GenomeNet

Database: Pfam
Entry: Sulf_coat_C
LinkDB: Sulf_coat_C
Original site: Sulf_coat_C 
#=GF ID   Sulf_coat_C
#=GF AC   PF12193.3
#=GF DE   Sulfolobus virus coat protein C terminal
#=GF PI   Sulf_coatprot_C;
#=GF AU   Mistry J, Gavin OL
#=GF SE   pdb_3f2e
#=GF GA   25.00 25.00;
#=GF TC   38.40 136.40;
#=GF NC   22.50 17.90;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Domain
#=GF DR   INTERPRO; IPR022014;
#=GF CC   This domain family is found in viruses, and is approximately 70
#=GF CC   amino acids in length. It is the C terminal of a coat protein in
#=GF CC   sulfolobus viruses.
#=GF SQ   5
#=GS Q8V9P2_9VIRU/59-127  AC Q8V9P2.1
#=GS D0VX05_9VIRU/15-83   AC D0VX05.1
#=GS D0VX05_9VIRU/15-83   DR PDB; 3F2E A; 59-127;
#=GS CAPSD_SIRV1/59-127   AC Q8QL36.1
#=GS B6EFC1_9VIRU/59-127  AC B6EFC1.1
#=GS Q50I47_9VIRU/59-127  AC Q50I47.1
Q8V9P2_9VIRU/59-127             VSAVLTQYGITGPNRAIYQGFGLKVARALNRIGSGPALVNMINGLKGYYISAFNANPQVLDAVVNIITG
D0VX05_9VIRU/15-83              VSAVLSQYGITGPNRAIYQGFGLKVARALNRLGGGPALVNMINGLKAYYISAFNANPTVLDAVTDIITG
#=GR D0VX05_9VIRU/15-83   SS    HHHHHHHHT--GGGHHHHHHHHHHHHHHHHHH-SSHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHS
CAPSD_SIRV1/59-127              VSAVLSQYGITGPNRAIYQGFGLKIARALNRIGSGPALVNMINGLKSYYISAFNANPQVLDAVVNIITG
B6EFC1_9VIRU/59-127             VSAVLTELGVTGPNRAIYQGYALKVARALNRLGGGQALVNMINGLKAYYISAFNANPSVLDAVTNIITG
Q50I47_9VIRU/59-127             VSAVLTQYGVTGPSRAIYQGFGLKVERALNRIGSGPALTNMINGLKAYYVSAFGANPEILDAVTNIITG
#=GC SS_cons                    HHHHHHHHT--GGGHHHHHHHHHHHHHHHHHH-SSHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHHS
#=GC seq_cons                   VSAVLTQYGITGPNRAIYQGFGLKVARALNRIGSGPALVNMINGLKAYYISAFNANPpVLDAVTNIITG
//
DBGET integrated database retrieval system