GenomeNet

Database: Pfam
Entry: Sulf_coat_C
LinkDB: Sulf_coat_C
Original site: Sulf_coat_C 
#=GF ID   Sulf_coat_C
#=GF AC   PF12193.6
#=GF DE   Sulfolobus virus coat protein C terminal
#=GF PI   Sulf_coatprot_C;
#=GF AU   Mistry J, Gavin OL
#=GF SE   pdb_3f2e
#=GF GA   25.00 25.00;
#=GF TC   25.60 165.10;
#=GF NC   22.80 16.10;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF DR   INTERPRO; IPR022014;
#=GF CC   This domain family is found in viruses, and is approximately 70
#=GF CC   amino acids in length. It is the C terminal of a coat protein in
#=GF CC   sulfolobus viruses.
#=GF SQ   1
#=GS CAPSD_SIRV1/59-127  AC Q8QL36.1
CAPSD_SIRV1/59-127             VSAVLSQYGITGPNRAIYQGFGLKIARALNRIGSGPALVNMINGLKSYYISAFNANPQVLDAVVNIITG
#=GC seq_cons                  VSAVLSQYGITGPNRAIYQGFGLKIARALNRIGSGPALVNMINGLKSYYISAFNANPQVLDAVVNIITG
//
DBGET integrated database retrieval system