......DVGRF..MSQVRRDFEK..L.........GEDSFCGIWRSAARDD...L--....QSLSERALSAVEELGASLGRYDSTMQCTAIDRCINEISLEQQTLRLSLSSNKRMYIGI.GGAMGLIIAIVLI..........................................
B8I3C0_CLOCE/4-172                  .............................KIIGSVLLICATSLIGFSLAADC..SKRPKVLRELQVLLQMLENEISYLSNLLAQSFERIY...........TSS.KT.......DASLI..FKEAAENLS-..L.........PGITADTAWEKAVENT...YSK....LGLNKEDKGILITFGKMLGSSDLEGQINNINLVSSQLKLQEMKAEQMRQKNEKMYKSL.GVLSGLAIVVVLF..........................................
R6GSG0_9CLOT/1-137                  ............................m-----------------------..-------QQYLQFVSYIETEIRYSQRILSEFINEYK...........--N.ES.......EFKLF..LTEIKENLK-..-.........SRASFSKAWTDSVHKI...PNS....YGLLRQEKELISEFGQELGSTDIDGQIALCNLNKSLISSILDAAKEEKTKKSKLYFML.GTSFGMCIAVILL..........................................
A0A0F2JJL8_9FIRM/3-169              .............................-ILGCIVLIAGCGSSGLWLADRI..RRRPSELREFLMALTLLDTEIVWGATPLPEAFGIVK...........ERT.DM.......PWQGF..FKDLQERLE-..-.........RGEAANIAWKATILCQ...KAH....FCLKPEDWQVIRDVGKGLGRSDRTEQHKQLELVLRQLTLTKEQADIWSVKQAKMWSYL.GFLGGIAGVLILI..........................................
A0A0C2UJ52_BACBA/2-170              .............................KWLGALLILFASVWLGAEQSKKL..SDRPKQIRFIRSALQTLEAEIVYGLTPLHESARKLS...........ERL.PP.......PVSEL..FALFSELLTS..-.........TELDASEAWKRSLAKV...WPR....TALMESERAILLEFGETVGKHDRLTEQKQILVTLKHLERQEEEACEKQKKYGKMMRSL.SLMGGLLIVLLLF..........................................
D9SLF2_CLOC7/3-172                  .............................KIIGCLFIIVSTSCAGYMLGDKL..RKRVADLKELQRILISIKNELKYSIEPIELTFKKIA...........RDF.KN.......PYDEI..LRIAAAKIYN..N.........EITSIDEAISEALAEK...EMD....LALKDEDKLIFTEFARSLGKWNIGAQEDFFNLSFVKIEEQLNSAEDFCAKNLKMYNVM.GPCIGLMLVIVLI..........................................
Q894F9_CLOTE/4-173                  .............................KLLGALLTIASSTAIGFLYSNKF..KKRVYQLKSIERAVYEIKNEILYTYTPLPELFSKTS...........EKS.SF.......PINKL..FESISNLLKT..N.........AVNSVYEAFIKGFQKV...EDK....MELKKEDKDLILNLAKTFGESDVQGHMNIISLTLEGLKKQITEGEIAMKKNIKMYRYL.GFTIGMMIVITLF..........................................
D3E6K9_GEOS4/3-172                  .............................KLVGAVLVLGAGTLAGFYQAQQF..AARPRQLRELILALQRLETEISYGFTPLPDALERIG...........VSL.RE.......PLKSL..LASAALYMRP..D.........YGLSAQDSIRKALGEY...WRR....TSMKSAEREVLEQLSGVLGTSDRQDQIKHIALAVGQLKHEEAAARDDQVKYEKMSKSL.GLLIGALIVILI-f.........................................
R5T8Q3_9CLOT/7-176                  ............................r-LLGAVLVVVSCSGMGFFLAGQW..GERLKTMEHLRKMIFLLKGEIVYARSALPESFERTG...........KKG.GG.......EIGDL..FVRVAGRMEG..Q.........RGEPFYDIWQEEIEKL...PKA....FCLSKEDRQSLKGLGEHLGYLDLEMQERTILLYLEQLDLTIGYLREHKQERSRLYTSL.GIMGGIFLTIMM-y.........................................
R6JN57_9CLOT/1-147                  .............................------MIVLFCGAIGISLAVDV..GRRCERAQLLCRLGEQVRLLLDYSMTDTGAIFAQLA...........SDP.RF.......APFGF..L---------..-.........QGCDPAK----TVTV-...--A....TGLTARDDQELADFLQRLGKSDLQNQLRLTDGYIAFAKGRAEEYAARCKRQKQLYVAF.GLSGGLIAALLL-a.........................................
R5Q3H4_9FIRM/3-167                  .............................KYIGALVVFVSCTLSGLTLCERE..KLKLRQCEAFLSLFEYVKNQIHYFLAPTKQIYRGFE...........DPV.LA.......-KAGF..LAKLCEE---..-.........SGGVYRNNWIDAFEAC...GES....FCLSPAQAEIVKAFGSHIGKSNEPMQMRNFEYCIKSMEAETAKQRALCEKNTKLYRTL.GFTLGAMAALLLI..........................................
R7GAR3_9CLOT/5-119                  .............................KYFILFLIFILSNIIGKSIAKKY..TYRLEELKEMKSALNIFKTKIEFTYEPIPEIFLEIS...........KNT.SK.......TIANI..FEMAKLEM--..-.........DKTDAQTAWQKAIDES...--E....NNFKEEDKKTLKVMAKML----------------------------------------.-------------rkv.......................................
R7KC87_9FIRM/4-157                  ............................l--VAGGLIAVAFTLVGMSINRRF..KMRKEAFASLYDFSVKLKGDISYLKTNLPSVIKSHF...........ENN.KS.......PVAQS..MLKYAEN---..P.........SSEFVPE--------I...---....GCFKESEKKEVTKYLYSIGSLPYAESLNMTDRMIENYKQLKEKSETEAKKLGSMYFKL.LVLLGFAIMLI--v.........................................
R5XPI3_9FIRM/3-172                  ............................r-IIGGILVIAATSGIGFLYSKEL..QIYLEKMLYIRHLIYLLKGELEYCVAPIGEVFGKIA...........QRV.KQ.......PYKNW..LLAMQKQVEN..R.........EADEFFTIWMRTIDQY...LGE....LSLKPSHLIQLKELGCYLGQNHTAVESRNLQLYIERLELEIEKMREGIETKRRIGSCL.GVMAGIFLVVILL..........................................
D7GUK4_9FIRM/2-178                  .............................KYLGLLCMAAAAVAGGFLLAGEW..EMRVKMLGIFRQMAVYLKARILYSNETLPEALKEIG...........SRF.SDgnsgmaaEAGLF..FLRVEKRMEE..E.........AGKPFAAIWKEEMEKF...PDD....LPLRKQDLEALQALGENLGYADKKTQERTILFYLEQADDSLAFLKKEMESRTKLYRSL.GMAAGLFILVLF-a.........................................
R5TLB9_9FIRM/3-172                  .............................KAAGSMCVLAACIGFVRELLRTG..SLHKEYLEALIELTELLSAEIRYERLPIQEALQQIQ...........KKI.RP.......EIAFV..LRQMIEQMKD..G.........TGTSFSEIWEQAFRKG...GKG....LFLTGEELEEVCRIGKHLGFLDQRQQEEHLQGCRERLQRLLRLRQKELEEKKHMYRCL.GVAAGIFVILILV..........................................
R5ECS1_9FIRM/4-170                  ............................r-WFGAALVIAGCGGFGFSIASGY..KREEGILRQLLRALNYMEWELQYRLTPLPELCRQAG...........KET.RG.......TLREV..FFNLARELEW..Q.........TSPDAASCMTAALKRS...---....HELPRRIRGIMKQLGHTLGRFDLPGQKQGLEEVRESCRMELEALGKNRETRLRSYGTL.GLCAGAALAILFL..........................................
C8WXI3_ALIAD/2-170                  .............................KLAGAALVLFACTLIGLRVAQGY..RDRPKALRQLLQALIELQSEVEYHATPIPQALRAVG...........TRL.GG.......WCGSW..LVDMANVLSR..-.........PADSPEIALQNVSLAS...ATS....GTLRDADAEPFLRLLRSIAVADRDHLQQPFLAARADLEAAIQAAQDEAIQGARLWQYL.GALAGVFIVLLLL..........................................
R5N5V5_9CLOT/5-169                  .............................KFIILSGIFCLSTACGITISRKY..ITREKELKEMLNALNIFEEKIKFTYEPIPDVFKEIS...........EKC.IS.......SIGNI..FKSASDNM--..-.........QIMSAGEAWEKAIDES...--E....TKLNKGDKDTIKGLAKMLGQMDLDGQVNEIRLTMKFLENKIEDAQMERKKNEKLYKTL.GATIGLAIVIILV..........................................
R7FH89_9CLOT/5-123                  .............................KYCMLFFVFLIATLIGKNISQKY..KFRLDELEELKNALNIFKSKIKFTYEPIPEIFVGIS...........NNS.NK.......NISNL..FNMAVDKM--..-.........KTESAGVAWERAVDEF...--Q....SNLNEEDRQALKTLSKLLR---------------------------------------.-------------snrytg....................................
A0A0N0YD81_THEVU/2-171              .............................KLIGGLLVILATSWLGFTFAGRV..RDRPKQLRQLRSYLAILKTEIEYGTRPLAEACANIA...........SQE.ET.......AVSRL..FQASADQLLR..G.........DGSSTYECFRRAIEQE...WQR....TALQQAEQTVLLQLCQVLGSSDRQDQAHHLTMACNQLELEENRAREEQDRYEKMYKTM.GVLTGVLLVILMI..........................................
R7FQQ8_9FIRM/2-167                  .............................KAVGAALVFFAAFTCGLLAGKRE..QRRIDEAEAFLALFEYIKNQVGYFLTPTKLIYRGFE...........NKV.LS.......DVGFL..-----DRLCS.hE.........NDEIYFDAWGDAFRAC...EGE....LHLSAEEKRTVLRFGECIGKSDEHMQLKSFDYYIGLLSSELEKARSETAKNKKVYRTV.GFAIGAMAAILLI..........................................
A0Q091_CLONN/4-173                  .............................KILGSILVLLSSTLLGFICGENL..KRRFLQLEEIEQALYQLKNEIVYTHNSLPEIFMSVG...........SKG.TK.......PIGDI..FKRVSSLLYD..H.........EVESVHEGFKKALNEN...KKQ....LNLKKYDIDILLNLSKSLGESDIEGQQNILTLTIRNIKSQLDSAKNVMEKNIKMYRYL.GFSFGAILVIMML..........................................
L0F7P7_DESDL/3-169                  .............................-WAGAFLLIMGCGSIGLYRAALI..RKRPVELRECLTALALLDTEIFWGSTPLPEAFAILR...........ERT.DG.......IWSDF..FAELSERLQ-..-.........GGEGASSAWNATIDHQ...IPR....FCLKSGDWQVIKDVGKGLGRSDRQEQHKHIELVKQQISLVKEQATQSSEKQAHMWSYL.GFLGGIAGVLFLI..........................................
R6N725_9CLOT/5-169                  .............................KYFILFLILVFSSMIGKFISKRY..VYRLQELEEMKNTLNILKNKIKFTYEPIPDIFKEIS...........NNS.NK.......NIGQI..FKKAEEKM--..-.........EKTTADVAWEQAVEET...--N....NNLKEEDKNVLKMLSKLLGQTDTDGQISQIEITENFLEGQIKDAMEAKQKNERLYTRL.GTIVGLAIVIVL-c.........................................
R7BI57_9FIRM/5-177                  .............................KIAGAVCITAATTFYARGLVLEL..RTRIEGLKFLKQCFCTLKGELRYGVETLPAAFMNVG...........ERC.GVg....geDIRDF..FWNVGRRLGS..D.........EAVSLKEVWEEETKKL...AAR....VNLDGRECDNLVRVSESLGYLDITQQINNIDLYLESIEADIAALTEKYADNCRMYMGL.GVMAGLFLTIILI..........................................
C2X2E4_BACCE/1-164                  .............................-----MLIVAVSTFFGFSYAKRY..SERPRQLRLLKSALQSLEAEIMYGHTPLSEAAERLV...........KQM.PK.......PLNWI..FQSFAKKLEN..-.........GEQTVREAWIESLKEN...WKL....TAFQQTEYEILQQFGETLGQHDRESQQKHIRLCITHLEREEEEAKALQLQYEKMIKSL.GVLAGLLIVILLL..........................................
J1H3U7_9CLOT/1-146                  ...........................me-------------------SRKL..GGRVRELEAFYSFLCLTREEIRYSGMPVERIIEKHG...........---.--.......KNQRF..LVLCAEYC--..R.........KGESFPRAWEHGMDDG...LLT....TGMNRQDLEYIRDFGLGFGASDTEGQLAHCQLYLGFISSALTHAREERDKKAKLYFML.GLFGGIAAALLL-s.........................................
Q5KX94_GEOKA/2-170                  .............................KWFGALLILAASTWLGFAAARVL..HERPRQLRQLKAALRALEAEVMYGHTPLADAAMHLA...........RQT.AA.......PLSEL..FERFAAALCT..-.........EETSAAEAWEKSLRAV...WGK....TALKQGEFEVMKQFGATLGQYDRLTQQRQIALALAHLEREEAEALDNQARYAKMAKSL.GVLAGLLLVILLM..........................................
R5LXU5_9FIRM/1-158                  ............................m---------ISTTLYGYRMSLDL..KAEYNELLEIKKMMFLLKGEIAYGSCTINEALANIS...........TRC.GM.......NIDNI..LENIASD---..-.........TEGNFYENWEQKWNDG...FLN....MHLSKNIKADILNFKDVLGLADKSGELSQIDLFLSRLQNEIDNTENILPQKCRMYRCL.AVGAGIILSIIII..........................................
R6EIE9_9FIRM/1-164                  .............................------MILCGCLGLGMWYRGQF..LMRLHMTRELICLLDQWISEIRYNRSTLPEGCRQIG...........RQR.ED.......RLGEI..CNRVYREYAE..A.........GGTGFLEIAGESFRRQ...LEA....LPLKKEEIDQFLIFAGKEGYADETMQIRAMELSKEGLERTATAQQREITQKCRLAVGL.GAMSGMFLVLLLL..........................................
G7M110_9CLOT/3-172                  .............................KLSLSICIFILSTYIGFAYGETF..RKRQNQLKEILKALTILENDVMYGTTPLPEALENLS...........YKV.CS.......PLSSF..TEAIANRLTK..G.........NVESVHQGAVEEFKGL...DKE....FYLNKDDKKIMEDFFKSLGESGVYGQEKIFFLAIEGIRMNLNDADDSAKKNIKLYRYL.GMCLGAMIIIFII..........................................
B5CM47_9FIRM/3-172                  .............................KLIGSILVLTATAGAGYLYGEGL..KDYLRQMEYLRYIAGMIRGQLEYTGAPLQELLMDVS...........AKI.KE.......PYKSW..LEHTARRTAK..R.........TDADFTEIWKGCVEKD...LGA....AGLKKEHREWIRDFGAFLGQGDRETMGRSIELSMKQMDLMIRQQRGELAGKRKIGNWL.GVMSGLFLIILLW..........................................
R7I7Q5_9CLOT/3-172                  .............................KIIGSICILFGCSAVGFCLVDQM..RKRLQELLFLRKQLAFMEGEIRHGLRNLPEIMFSME...........QRC.TG.......EWKVF..FHRVAEKMYE..E.........KNAPLTEIWKDTMREV...LQV....SRLTVKQKKEWEELGENLGYLDCEMQLVLLQICQEHFQDFIREEQEKYKKHARLYQTM.GVMSGIFLVVIFI..........................................
A0A089L3U1_9BACL/3-172              .............................KLLGAVLVVVAGALAGFTRAAQY..ADRPRNIRGLIAALQRLETEILYGYTPLPEALHRIG...........QQS.KG.......PLQAF..FTAAAEEMSP..P.........LNRTAEEAFQRAVELH...FRS....ASLKGAEKEIIRQLSCTLGTSDRSNQSTHIALALQQLKQEETVAREDQGKYEKMSKSL.GLLLGVLIVILI-f.........................................
F5SB01_9BACL/3-172                  .............................KMIGACMILLSTTAFGFRKARAY..AERPRQIRQMRGALSLMRTEISFGSRRLDRICEQIG...........HRE.KE.......PVRSL..YARCAHYLRE..M.........DGVSTFECWKRAVEET...WPA....TELKQPEKEVITDFGKTLGISDREDQLAHLARTQTNLEVEEGRAREEQERYEKMCKSL.GILGGALIVILI-y.........................................
Q2RI95_MOOTA/3-172                  .............................KLLGGVLIITTCGSLGLMVARGY..RARIEQLRHLNAGLKMLETEIRYTATPLPLALIRVG...........NQL.PG.......AIAHF..FHTVAGVLKA..D.........AAAGALAAWERGLEDL...RAR....GALEADDLEILRALGPMLGRSGVNDQVKNLEMTRQLLGQQQLAALEINNRQGRMWQTL.GFLLGVTLVLLL-y.........................................
R6ZUU8_9FIRM/4-173                  .............................KIVGSLILLVGTAALGVYYAGQY..MERLRNLMEMKKALMQMQGELRYLHSAMPDLLETIG...........KRT.RG.......VLSPF..FLSLAKEMDK..K.........EQGDFASLWCSQIKKK...IPL....SALEPEARNLLFETGRQLADNDRQSKEEGLTFALKQLEDMIHRRNKEKQNRLKLYYVC.GIMVGAMLTILLV..........................................
E6TXN9_BACCJ/2-170                  .............................KLLGALLIIATTTMFGWEFSRRL..TRRTKQIRYLKIAFEALETEMTFSMTPLPDACEKVA...........HQL.IA.......PLNIF..FEDVAERLKK..-.........EEKSATSIWNSSLKKW...KGK....TDLNTAELNILNQFGQTLGQQDLESQRKQIRLAISYFNQEEKQALEDQQKFESMYKSL.GFLGGVLLVLIML..........................................
R5PDC9_9CLOT/1-166                  .............................--------------MGILRAMAI..RRRVKEMQEYARVLSVATAELRYRRDILAQVFVRVA...........KKC.RQ.......PYAAW..LSELSQALME.aQqrqaysyteVAADFDQIWIEHADKL...YES....SGLKQEDMEYIYNLGQTIGYLDVQAQEEGLALLQADLGRHIRELEAEAKDRMRLSLVV.GSVAGVLLIIILI..........................................
R5HGP6_9FIRM/4-169                  .............................-LLGKTLLFAGCTAFGLLRGSRL..RQRTACLGEFRRTLAGLARELAFSLRPVSDLMAGAE...........AGT.QG.......PTAAF..FRTCRRRFAE..G.........GQESWAESWTEALEQV...--A....LPLEEADLRLLQEAGDVLGRYDGESQRQALEGLLRGLEGQAAEAAERARRLCRVYLAL.GLAAGLFCLILL-..........................................
R6CNW8_9FIRM/3-160                  ............................e-LVGAVLLAVSGAAAGSAAADEI..KQQRLALQSVEDMLAQMMIMLEFEAPTVQIMLSELR...........KGS.AP.......---EF..IMRMPEN---..A.........DP----ERICEAIKRC...--P....DGLTEQDVQKLCTLFGRLGSADKLCEQQRIAGAAAYFAERRKKCEPECRRKEKLAKSL.GLLGGIFFAVMLL..........................................
A9KMD0_CLOPH/7-176                  ............................r-MTGCALIIGASTGMGFLFGNEI..KKRMEDLRAAKTIAILLRGDIRYAQTALPEALENIT...........KRH.DG.......RLTPF..FKKVSKELSQ..Y.........SGVSLAEIWESAMKEE...LLN....TSLTKKDRTCFLEFGKQLGYLDKDMQMNHIDWYITQVEEDMQEINLDAKEKIRLYRSL.GVLLGIFVTILV-l.........................................
A0A078KSP3_9FIRM/4-171              .............................KYAGIAVFIFTCTAAGFMKSLSL..SRRVKELETFISALSFIATEIRYFASPTPVIISKIK...........SKE.EY.......AGLHV..FEICEKNLL-..-.........TTHDFKKSWTSALDAS...KQY....LSLDAGDIETLKCFGNTFGTTDIEGELANCEHYINSMKVRLESARIDKTKRGRMYSSL.GLLTGVLIAAVLI..........................................
J3B0I1_9BACL/3-172                  .............................KLIGAVLILFSASMVGWQIGRYY..AYRPVQLRALLVALQMLETEIVYGMTPLHRAFVKVG...........RRV.SE.......EVGKV..FLHAAELLVS..E.........KAQSAEDSLQQAMGKH...WAQ....TALRRQEREVLASLGQVLGSSDREDQQKHLRLAVTHLRGLEEEARAEQAKYERMYKSL.GFLGGLLVVILMF..........................................
R6TCG4_9FIRM/3-165                  .............................KLLGSLLILGGGFWARWSMVSVC..RRELDTLSELTACLTEMAEEIRLARTPLPELLDRLS...........RGR.GP.......EVTAF..FTAVAGAA--..R.........RGGNVAQVWRQAAEE-...---....LPLCDEDRDILAEAGRHLG-GDETSVCKGISLVISHLGRSLEEQRRSRGEREKRVTAL.CFSGAALLVILLL..........................................
R6Z5K6_9CLOT/4-173                  .............................KVLGAFLVVLSCSRLGVYMAARL..SERRGLLKKIRVMVIHLRGEILYANAPLYEGFQKAG...........RRS.GG.......REGLL..FETVSEQLLK..E.........QGKEFFAIWQEAVTSY...LPQ....TPLTKEEGEQLLAFGEHLGYLDREMQERTLSLYLEELEREMEELNQEIAQKGRLYTSA.GILTGLFLAVIFI..........................................
R5VM52_9CLOT/3-170                  ...........................fg---GFLMIWGGCLGTGIWCCCRY..LRGIRTMMHLEVLLLLMEERMRYGRNSMTTVLQELS...........NKS.QG.......EMKKF..WQSMIEPDF-..S.........GEESFAQKWRRQACQH...MKA....ACLKGEALEEFAELGSYLGNQNLNQQLLSLEQYRSRLHASLLEQQKLKPKYIKLYPVM.GGCLGLILCMLMV..........................................
D5DS81_BACMQ/2-170                  .............................KLFGAIFILFASTYTGFEFAKQL..SARPRQLRQLKTALRSLEAEIMYSNRPLQEVAHLLS...........LQL.PN.......PLASL..FNEFSMKLKE..-.........GTESVKEAWEKTLDQF...WKQ....TALKTGELEILKQFGETLGQHDRYSQQKHILLTLNHLEREEQDAVDKQNRYEKMVKSL.GFLSGLLLVILLM..........................................
A6TR28_ALKMQ/4-173                  .............................KLLLSILIVICSGLIGIIYAKAY..IDRSKLLRDLISTLQMLETEIMYGATPLPELMVLLA...........AKS.ER.......EIARL..FQMTAHNLQK..H.........DGHTFASVWRKSVNVM...GKE....TVLKERDIALLVSLGNNLGISDQENQVKHIRLTMEEMRRNYDEAIMLQRKNEKLYKSL.GVLFGLTVVIVFF..........................................
C5VSZ5_CLOBO/4-173                  .............................KMLGCALVLISSSLLGLIYGQNL..KKRFFQLKEIEQAVYQLKNEMLYSHNSLPDIFNNVS...........EKC.DK.......PICDI..FKEISKLLYD..Q.........EVESVYEAFKKSLTNN...SLK....LNLKKYDIDIILNLSKSLGESDIDGQQSMLTLTLRNINSQLDSAEKVMQKNIKMYRYL.GFSLGAILVIMML..........................................
Q8RAD9_CALS4/2-170                  .............................KLIGVILTIFSTTSIGYLMAMKF..KARRWILKSLISALNLLKLEITYSRTPLERALKKVA...........LSS.DK.......TVGEL..FQRASLHLGE..Q.........SGLTAGEAWEKALNEW...-ER....GYLSKEEKEILRAFGTILGISDAGNQEKNFNLTMDLLKRQLNLAEEEGKKNEKLYQNL.GFLLGLAIVILFL..........................................
R7ISW6_9CLOT/6-170                  .............................KTILLFAIFSLSTGIGILISKMY..ENRVKELRQFKNILNIIKTKIKFTYEPLTEIFNQIS...........QEK.SS.......KIEEI..FENMTYKL--..-.........EFENVKYSWMDAIQEA...--D....ISITQEDKDILKELGKVLGQTDADSQVNEIEVTESFLNMQIEKAEEARKKNQKMYKTL.GVVVGLVFVIILI..........................................
R5RJJ1_9FIRM/3-172                  ...........................rc--TGALLLFFACCGMGFWKSRQC..TGRVHQLKELIKMGYFLKGEISFARTTLPEALGQMG...........EKV.EF.......PFSEF..VRILSERMKK..Y.........SGENFSHTLRAVMEEK...LKD....TYLETVDLEEFYSAACNLGYLDKEMQIHILDRYLKEQAQKVEMLTVQMPKQQKLFRSL.GILGGAFFVILFW..........................................
R7GUZ7_9FIRM/2-166                  .............................KWIGLIFLILCGAMAGMACSGKL..RMKLERTEKLCSFLREMGVLMQYQMSTLGELLDTFS...........NRS.VY.......QEFQF..LSQTAAHMQ-..-.........QQTPFVQAWSEQVQAE...---....KHLSPEVKEVLLELGEELGRTDLEGQLSALSQAHIQLQRFQDTYRVTYQKKGKLYRSL.GLLAGLLLAVLF-c.........................................
R7FEP9_9FIRM/3-167                  ............................r-LAGLACLVLCGGGAGWYAAMGL..QRTRTAAECLSRMLREMAVQMEFRALSMQELLERLS...........QES.SY.......GMFRF..PATAAQRMA-..-.........QGDSVCQAWQTGLTQD...---....KAVPELMRRILLPLGEELGASDLAGQAETLEQYRMQLEPYTAAAAERCQRLQRLYVSM.GVLGGLLLAILL-c.........................................
R7BSC6_9FIRM/6-166                  ...........................rl--VAGGLLALIACYIGVLIKRRY..AKRVTFFKSACEFSSCLATELSLKKTPMPKIASKFL...........QGR.EG.......EFESC..VECWINL-AK..R.........GGVYAFE--NANV---...---....SILKTDEKKQLASFFSALGKTDLKDQLSHVGYYKNVFEQKQKVCEDESKKLGNTYFKL.CVLAGIAIMLIL-a.........................................
I8J694_9BACI/4-171                  ............................f--LGASLILFSTSWMGFAMAKKV..KERPKQLRELKVALQSLEAEIMYGHVPLDEAFGHLS...........RQL.NE.......PIAAF..FGELAGALQE..-.........TASSVPILWEEALTRL...AER....SSLKKAELEVLQQFGSTLGRHDRDNQKRHIQLTLSHLERELDEATAAVATYEKLYKSV.GVLSGLLLIILLI..........................................
D4J409_9FIRM/1-138                  .............................-----------------------..---------MQRSLRMLHGEIRYTGAELPEAIDQIA...........LRQ.EK.......PFSDF..YHGLSEQMRR..M.........DGQSLKTLWQTEIEKC...LNN....TYLTKEDKQIFLESGSQLGYLDRQMQLSSLEACMAQIEDNQNMIRKNMKEKQKLSVAL.GLLSGFFIIILLI..........................................
A3DDQ0_CLOTH/4-173                  .............................KIIGSLIVFMSSSLLGYMYSRRC..SKRPAELRALQGYLQMFETEISFMSNVLKDAFTKIY...........MYD.DS.......SVAVF..FKGTVEALEN..D.........TGITAGEAWAKAVKEN...IKN....TSLNKEDEEIIISFGKMLGSSDVEGQIKNIRLTINQLKLQEQKAEELRAKNEAMYRNL.GILGGLAIIIILF..........................................
G7W852_DESOD/3-169                  .............................-IMGCIVLIASCGCLGLWLAYRI..RRRPLELRECSMALALLDTEIVWGATPLPEAFSIVK...........ERS.DR.......PWQGF..FAELQERLV-..-.........RGESAGSAWKETMTNQ...KDK....FCLKTEDWLVIADVGKGLGRSDRSEQHKQIELVQRQLLLIKEQAEIWAYKQAKMWTYL.GFLGGIAGVLILI..........................................
E7GNS0_CLOSY/4-173                  .............................KTLGLILVIASCSGIGAEAVHRL..RERLRLLETLRRMASHMKGEILYANVPLAEALYRTG...........KRN.KG.......AAGEL..FIAIATELEQ..E.........TGESFEAVWRAKAGKF...AAG....SVLNKKEQEQLLRFGESLGYLDRDMQEKAILFYLEDLEHSIETLRKEEPEKSRLFFGM.GILSGLFLAVVLI..........................................
R5N3Z3_9FIRM/1-102                  ...........................mf-----------------------..------------------------------------...........---.--.......----F..IKDARERFR-..-.........RGDSFSSAWKNAIDKN...KSD....TCLPQDCIEKLKAFSDTFGSADKQSELENCDTFISYFELRQKELHERAASAPRVYGSL.GVLFGALAVIVLF..........................................
R5TCB0_9CLOT/5-172                  .............................KIIIGGLIVAVTTYIGFLVAKKL..QKREETLRETILFFDMVENEIRYMLNVLPNAYESAR...........QRL.KG.......DLKIV..IGQIVVDMLA.sD.........NYELSGKTISSNINLL...---....KELTSYDKEVIISTLKNLGRSDVDAQVNILENAKRTIQVQIDEAIEYKNKNSKLYKAV.GTIAGMMIVIILV..........................................
F3AI40_9FIRM/4-173                  .............................KGIGIILIVLGTSGIGYLTAADL..KRHLNDLKCLRRILLLLKEEIAYTHAPLEEAFARIS...........RKV.KA.......PYCLF..LTQVSGQLAR..R.........AGSSFAEIWSCAVEER...LCT....TKLTREELEELKEFGNSIGYLGGHAQEGAIDLYLEQLKVEVQDVREGLAAKQKLCSCL.GVMSGIFITILLI..........................................
C8W107_DESAS/3-172                  .............................KLLGSIIIISACGMAGLVKARTY..TRRTGELRSIQSALQLLETEIAYAASPLAQALHSAA...........ACG.EK.......NVAGL..FLRASQELLS..M.........TGQTAGEAWDKALAVF...YPQ....SSLNRSDLLILRNFGSTLGVSDREDQIKHLCLTQEQLRAEMEKAEAEAGSNVKIWNYF.GFFGGIVTVLILL..........................................
A0A0D1XUH5_ANEMI/3-172              .............................KLLGASLIILAGTLSGMQLGGYL..AHRPLQIRQLRTGFTLLETEIIYGSRPLPEALASIS...........RRL.TG.......SGALL..FSRTAEMLAQ..E.........PEWPVSECWHSAVQQV...WPK....TALKGPEKEIVLQLGSVLGQSDREDQRKHIRLACANLEHEEASARDNQQRYEKMCRSL.GVLSGILLVILL-y.........................................
G4HEY2_9BACL/3-172                  .............................KLVGALLVIGAGTLAGFYQAQQF..AVRPRQLRELILALQRLETEISYGFTPLPDALERIS...........ASL.RD.......PLKSL..FAQAAQYMRP..D.........YGLSAEDSIRKALEDY...WKR....TSMKNAEREVMEQLGGVLGTSDRQDQMKHIALAAQQLKHEEEAARDDQAKYEKMSKSL.GLLIGALIVILI-f.........................................
A5I318_CLOBH/3-172                  .............................KILGSLLIFVGSLYWGITTANKF..KYRRDELLELERCINELKNEITYTYTSIPDILMNIS...........LKS.KK.......PISTL..FKKISNMLYD..N.........KVNSIYEAFSKGFSEE...KDN....MALKEEDIDIILDLSKNLGQWDPKGHENIIELALYNLKKQSDRAEESMIKNMKMYKYL.GFSIGAVLVIIFI..........................................
A0A0M1UYE2_CLOSO/4-173              .............................KIIMISILVACSYLIGEYIYKAY..TKRHKQLNELIRILEIMRMDLAFGLYTLDEMFFRIG...........ENK.EM.......SFHMV..FKNICKDLRD..E.........NNKTLESILDKNLEDM...GKD....TYLQDREIEELKNLILTLGKGDIESQERMIDLSISNLKKMTEESLEDINKKGNVYKKL.STIIGLVIGIFLM..........................................
A1HQ77_9FIRM/4-173                  .............................KLTGSLLVVTAGTAIGFLMAWRY..GERPRQIAQIISCIVSLKSYINYAAIPLPEALARCS...........VGI.NG.......PVAEL..FGRMAQMLQK..E.........SWLSPQEALRRALGQA...DSR....LVLGRPELEALLLLGANLGAMNREEQQKQLDLVQHELEKAEREAIAQRDPNMKMYRYL.GVCGSLAIVILLV..........................................
F4A170_MAHA5/4-173                  .............................KLILSAVIVIASAMIGNIYSMKY..AIRVTQLRRLQTALQMLETEVIYRYSPLPEAFKSVA...........LSM.KG.......EIQCI..MEDTASMLAD..R.........KGYTIDHVWETALKHY...AKS....MALTSDDIGILLNLGKTLGSSDADNQIKYFELILNQLRQQEKYAEAEKAKNQKLYNNL.GILGGLGIAILIL..........................................
R6G6F9_9FIRM/3-172                  .............................KVSGALLVFFAGWGMGNWRSRQY..QQRIKDLQILQLIISCLIGEISYARNTLPEAFSRIS...........EKV.AS.......PFREY..LQSVAKRLKE..Q.........TGETFVRILKEQEQTV...REK....TSLREEDWDLFLQTLGHLGYLDAKMQIQLLESGKTELAMREEKLRHQLPEQKRVWQSL.GILGGAFLVVILI..........................................
R6GDG8_9FIRM/4-172                  .............................KVIGALIVVTACSLMGFALANEY..IAKINNLDAFKKSLRILKGKIKYDNLSVFEAMELIK...........-IN.NN.......VIENF..YHKVSEVYF-..M.........EEKTLFESWKMAVNKY..lKKE....IKIDKQETDVILTFGTNLGVTDRETQLSNIDECINDIQEVILQLKEEKNNKCKLYKCL.GTFSGILIAVLLI..........................................
A0A0F2SK18_9FIRM/3-169              .............................-ILGCIVLIAGCGSSGLWLANRI..RRRPSELRELLMALALLDTEIVWGATPLPEAFGIVK...........ERT.DT.......PWQEF..YKELQDRLQ-..-.........RGESAGIAWKETILAQ...KAN....FCLKPEDWQVIRDVGKGLGRSDRTEQHKQLELVLRQLTMIKEQADVWSVKQAKMWSYL.GFLGGIAGVLILI..........................................
R6TB59_9FIRM/3-162                  .............................KLIGCVLIISACTQMGCAMALDK..IRQMKYLKLLRRLIFETRAMVDGGM-TFGEIILKLS...........--L.QK.......DYSDF..T-FLSQD---..T.........SSPDVRRRITEDIYNS...---....KLFDNEIRQTAIDFFEKLGTTDTNGQLAYVSMSLAALDEQISRLSENFTSQVRLCRAL.GVLSGAFIAIMLI..........................................
R7HEM6_9FIRM/3-173                  .............................KLCGAVCIVAGTTCYGLFYAFQK..KSRLWRLKQFKESLLCLSGQLRVARMTMPQALAQIG...........QKS.RY......dYLSQF..YIFVSENLEQ..H.........TYSGFWETWAAGIDSY...VRD....IYLTESDSEILKNIGSIPLHLDIQMQLAFLEENISELENLIEETQKDIRARCRIYQSA.GVIAGLVIVLILI..........................................
K4LIS2_THEPS/22-190                 .............................-LLGAVMIIGSAGLAGMLRASYF..SRRPQELRLLQEVLQMLDTEIMYAATPLPDALLKIG...........RTG.EG.......VIARI..FTFAGEALVQ..E.........RGITPAEAWERALRQN...WQL....TALSKEDQAILSAFGERLGISDREEQHKNIALTSLHLRREEEKSQREREKNERLWRYG.GFLLGISIVLLLL..........................................
R5KKD4_9CLOT/5-156                  .............................KILGILLINLVCAATGAYYALKT..KDRCETARQLIQMADMMSVELSFSADNSRKIINRLR...........KEK.SL.......-----..----------..T.........KLGFLNDIDLENIDIK...---....TGLDPADDEKVNMLFRNLGSTDVSSMLKIINSFKESISASLKGYTEYSRSHSRLFVAF.GILGGLAVSIVLI..........................................
R6DUF9_9FIRM/4-160                  ............................a--AGAVLVLSAAILALRRYYARQ..RRCRDLLWSFAAALGEMESAIRWQRTPVLPLLEMLQ...........--T.RE.......HCGVW..FCQIRDKVQ-..-.........SDMTLQLAWENTFHQL...---....-----SDAELRDLLCRISWSGDAQRLESTIARARAEAEQLYEKRREADRHSRR-VTTT.ATLCGAGLMIILLl.........................................
F8I9H1_SULAT/5-169                  .........................kvtg------LVVTGGAILGITRQAGFpyRQRVRVLEEWERALARLVPLIGWRHLPLKDACRLAV...........-KG.LP.......MIGPY..WLRMVASLD-..D.........REVDFLTAFNTMVDHL...---....PGLWAEDRPVLQEVGRLLGQSAAVYQEALLARGLADVSRLLEEARQQSQSDGRVMPAL.VGAVGALLLILLL..........................................
A0A098F2A5_9BACI/3-171              .............................KLAGALFILAATTWTGFELSRNL..SERPKQLRQLKAALQSLEAEIMFGHTPLHEASRRLA...........AQL.PG.......PLCGL..FEKFGERLA-..M.........TETTVKDAWDESLEEI...WKL....TALKKEELEIMRQFGETLGRHDRLSQQKQIQLTLSHLEREEAEARERQSKYEKMFKSL.GFLSGLLVIIVLI..........................................
A0A094WJF3_BACAO/10-178             .............................KLLGAVLILLTTTFVGFEYARRL..SERPRQIRQLMSAMQSLEAEMLYGLTPLSEACSNIA...........KQI.PN.......PISSF..YEAFANKLLA..-.........KEDSAYLAWEQSLDEV...WPN....TALLETEKEIMKQFGATLGQQDHEQQKKQIQLVLTHLKREELEARDKQAKYEKMIKSL.GFLSGVLVVIVLI..........................................
R6ERA2_9FIRM/3-171                  .............................KLIGLLGLVIACGLSGIMKTGDL..KKRVALLEDYLQMIIELKGQINYFREPLPDIFDKLK...........KND.RS.......AAYII..LDSLGTQLRE..-.........KGGEIVKIWPEKVEEI...YKS....EPVTADDMEIMKYPGEFIGQTDFENHIYHFTYLEEKLKKQIIEAQESYKKKGPMYSKI.GFFLGSIGAIILF..........................................
R7KYP0_9FIRM/3-173                  .............................KITGIMLLLFMSAMTGFFAADSL..RRRLCGLKALRNMLESLRLMVRYEALEVTEMVRRLC...........EGE.IS.......SEISF..ISALNELIQS..Ev......etGNMTFSEAWSMAVNEN...--G....GAFTEDDKALICRVGNVLGSCSCDGQLSALSLACEETDRLIIDAGEQYKAKGRLYRAL.GAIAGAVIAVII-v.........................................
A0A0E3JPE3_CLOSL/3-172              .............................KILACIIIIIASTAIGFNYGDSF..KKRTKQLNELQRCINQLQNDMIYTFTPLPEAISNIA...........EKS.KY.......PIKSI..FEEISSLLFS..N.........AVDSAYDAFCKVFNDK...KEV....LNLNKEDLNVILDLAKTLGECDIDGEKRMFSLTLGSLKKQIENSEISMNKNVKMCRYL.GFSLGAMVVIMLI..........................................
B0K9D1_THEP3/2-170                  .............................KLLGIVLVIFSTSSLGYLFALKY..KMRRWILKSMISSLNLFKIEITYSKAPLGEILMAIS...........RSS.DK.......SIKFV..FSKTGMILSQ..N.........EGYTAGEAWEIALKE-...WDN....GYLKKEDVEILRSFGYGLGNSDVYNQEKNFDLAIELLKRQLSNAEEESKKNEKLYKNI.GVLAGLAIIILFL..........................................
R5IGU5_9FIRM/1-147                  .............................----------------------M..RRQQAQTLALIDALLRIRHELQYRLTPLPEIFAALG...........GSR.NR.......EIAEF..FSRLAALLSS..A.........QTCTVGYACRQALAQT...-RG....LSLSSAARGTILNLFDSLGRYDLEGSVQALDLALSRLREEVKALQNSAAARCRTYLTL.GVCTGLAAAVILI..........................................
C0ZBZ1_BREBN/3-172                  .............................KLMGAVLILFSASMVGWQIGKYY..ANRPVQLRALLVALQMLETEIVFGMTPLQRAFVKVG...........HRV.SE.......EVGKV..FLLAAEFLQT..E.........KAHSAEEALQQAMNRL...WTQ....TALRRQEREVLESLGQVLGSSDREDQQKHLRLAVTHLRGLEEEARAEQEKYEKMYKSL.GFLGGLLVVILMF..........................................
R7NNJ7_9FIRM/1-133                  ............................m-------------------SYKL..QRRRKYLSTILLFLNRLQATITFRKDDIEEIVFNLA...........---.--.......-----..-----D----..D.........ELVPLKNAENNHYEKI...IET....LNFNNKDKELLSSFFKDLGTTDIDGELSHIKMYQELFSEQYKLSKEDIKNKGKLYRML.GLFSGLAFVVLFI..........................................
A0A085L6A9_9FIRM/3-172              .............................KIAGCLLIMSAGSFAGISMARNY..ARRPGELRSMVTALQMLETEISYTATPLPEALARIA...........ARC.DK.......AIAPL..FSRASEELYA..Q.........TGCTAGEAWETALNKF...YAL....SSTLPSDLAVLRNLGTVLGISNGEDQCKHLRLAKEQLKGEIITAEQQAAKYVKLWNYL.GLLGSLALILLL-y.........................................
R6GNP4_9FIRM/6-157                  .............................KLIVFVLCAFVGCMAGLLCARRI..CEKENYYKELSNFCSHFKSCVAFRNDEIANVINGFP...........CRS.TL.......-----..-------LK-..-.........SQLYAKANATNEC---...-DQ....GFLNTEEYSVVSDFLYNLGRFDEQTQIEDVMRNKEIFEDNYKSLKEKNAVKRPMYIKL.GLLFGALVGVL--tm........................................
R6R314_9FIRM/4-172                  ............................s--IGICMILAVTTLTGAYFCLRE..KYRLQDLRELERAMVMMESQIRFLSVPLSEVLENIS...........YQT.GG.......QVGML..MEETAKAMAE..R.........TGETAEQIWEAVWMRH...ISH....TYLSGEDYQSILRFGKTLGYLDQEQQKNSTELFLTELRQKCGQIERRLEKNGRLYYSM.GFLGGLMLVIVLL..........................................
Q24UX9_DESHY/3-169                  .............................-WVGALLMIMGCGSLGLYSAARI..RKRPVELRECLTALTLLDTEIFWGNTPLPEAFSILR...........DRT.DG.......AWSGF..FAELSERLH-..-.........KGEGAYGAWNETIEQQ...KKN....FCLKTEDWQVIKDVGKGLGRSDRQEQHKQIELVKQQVSLVKEHAAQWSEKQAKMWSYL.GFLGGAAVVLFLI..........................................
F4XAH5_9FIRM/3-169                  .............................KLVGAVLVAAGSGWLGLSAAAGL..TKRLRAVQSMIVGLELMERELWERGAALPELMAALA...........RRC.SQ.......PAAGF..FQRCAEGCTR..L.........DQVPFGESWRQAVDEL...---....ELLSPDGRAALLPLGEVLGRYEADSQRQALEHARQALEREEQRAQEERRRLGRVYQAL.GLSGGAFLVILLL..........................................
R7R618_9FIRM/4-173                  .............................KTVAAALVLCGAQGFGYALCQEM..KCMLYHDTEQKQMLLYMTREIAFLHRPIQEILEQIG...........EKL.QE.......PYRSL..TLEVACQMKK..E.........DGRSLHTLWNEQTYKL...RER....RYYPPAAMDNLARIGECLGCEEDEMQIASLRLLMGNLDEEIEKIKCRKEERSRLIQTL.SLLAGIFCIVLFL..........................................
A0A0A7FV67_9CLOT/3-172              ............................r-LIILMFIFMSFCFMGYVYGDKF..LKRHKRLNEILKSILLLQNEVIYNLSPLPEALFSIG...........TKS.RE.......PFNKL..FLDVSDILLK..G.........DGESVYEVFKQEYKKN...KED....YYLLEEDERILSDFFKSLGDLGIYGQDKMFDLVIANLKLNIKDAEVIAKKNTKLYRYL.GVCIGAMIVIFLL..........................................
R6XGN9_9CLOT/5-169                  .............................KLIILNLILVSSTIIGITFSKKY..TYRVKELQEMKNALNIFMTKIKFTYEPIPSTFLYIS...........EKV.EG.......NVSKI..FKNATEEM--..-.........ENKPAGEAWDKSLDAI...--V....TNMKKEDIDIIRNLGRLLGKTDIEGQISEIKLVNNFLDIQIKDAEEEKNKNEKMYRTL.GIVAGMTITILLI..........................................
U5MT08_CLOSA/3-172                  .............................KLIFMIMIFTTSSYIGFMYGETF..RKRMNELKEILKALLILENDIIYGTTPLPEALENLC...........FKV.EE.......PIKKI..TKAIEERLIK..G.........NVESVYEGAREEFKVL...ENE....FYLDDSDKKIISDFFKSLGESGVYGQEKIFTLAIEGIKLNLKDAEEIAKKNIKLYRYL.GVCFGAMITIFLI..........................................
H3SFE1_9BACL/3-174                  .............................KLLGSALLIAAAASIGWLKAASY..AARPKQLRLLNHALQRLETAIMYGHTPLAAAFAEIS...........RQL.PS.......PLRAV..FADAAQGMDA.aD........aIPLTAREAWQLSWERH...RGN....TALANEDLRILLELGYSLGISDRDDQRKHIRHAIKQLEQEEFVAREEYQRYGTMCRSL.GVLSGLLAVILM-y.........................................
R5HZJ8_9FIRM/3-172                  .............................KVLGSMLILLASVGFGFQIQMDL..RNHLRLLYDIRKLLLDIANETAYTMDPMEVVLEHAI...........HSR.NP.......YLNEI..CKEMGEGLQK..K.........ERGCGQELWQERIEAW...QKR....LGLSLEEKEIFAGAGCAFFGKSMGENEKSLEHYLERLDYVIDQVRGEQKEKQKVYQTV.SVMCGLIIILLFL..........................................
U5RXC4_9CLOT/3-172                  .............................KFLGCIITICASTGIGFIWGENL..KGRVKQLRELQRCINQLQNEIIYTHTPLPEAILNTA...........SKS.VN.......PIKDV..LEEISHMLKE..N.........SVDSVYEAFNVIFEKK...KDV....LNLKNEDIDALIDLSKTLGESDIEGQKRMFSLALENIKKQIEISEISMNKNLKMYRCL.GFSLGAVVVIILV..........................................
R5Y7U2_9FIRM/2-153                  .............................KYAGLLFVNAACAFAGVFAALRI..REKSRVARLLIEMANMMESMLSFGSEDSVKIIRTLS...........NEK.AF.......-----..----------..-.........AELTFLK--NMDIENI...AVS....TCLNESDNERTALLFKMLGSTDVPSMMNSIEGYKASMELSACKYDEYCKSHAKLFVAF.GLLGGLLLTVLIL..........................................
D7CKG4_SYNLT/7-176                  .............................KIVGGLLTFLACGAYGLAGAKSL..DNRVRQLKSIRFALAILEKEITYLQNPLPRALQKTA...........LLA.EP.......PTRQF..LAVAAGCLER..R.........GGVTAEEAWLEGIKTL...QEN....SDLSETDLFLLQSFASRLGMSDTEEQKKAFQLLGEEIKQLEDSAFKTAATEKKLWTYG.GFLLGTLVVLLLL..........................................
R6H489_9CLOT/5-169                  .............................KYSMLLLVFISSTLIGKYIAQHY..YYRLKELEDIRTALNILKSKIKFTYEPLPEIFNEIA...........KNI.NK.......NIAQL..FENSTKKM--..-.........ENKTATEAWNESIEEY...--K....GNLTEEDKQVIKTLSKMLGTTDSEGQISQIEVTENFLDNQIKQAQEEKNKNEKLYKKL.GSTIGLAIVIILI..........................................
R6XJJ5_9FIRM/3-172                  .............................KVLGSICVLGTSALLGIQKGAEI..QRVYEELLYLQRILYQMQSEIRYLRAPLGDIAGRIG...........RES.RD.......PYKKW..LLSLEREMKQ..R.........DGKSFSTLWEQGVRKH...LGD....IHFPEREISRLCALGSQIGNADMEFQMRTLSLYQEQLAQTLEELRRTMDGKVKLCRSI.GVIGGIFLVILLL..........................................
R5Y419_9CLOT/4-173                  .............................KIILVGMLIGCSYLVGEDISKRY..IKRHKQLNDLIRVLEIIRMDLAFGMYTLEEIFRNIS...........LKD.EY.......DFNEF..FSKFADELSK..E.........DGKTIDNILNETIHIL...YKD....TYLKENEIEEFKKLILSLGKSEVESQERLIDLTVENLKKLTVESKEDIKNKGNLYKKL.ITFSGICIGIILI..........................................
R5QH78_9FIRM/3-172                  .............................KVIGGILILSATAGAGVVYGNEL..KRYLRNMVYLRYVFGLIRGEIEYTCAPLPEIFFGVS...........ARV.KE.......PYRRW..LKKTAEEMEC..R.........DLSGFARVWNRCTDKY...LEI....PGLKQEHKILIKEPGTFLGSFEKDISDRAMEMYLNKMDLEIEKLRAELASKVKVGRCL.GVMAGLFFIVLLI..........................................
C5D483_GEOSW/2-170                  .............................KLVGALLILLTTTWAGFEAARML..HERPRQLRQLKAALQALEAEIMYAHTPLSEAALHIS...........RQI.SS.......PLSKL..FAQFAAKLQV..-.........GETSVHQAWEESLQAV...WKE....TALKQGELEIMKQFGETLGQYDRLTQQKQIALALAHLEREEADARERQARYEKMAKSL.GVLAGLLLVILLI..........................................
I4D8X5_DESAJ/3-169                  .............................-LFGCIALIAGCGSMGLWLAQRI..RRRPEELREFLVALTLLDTEIVWGSTPLPEAFSVLK...........ERT.GA.......PWQSF..FSELQKRLE-..-.........RGEPASTAWNEEIVLQ...SSR....FCLKQEDWRVIRDIGKGLGRSDSHEQHKQLQLVSRQLSMLKDQVGIWAEKQAKMWSYL.GFLCGVAGVLILI..........................................
R6NPU3_9CLOT/3-170                  .............................KTAAALAVALGFALGGKCVASFY..AGRVRVIRESLLLISAVETGVRFAHLTVEQLLRELD...........KNG.GF.......VYLDF..IADCRRRME-..-.........SGEPFPSAWRKSIEQR...GEL....CRLLGEAKEYLAALGSDIGATDVDGQLNSCGYYKRLLTAELEQREEKNRRSSKLFPAL.GVMLGVSAAIMMI..........................................
R7DBE8_9FIRM/3-172                  .............................KLVGAVLIIFASAGLGYLKSKEL..MLHEKNLEEFLQVILCLKGEIRCGNSSLSDALRDTA...........CRC.RG.......RYEEF..LERVAACIEA..N.........TEEKLSIIFQNCTENY...LTD....LKLDEDERRKISLLGEKLGYLDREMQIRQLELYETDFLYLLQNLRKDKEEKKKIYRSL.GAMGGILLAILFW..........................................
R5CZB5_9FIRM/2-169                  .............................KLLGAVLLTAAASVMGFFKAREL..KASSQSLREIISLLELMRNEICTRRTPIKQIFSCSN...........LPD.YR.......YMNSF..ISSLETELSS..L.........GSKSFTQIWCENAEKT...L--....QMLSKSSRQALKDLGSSIGKYDAELQAASIDRCISELSSEYEKLNEGLKNNEKMYIGL.GTGIGLIAAIILV..........................................
G4KPT5_OSCVS/2-164                  .............................KALGSLLILAGFSAAWAGELRRW..RRETETLFQLTAALEALSGGIRLTRTPLPRLFRELG...........RAR.QG.......VVAAW..LTELAEALE-..-.........RGELLRPAWNTACRH-...---....LPVEDDVREVIAELGYKLS-GDEMEICKGIDLVTSWLRKKSEERLRKKRDWTRQATAV.CFSGAALLIILLL..........................................
R5WWV3_9FIRM/3-172                  .............................KFAGILMIFIAGTGMGTAKSMEL..TKRERNLKKFLWLTSCLKGTVRCGNSCFPEAFLEIS...........EKF.DG.......MYQEF..LQSLADRLKG..Q.........KGQTLGQIFRDCAKKE...FRT....AGFSAEEMELIASLGDRLGYLDREMQLRQLDIFEEELCRRLDFLACQLPEKKKLCRNL.GILGGIFLGVLLW..........................................
W6S2T8_9CLOT/4-171                  .............................KIIGSLIILGSTTIAGFILGDIV..KARFEQLMELQKAINIIKNEMIYSFDVLENILLTTS...........KHV.KG.......SISLI..FKRASEIIYA..K.........EVDNVKEAFDKALEEI...--S....HNLNKEDIEVIRAMATSIGNFDVDGESELLNLTLINIERQLKESEELKNKNLKMYRSL.GICIGLIIVIFI-f.........................................
R5UPW6_9FIRM/3-171                  ............................r-IFGTVLILAGCAGFLYKWAEGE..KARQRMAGEWIRLFVRWGYALEQEHVRLCD-FLSFY...........ETA.DA.......SMQAF..LDEVCVCMRN..H.........QNPSGQKIWQDCLQKH...KRE....LQIGQEGWEILTSAAGAFYGESSAENLRCNEICRKRMEKFLAESRLEFFKKQRVYLPV.GMLTGVVMIILLV..........................................
D4LE91_RUMC1/3-165                  .............................KLLGLLLVVGTGGMLGLQKAKQL..QNQAAWLAALEGFLRSMQTEIRYLAPPLEQLLSQLY...........AQP.AY.......QSLTF..LSGTASYL--..-.........GQMPFGQAWSRAVRE-...---....ACSHREAKQVLLQLGGELGNSDIDGQLAAIGLAEERIHMLLESARQQSREKGKLCTAM.GTLLGTLAAILL-a.........................................
R5Z1B3_9CLOT/5-169                  .............................KIVMLFAVFGTISTIGVKISNRY..TERANNLKQIKKALNIFETKIMYTYEPIPDVFLEIS...........KKI.KG.......DVGKL..FWDASRNM--..-.........SLDFAGDAWEKSLNNS...--N....IMLLEDDKEALRSLGKLLGSTDIDGQLSQIRLVNGFLNEQIKEAIEQKDKNETMYKKL.GIIVGLAVVIVLV..........................................
Q5WF48_BACSK/2-170                  .............................KWFGAALILLCSTLYGLEQAKKL..RDRPQQIRQLRVALQALEAEMLYGQTPLAQASENIA...........KQL.EG.......AIGDM..FACFAANLRA..-.........RKQTAMDAWREALEAV...WEE....TALKSGEREVLHQFGATLGTMDRSQQQKQLKLAQTHLEREELEAKETQLRYEKMAKTL.GVLAGLLLVILFV..........................................
U2SH45_9FIRM/3-165                  .............................KLVGAVCILGAGTWAWRRSAAER..RRELDTLADLTALLDRMGEEIRLRRTSLPRLLGSLG...........RDR.TG.......PVRDF..CTSVAASLA-..-.........RGAPLGQSWRSAAEA-...---....LPLGPESRTALTALGDSLQ-GDEESVCKALTLAGKILEKNLAAARDHRQETEKRSAAL.WLSSAALLVILLI..........................................
G2G096_9FIRM/3-169                  .............................-ILGCVALIAGCGSLGLWLANRI..RRRPAELRECLMALALLDTEIVWGVTPLPEAFCIVK...........ERT.DL.......PWQEF..FAELQERLQ-..-.........RGESASPAWKDTISTQ...YKH....FCLKQQDWQVIRDVGKGLGRSDSQEQHKQLELVQHQLTLMKEQAGIWSEKQAKMWTYL.GFLCGIAGVLILI..........................................
R6DUA5_9CLOT/3-171                  .............................KIAGVLLILTGCTGVGLYTAMRY..LIRIHLLEEIEQAMQFIYSEIEYAACDMVEIMHMLA...........ARS.NA.......-CRMF..WCRMEEALLS..C.........EGKLFYQNWKEHITGI...EGY....SCLKTEELLLLQELGKNLGNMNRDAQLHTIRLFLERLHAILLQAKGEYREKRKISGIV.GITAGIFISVLLV..........................................
R4KFS4_9FIRM/3-172                  .............................KLIGGLLVVAASGLAGWQVSRSY..ARRPVELRQFISALQLLETEITYAATPLPEALAGVA...........EQV.DV.......PAASF..FRQIAGDLGA..H.........RGCSAREAWHGALECY...GHR....SALGRGDLSVLRGLGNSIGISDREDQSKHLRLAAEQLKTALAMADAAAAKNVKLWNYM.GLLGGLIIVLAL-y.........................................
B1I3A8_DESAP/3-172                  .............................KLAGAVILIGSAGALGLLVARGY..ARRPHELRAMHSALNLLETEIVYAAAPLAEALEQVG...........SRA.EK.......CVSGL..FIRAQAELAA..G.........AGTTAQEAWEWALAQY...QPD....SYLRPEDLAVLEGVGKVLGTSDRQDQARHLRVARERLQAQILKAEDEARRNVRLWRYL.GFFAGCAVVLILV..........................................
Q0AZG9_SYNWW/5-174                  .............................KLMGAASIITGFGCWGLKAARRM..DRRVEQLQELRLALGFLEKEISCIYSPLSQALAKTA...........DFS.RP.......PVSYL..FAASSSLLQE..K.........TGMTAAEAWNAGIEGL...RLH....SDLQEMEIGLMATASLQLGISDASQQKKLLTLLQEELALLEQKAMQQAEGGRKMWTYS.GFILGAMVVLLLI..........................................
R6YYS9_9CLOT/10-174                 .............................KYILLLAIFALSTAIGLLIAKSY..QNRVVELKEFKNILNIMKTKIKFTYEPLAEIFKQIS...........KDN.ES.......EVEKI..FGQMANQI--..-.........TYYQAKDVWENCIQDA...--D....ISIKQEDKDILKKLGKLLGQTDIEGQISEIEVIENFLDMQIENAEDERKKNQKMYKTL.GIVAGLVFVIILF..........................................
S2KVU5_9FIRM/3-172                  .............................KLSGALLLVLGCAGFGWCTCRDM..ERHIGQLHLLSRAFSMLESEVGYSRATLPEGLIRVG...........NRL.GG.......RLGEC..FINVGKKAQG..P.........EGITFAAAWDEEVAGF...LKE....TCLDKKEEELLLSFPGFTGFVDGQMQLISLEQFGKEIRRAEEKARKETESRKKAVLSV.SMAGGLLIAILLI..........................................
D9QRW5_ACEAZ/3-172                  .............................KLAGSLLIVGATSWLGFLKADQL..IQRTKQLQQLQIAFQALEAEIMYAAVPLPEAMGKVG...........NKV.DS.......PAADF..FLVSKEKLKS..E.........IGITARQAWQEAVEEV...FPN....TALMIEDKEFLLNFGNNLGNSDRTHQEKNLQLVQKELKQAKEASVTAKKSGVKKWRYF.GILGGLLIVILL-y.........................................
A0A0K0GEY4_9FIRM/2-170              ............................n-WIGALLLISTTTWLGFDWSNRL..SNRPKQIRQLKNALQILEAEIVYSQLPLKEAFLNIS...........RQI.PE.......PTRFF..FEEIGLSLQ-..D.........KNIDFYIIWKEKVDAL...INN....SSLAINEKEILYQFGRTIGQHDFYQQQKHIQLTLSHLERELEDAREEQYKYSKMAKSL.GFLAGLFIVLLLI..........................................
R6P608_9FIRM/3-172                  ............................r-LIGAVLILFGTVGIGYDRMRQI..KRHYEGLLDWRECMLKIQGDMQSLKKPLPDIIAELG...........HHA.PE.......VFQSF..FMQVHKELMQ..Y.........ENCSPKSCWKEAWKSW...ENR....EIFTKEEGQLFLECGRLLEQGSGGMFEKEAELLIERINILIQREQTEMRERIKVSMYL.CATAGIFLVLILV..........................................
K4L1Q4_9FIRM/3-169                  ............................v--AGYLGLIIGFGCLGIIRANQI..KKRPQEIREMINALALLDTEIYWGATPLPDAFQVLK...........ERT.GP.......PWQLF..FASLEEWIR-..-.........AGENASQAWKKSIETH...RRK....TCLTDDDWLVISGISQGLGRSDRNEQHKQLELVQRHLAGVDEKARQQAESRAKMWSYL.GFLGGIAVVIMIM..........................................
G2TPR1_BACCO/3-171                  .............................KLFGAALIVFATSFIGFEAAKRL..SERPRQLRIFQSALQALEVEIMYGHTPLHEAARKLS...........DQL.PD.......PAAAF..FRSFAGQLTT..-.........LETTVKEAWEKSLDGI...WEL....TALKENEYEVLRQLGENLGKHDRYTEQKQLLLALSHLEREEKEAHERQLRYEKMAKSL.GVLTGLLIAILLI..........................................
E3E4Y7_PAEPS/3-172                  .............................KLLGAVLVILATTLAGWQRARQF..AMRPRQIRELILALQRLTTEVSYGVSPLPDAFAKTG...........EPL.RE.......PLRSL..FQQASRWMHP..S.........FGLTARESLHKAIEVS...WSR....SSMKQAEKEAMRQLAYSLGTSDREDQIKHIALTIQQLSHEEAQAQADQVRYERMSRSL.GLLIGALIVILI-y.........................................
A0A023CLT6_GEOSE/2-170              .............................KLIGAMLILLTTTWFGFEAARML..KERPRQLRQLKAALKVLEAEIMYAHTPLSEAALHIS...........KQI.SL.......PLSKL..FEQFAAKLQK..-.........EETSVQQAWEESLQTV...WSS....TALKQGELEIMRQFGETLGQYDRLTQQKQIALALVHLEREEADALERQARYEKMAKSL.GVLTGLLLVILLI..........................................
R5UCV0_9FIRM/3-172                  .............................KLIGCILILLSTTAGGFLYGVEQ..QQYLEKLMYIRHILELIQGEIEYSGAPLFEVFGKTA...........NRV.QE.......PYRSW..MLDLKRRVEA..R.........GGQSFRGIWEACTETK...LKE....LHLKSRHMRELSEVGMYLGQMDVRTGRTSMQMYLENLGAEIEETRQEITAKKRIGNWL.GVMSGLFLVIVLF..........................................
R6DM84_9FIRM/3-171                  .............................KFAGIVGLVAALGLIGILKAEEL..KSRVKDLEDFLRMCLFLKSKINYLREPLTYAYSTGN...........SGS.GN.......RADLL..LHEVFVEIDE..-.........KQGEIEEIWAQKANEI...YKT....SRLTKADMNYIRYPGKFIGQTDYENQLYQFEYIQSSLENQIKEADEELKRKGPLYRKL.GFFAGALIGIILF..........................................
C9R8Z9_AMMDK/3-172                  ............................r-WLGAGLVVLAGGMAGQELSRDY..LCRPRELRGLLGGPNLLQTEISY-ATPLPEALARVG...........KRL.KG.......PVGEL..FCLVADRLAA.gA.........GGNGAGVVWEEALDSF...RSR....MALKEEDLEVLRLLAGVLGTSLKEEQERHLTLARERLKLALTLAEEEARRYARLYRFL.GWGAGVGLAVLLL..........................................
R7N2Y4_9FIRM/4-171                  .............................-IMGSLLVILGAFGFSVSLCLEY..RMRLMLLKQIRGVYEYMEFQISYGKLPIPEILRKLS...........FKD.EL.......CFRQE..FGRIAQRMEE..-.........GGQELAVIWKEELGPS...LRK....SGLKKKEQEWLLAFPLKQGFLIGQAQAESLGEIRRELEDGIQSLQQEQKSRSKVIMSV.GVAGGVLLSILFL..........................................
R5NHY8_9FIRM/3-172                  ............................r-IVGCILLVAAGTGMGFSGSMKL..SERIYTLEMLLRMGIFLKGEIRCGNMSLPDAFYGVA...........GRM.DG.......KYREF..LISAADRMKS..G.........TGETLSQICRECAETS...LKK....SCLTSGEKDAFFSLGEHLGYLDLEMQMKQLSLYEENLEEEISRLKEEASVKKRLYRSL.GILGGLLLAVLLI..........................................
D3FUV9_BACPE/2-170                  .............................KLFGALLIILVTTAVGFELARRL..NERPRQLRTLKVAIQALEAEILFGLTPLAEASHNLA...........KQT.PK.......PISYL..FEYFSYKLR-..H.........TELPAYAAWDESIAEM...WSL....TSLLESEKEILKQFGQTLGQHDRSQQEKQIKMTLAHLEREEGEARDRQHRYERMVKSL.GFLTGLLIVILLM..........................................
A0A0F2PSX6_9FIRM/3-172              .............................KLAGALLIIVAGGAAGIIRAREY..MRRPGELKSILASLQMLETEITYAATPLAEALERVA...........AAG.GR.......EMGGL..FAGAAAELRA..M.........SGCTAAEAWQKSLQSF...YPA....SALRESDLSILYNLGSALGISDRQDQSKHLRLASEQLKLEAARAGDEATRNVKMWNCM.GFCGAAALVFLI-y.........................................
A0A075R476_BRELA/3-172              .............................KIGAAIVVLVSASLIGIQLGKRY..SDRVKELRALLHSLQMLETEIVYGATPLSLAFEKIS...........VRV.TH.......SIGNL..YKRASELLQT..N.........AGESTQMVWQTALEQT...WSL....TALRKEEKEILKNLGYVMGNSDREDQKKHLQLTVFHLRGLEEEAKEEQLKYEKMYKNL.GFLGGLLIVILMM..........................................
R7A1H9_9FIRM/3-170                  ............................q-LFGCLLVIAGCVGFAYLMCLEL..SDRIRFLKEICRIYEELQYYIAYQRTPVSEAMKAMA...........RKQ.EP.......LLGEA..LCEVAEGME-..-.........KGKELQKLWQQSIGEA...LLK....TPLKEEERRLLLDFPGRLGYLEGQAQAEAFAEPLREAQRRIAQLYEVQKNRNKVVMSL.GLAGGILLSLVLV..........................................
A5D344_PELTS/3-172                  .............................KLAGAALIVAASGLSGMAVAGSY..SRRPGELRALRAALQMLETEIAYGASQLPEAFSRVA...........GCC.EE.......AAAPL..FRRAAAELSA..M.........SGITAAEAWEKSLAGY...YPG....TALKPRDLSILRNLGSSLGISDRNDQIKHLNLAKEQIELEAVAAEAEASRNVKLWSYL.GFLAGLAAVLVL-y.........................................
B7GHE8_ANOFW/2-170                  .............................KWIGAVCIILATTWSGFEASRLL..RERTKQLRQLKMALQSLEAEIMYGHTPLIDASLRLS...........QQL.SR.......PLSWL..FESFAQKLQK..-.........GTMNARQAWEESLHEI...WKM....TALKEGELEIMKQFGETLGQYDHEIQQNYIRLTMVHLEREEGDAIEKQQRYEKMMKSL.GVLTGILIVLLLI..........................................
A4J3D9_DESRM/3-172                  .............................KIIGAAVVVFFCTLIGMTVASGY..SRRPGEIRALLNALQILETEIAYGATPLPDAMTSVA...........ERC.DP.......RVALL..FSRAGTELMS..M.........RGITAREAWQTALSQY...YPK....SSIAKTDRAILVELGTSLGMSDREDQIKHLVLAKEQLKLEHAKAEEASLKNTKVYHYL.GFLGGLTVVLILI..........................................
R5WDN8_9FIRM/2-78                   ......................avlsdls-----------------------..------------------------------------...........---.--.......-----..----------..-.........----------------...---....-AVRADVVEEIGRLGDILGDMDVDAQISRISLIENIITDKYERERNRNGGIRKLSNSL.GILAGLFIVIMLL..........................................
I7LKN7_9CLOT/3-172                  .............................KLIGGLIIIIASTITGFYISHLL..YEKVRQLRELQYALQILESEIIYSAEPLYVALSNLS...........LKV.NE.......PLKAL..FIDLANSIKD..F.........EKDTLHDIFINSFDRH...KDR....FLLEKEEIEVLVSFFSSLGTSDLEGQKKNFNLTMKKLDMLEKKADDKRQRNDKLVKYL.GFASGILIVVILV..........................................
G8LWK3_CLOCD/4-171                  .............................KIVGSLIVFVSCTLLGYSHAQTY..AQRPQELKTLQMLLQIFENEISFLSNVLQEAFQKVS...........SCT.DS.......SVAVF..FEAAVENLK-..-.........EGLCADEAWTKAVKEN...ISG....TSLNSEDEAIIISFGKMLGSSDLEGQIKNIRLTVNQLKIQEQKAEELRSKNEKMFKSL.GVLCGLAIIILLF..........................................
Q9K954_BACHD/2-170                  .............................KLLGAIFILMATTWAGFELARRL..HERPRQLRQLKVALQSLEAEMVYGLTPLAEATGHIA...........AQM.PK.......PVSYL..FEHFSYRLKE..-.........KEETVYDAWEAAINET...WKY....TALLASEREVILQFGATLGQHDREQQQKQVRLTLAHLEREEGEARDKQYRYERMMKSL.GVLAGLLIILMML..........................................
R5DH03_9FIRM/5-160                  ............................v--LGSLLLLGGALWLWLGLVQAQ..RRQLRLLEELAASLEQMASAIRFRRETLLRLLAAQR...........QRP.LA.......--GPY..YGAVLAALE-..-.........EGISFPAAWRQGFAA-...---....--LSGEGGRILRRLEP---EGDEQRILGELTWAAGELTELRRGLEQESRQREKLWFAG.LFSGAGLLLILL-i.........................................
D4LPN5_9FIRM/3-172                  ............................r-IVGCILVVAAGAGMGFSGSMRL..SEQIRILEKLLQMVICLKGEIRCGNASLPDAFYGAA...........GRM.NG.......KYREF..LISAADRMKA.gT.........GEKTFTDMQGMCGKRP...EKK....LPYPWG-KGRFFSFGEYLGYMDLEMQMRQLSLYENNLEAEILKRKAEVSGKKKLYQGI.GILGGLLLAVLLV..........................................
A0A075KBE0_9FIRM/4-173              .............................KIIGSILVLITSSYIGFKMAASC..QERPRHLRQIISCIASMRSYILYARVPLHEAVAQCT...........NGI.YG.......PVATF..FQKIAAMLEK..Q.........TILTPQEVISKVLHEM...QGS....LMLKTPEIEVLHVLGGNLGHMNCTEQEKYLLLVIEQLERFENEATRLRDLNTKMYRYL.GVCGGMAIVIILV..........................................
R6LMJ0_9FIRM/3-172                  .............................KMLGAACVIFSASAVGFGFSGNV..RRQCAQLTALIEALTYLKSEMLYRRTPLPQAMGMLA...........EHS.AD......aAVGGL..FAKAAEKLEE..S.........CTLSVHAAFRAALGMA...-DG....LVLSAQTRQALLSLSLSLGQLDLDGQERALELASERLSAQLRLLEQGRSARCRSYATI.GICAGMALAVILL..........................................
R6SV52_9CLOT/5-158                  .............................KIIGTLFVCGAGIGFTVFAIRFE..RCKLQILDAYIALIFYIKGQIDSCAMPIGEILRGAG...........RAL.AE.......----F..-PALA-----..-.........----VISPDEDPIDKS...-SV....YYLDRESLRLLRSFFSELGSLYREEQLRRCDYYIEALTSQRQKLHEMLPARLRLVCTL.VLCTAAGITILLW..........................................
R6CWK5_9CLOT/3-162                  ............................l--WGRVLLFLCLSSIGITMGTRV..HKRRELLLLSSQLLGTLSAELTFCQKSADALILELA...........AKS.PF.......DSLGY..LRKFCSL---..-.........PKAPFPKRWKQAVEQ-...---....SVQGGEDREMLLLVGQVLGAYDLNTQLKELCQLREKMTAKAQELLEEDIRERRLYTAL.GPLMGLAVCILI-..........................................
R6VE33_9FIRM/3-172                  ............................r-VAGACLILSASSLLGVQKSRQF..TKRIEQLQELQRIVLLIQGEILYKNAALPEALRSSA...........GKV.KV.......PFDSF..LRQTAGRADA..F.........DGVRFSDLFETEIKEQ...LKG....TALTKEDKEEFARFGESLGYLDVEMQKNAMKLYLKELEQKIEYLQKEIPPKRKLYQSL.GVMGGIFLLILLW..........................................
R6TRE8_9FIRM/3-160                  ............................r-VLGIILICTAAGGSGMLYAASL..NREYEKLLGFIRLIRFIGTRIECFSQPLMTVYADFS...........DPA.LD.......SCGFT..-----GA---..L.........REDGFTTALCRCRDE-...---....LCLDDAVFGILSEFGDGLGKSFSDDQVKHCARYADMLSERASELEKTLPGRKKTAVAV.SASLAVMAAVILL..........................................
R7L7Y5_9CLOT/5-169                  .............................KVFIFAMIIGTSSAIGLMLAKKY..TNRELELKEIKNALNMFENKIKFTYEDIPTVFKDIS...........KKI.NG.......NVGNI..FKNASEKM--..-.........QNMQAGEAWKYALENT...--Y....TSLKKADIDIIKGLGRMLGKTDLSGQISEIKLVNNFIDAQIEDAKQEKDKNYKMYKTL.GIVVGATIVIIL-a.........................................
R5K248_9CLOT/5-174                  .............................KILGMLLVVAASYGIGKTIGVYQ..NRRVEDIYELLIFVRMANGHLAYSASEITEIIREGS...........DKA.GG.......RIGDW..LAGLALQFRT.eE.........YASSFEQIWTGSIGSL...MEH....SYLTDAQIGAVKELGKWLCYMDVDMQIRNLKLWEQNMQAEYEEQKDRARRINKVSRSL.GLLGGIFLIILI-..........................................
K6DNH1_9BACI/3-171                  .............................KLIGAIIIIVATTWTGFEASRNF..SARPKQLRALRSALQSLEAEIMYSHTPLHEAARRLA...........AQL.TK.......PLSTF..FEAFARKLT-..D.........TETTVNEAWETSLREV...WKS....TALRQGEFEIMKQFGETLGRHDRFSQQKHIMLTLSHLEREEADAIDRQAKYEKMVKSL.GFLSGLLLIILLF..........................................
K6UC52_9CLOT/3-172                  .............................KLILAMCVFLISTYIGFSYGETF..RKRQAQLKEILKALTILENEIVYGATPLPEALENLS...........HKV.DK.......PLSDF..IKAISDRLIK..G.........DVESVYEGALEEYSRF...KNE....FFIYDDDKKVLGDFFKSLGESGVYGQEKIFFLAVEGIKMNLSDAEDNAKRNIKLYRYL.GICLGAMIVIFII..........................................
C4Z0I3_EUBE2/4-172                  ............................y--IGGILILSGCFMYGLSYSQRL..KNRIIILKDMVRMLSVMNNHIGYSLIDMTQIFERLG..........dFDM.CS.......YVRNF..TGYIYEALNK..S.........DIDTFALIWNEAADKA...-FA....GILGKRQLEIIKEAGSISTFIDKDSQLKHIQSVVCELNEELDVVKTNAAGKMKAYIVT.GISAGLILVIVLI..........................................
A0A0F2NK71_9FIRM/3-172              .............................KIIGSLMLVTAGGVAGMMVAREY..AKRPGELKALLSAIQMLETEIMYTATPMAEAMERVA...........AGA.DR.......RVAGF..FRDAALDLKS..M.........AGRTAGEAWQAAMDRF...YPR....CSLSGGDMSILGNLGGALGRSDREDQAKHLRLACEQIKMEIIKSEEDASKNTKMWNYL.GFCGALAAVIIL-y.........................................
A0A089ILM4_9BACL/3-172              .............................KLFGAVLIVLAGTLAGLQFAKQY..ADRPRHIRGLIAALQRLETEIMYGFTPLPEAMRRIG...........IQS.KE.......PLKTL..FIKTAEEMSP..P.........HDRSAQDAIQRAMDSH...WKS....TALKGTEKEILRQLSCTLGTSDRSNQSTHIALALQQLKQEESVAREDQGKYEKLSKSL.GLLLGALIVILI-f.........................................
I9AZW5_9FIRM/3-172                  .............................KLIGSLLVLLVSSYIGFKMASRC..QERPRQLRQIITCVGSLRSHIIYSCLPLHEAIANST...........NGI.YG.......PVAEF..FQQVANLLEK..N.........ASLTPQEIIKKVLREM...EGS....LILKRPEIEVLYVLGGNLGVMNCKEQEKYLSLVIEQLERFENEATRLRDLNTKMYRYL.GICGGLAIIIILV..........................................
R6B816_9CLOT/5-171                  .............................KYILIFFVFLAFTYIGNTYSKKY..VNRVQELEKMQNLLNIFKSKIKFTGLTIQEIFNQIY...........DDN.KD.......VVGDI..FKRASLNM--..-.........ENMSAKDGWKKAIEES...QDK....LSLNKEDFTAIETLGKMLGNTDVEGQVSQIELTEKLIEDQIENAKIEKQKNTKLYKTL.GVTVGLTAVILLL..........................................
A8MFK1_ALKOO/4-173                  .............................KIICSIVIIACSSLVGIIFSNTY..IERTGLLSHLISTLQIIETEILYGATPIPVLLEKMG...........SRS.KK.......EIGCI..FLSASNLLKE..N.........KGQPFEEIWSIAVNKE...IKN....TSFSKNDIEILLSLGKNLGLSNSEDQIKHIRLIQEEVKRQHENSIIEEKKNVKLFKNL.GFLLGLSIVIVLF..........................................
R5Y7F5_9CLOT/5-157                  .............................KYIILFFIFWTSSFIGILVSKRY..SNRVKELQEMKSALLMFEAKIKFTYEPIPEIFKEIS...........NKF.SE.......HIEEL..FENSVTKM--..-.........KNKSASVAWCESIEES...--N....NNMNKEDKEVLKGLSKLLGKTDINGQISEIKLVSNFLDTQIQIAQKEKEKNGKMYKTL.-------------r.........................................
F2JME2_CELLD/3-173                  .............................KLLAIGLVLIGCILGGIWLDEDQ..KKRIEELGKFIYLFELLKAEIDYRLTPLKEACLIVG...........KRT.NN......kSIDAV..MMGFAKSLED..K.........ESVRVEEMWENAINAQ...KQA....FHLQAEDYKLLYSFGGACGYLDKNMEKRNIEMVLEQLRQSTKEAKEKYQKTSKLNRSL.GVLVGLGLSIFLL..........................................
R5ASR1_9FIRM/1-70                   ............................m-----------------------..------------------------------------...........---.--.......-----..----------..-.........----------------...---....--LTPDVRAALLTLGEQLGKYDAQIQRRALDTCIETLQAAAAQMQADTTQRGKLFCGL.GATLGLLAAVAL-f.........................................
R5DS37_9FIRM/4-164                  .............................KLIGCLLVVCTGTMIGFVLSGRL..YKRRDFLKSFTEFISLLATNLRYSGDDIFTLVNSCA...........ENS.SL.......DLLLF..----SE----..-.........CDRPFDELWLERVKRL...SSE....IPLSKSDISMLNDFGGQLGKTDTEGQLKHLELYEVSFSKQLSSALDAITKKSKLYKTM.GFFAGSAIALMMI..........................................
R6PFL3_9FIRM/3-172                  .............................KIIGAVLVIFACAALGYKKSAAI..SDRLFLLREIEKLLLLLMGEITYRREALPEAVLRVS...........GKV.QE.......PLCSF..LKETAETAQK..Y.........QGERFACIFRENAEKY...LKN....SELTQKDFEEFVQLGEYLGYLDTDMQKNTTQWYLQQLKTEIDILAGEIPVKKKLYRSL.GVLSGIFLAILLL..........................................
A5Z6N6_9FIRM/4-173                  .............................KITGIVLIMMSASLMGYLFSKDY..IERINRLEQIQKMLILLKGEISYSNNSVQEALENIS...........EMI.EG.......KVGEF..VTKVQESFKK..-.........SEIPLSVAWSLGVDNI..fDKK....SSLKSEDKNSLKDFGRGLGITDRQTQINNIEKYQSQIQLTIKELKAEKNEKCKLYRML.GITCGAFLGIVLI..........................................
#=GC seq_cons                       .............................KllGsllllhusshhGhhhupph..pcR.cpLcpltphLphLcsEItYstsPLs-shpplu...........pph.pt.......shsth..atphuppltt............pstshtpsWppslpph...htp....tsLppp-hclltphGpsLGppDtpsQhcplpLshppLcpphppuccptpcptKhapsL.GhhsGlhllIlLh..........................................
//
DBGET integrated database retrieval system