GenomeNet

Database: Pfam
Entry: Synaptonemal_3
LinkDB: Synaptonemal_3
Original site: Synaptonemal_3 
#=GF ID   Synaptonemal_3
#=GF AC   PF15191.4
#=GF DE   Synaptonemal complex central element protein 3
#=GF AU   Eberhardt RY, Coggill P, Hetherington K
#=GF SE   Jackhmmer:A1L190
#=GF GA   27.00 27.00;
#=GF TC   72.90 72.80;
#=GF NC   24.40 23.80;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 17690987 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF WK   Synaptonemal_complex
#=GF DR   INTERPRO; IPR028145;
#=GF SQ   34
#=GS H2RBX9_PANTR/1-85       AC H2RBX9.1
#=GS E7D6R1_MOUSE/1-85       AC E7D6R1.1
#=GS G3IM77_CRIGR/1-85       AC G3IM77.1
#=GS S9XNJ1_9CETA/6-90       AC S9XNJ1.1
#=GS R4GBT4_ANOCA/1-85       AC R4GBT4.1
#=GS W5QFA2_SHEEP/1-84       AC W5QFA2.1
#=GS SYCE3_MOUSE/1-85        AC B5KM66.1
#=GS SYCE3_MOUSE/1-85        DR PDB; 4R3Q A; 13-85;
#=GS SYCE3_MOUSE/1-85        DR PDB; 4R3Q B; 12-85;
#=GS B3DHF5_DANRE/1-91       AC B3DHF5.1
#=GS L9JFD6_TUPCH/1-85       AC L9JFD6.1
#=GS G1U293_RABIT/1-85       AC G1U293.1
#=GS H0XKE1_OTOGA/1-85       AC H0XKE1.1
#=GS H1A4T8_TAEGU/1-83       AC H1A4T8.1
#=GS W5KM33_ASTMX/1-92       AC W5KM33.1
#=GS G3MY06_BOVIN/1-85       AC G3MY06.1
#=GS D3ZDD6_RAT/1-85         AC D3ZDD6.1
#=GS G5E7G0_LOXAF/1-73       AC G5E7G0.1
#=GS G7PG76_MACFA/1-85       AC G7PG76.1
#=GS J9P675_CANLF/1-85       AC J9P675.1
#=GS F7H7Y4_CALJA/1-85       AC F7H7Y4.1
#=GS M7AQF4_CHEMY/1-85       AC M7AQF4.1
#=GS SYCE3_HUMAN/1-85        AC A1L190.1
#=GS G5B2G1_HETGA/1-83       AC G5B2G1.1
#=GS I3NHA5_ICTTR/1-85       AC I3NHA5.1
#=GS F6PQ54_HORSE/1-84       AC F6PQ54.1
#=GS H3A163_LATCH/1-85       AC H3A163.1
#=GS G3QK37_GORGO/1-85       AC G3QK37.1
#=GS A0A0D9QXN7_CHLSB/1-85   AC A0A0D9QXN7.1
#=GS G1PYV3_MYOLU/1-85       AC G1PYV3.1
#=GS D2H6D0_AILME/1-85       AC D2H6D0.1
#=GS L5K7L9_PTEAL/1129-1211  AC L5K7L9.1
#=GS L5LG90_MYODS/1-85       AC L5LG90.1
#=GS A0A096NL54_PAPAN/1-85   AC A0A096NL54.1
#=GS F1RXU0_PIG/1-85         AC F1RXU0.2
#=GS M3WXL6_FELCA/1-85       AC M3WXL6.1
H2RBX9_PANTR/1-85                  .MDDADPEERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFVNCK-------EEMEKNWQELLHETK...
E7D6R1_MOUSE/1-85                  .MADSDPGERSYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFLNCK-------EEMEKNWQELLTETK...
G3IM77_CRIGR/1-85                  .MADSDPGERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFLNCK-------EEMEKNWQELLTETK...
S9XNJ1_9CETA/6-90                  .MADSDPGERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFLNCK-------EEMEKNWQELLSETK...
R4GBT4_ANOCA/1-85                  .MAKCETYERNYDNIVKQLEDLNRDLEKLLEDMEKLSVQATWMAYDMVVMRANPELANSMRRLEDAFLTCK-------EEMERNWQEMLKETK...
W5QFA2_SHEEP/1-84                  .MADPGPGERSYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPALAEAMRRAGGGLPR-K-------EEMEKKWQELLSE--ar.
SYCE3_MOUSE/1-85                   .MADSDPGERSYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFLNCK-------EEMEKNWQELLTETK...
#=GR SYCE3_MOUSE/1-85        SS    .XXXXXXXXXXX-THHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHT-...
B3DHF5_DANRE/1-91                  .MSGGLSDVQLCEDFSSESLQLNQHLEKMTEQMEDVSVKLSCMTYDMVVLRTSPDLAESFKSLENEFQKCKAVLCGLTDGQEVKCHP--ADE-eq.
L9JFD6_TUPCH/1-85                  .MADSDSGGKNYDSMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFLNCK-------EEMEKKWQELLAETK...
G1U293_RABIT/1-85                  .MADSDPGERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFLNCK-------EEMEKNWQEMLRETK...
H0XKE1_OTOGA/1-85                  .MADSDSGERSYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVIRTNPMLAESMRRLEDAFLNCK-------EEMEKNWQELLNETK...
H1A4T8_TAEGU/1-83                  .MDESESQKENYYNEGKMVENFNMDMEELLDEMEKLTVRAAWMAYDYVAIQTNPGPYNAMQHLEDAFLMCK-------EQMEKKWQEVL----le.
W5KM33_ASTMX/1-92                  .MVDGSSSGEQHADFGRESLQLNKDLEKMTEQMENVSVHLTWMAYDMVVLRTNPQLAKSLRRLEDEYLKCKAVICSSADKDNAAVHSVTGDQE...
G3MY06_BOVIN/1-85                  .MADPDPGERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPALAESMRRLEDAFLNCK-------EEMEKKWQELLSEA-k..
D3ZDD6_RAT/1-85                    .MADSDPGERSYDNMLKMLSDLNKDLERLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFLNCK-------EEMEKNWQELLTETK...
G5E7G0_LOXAF/1-73                  .MADSDPGDRNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVIRTNPTLADSMRRLEDAFFNCK----------------------eem
G7PG76_MACFA/1-85                  .MADADPEERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFVNCK-------EEMEKNWQELLHETK...
J9P675_CANLF/1-85                  .MADSEPGERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFLNCK-------EEMEKNWQELLNETK...
F7H7Y4_CALJA/1-85                  .MADADAEERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPMLAESMRRLEDAFLNCK-------QEMEKNWQELLHETK...
M7AQF4_CHEMY/1-85                  .MAKSEPRERNYDNMVKMLEDLNRDLEKLLEEMEKLSVQATWMAYDMVVMRTNPDLANSMRRLEDAFLNCK-------EEMEKNWQEMLKETK...
SYCE3_HUMAN/1-85                   .MDDADPEERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFVNCK-------EEMEKNWQELLHETK...
G5B2G1_HETGA/1-83                  m---ADPGERNYDNMLRMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTDPALAEFMHRLEDAFLNCK-------EEMEKSRQELLSETK...
I3NHA5_ICTTR/1-85                  .MADSDPGERNYDNMLRMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFLNCK-------EEMEKNWQELLSETK...
F6PQ54_HORSE/1-84                  .MADSDPGERNYDNMLKMLSDLN-DLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFLNCK-------EEMEKNWQELLSET-t..
H3A163_LATCH/1-85                  m-AESELCEKKHDNILKMLCDLNRDLEKMLEDIEKISVQTTWMAYDMVVMRTNPALTDSMKKLEEAFLNCK-------EEVERNWQEMLSETK...
G3QK37_GORGO/1-85                  .MDDADPEERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFVNCK-------EEMEKNWQELLHETK...
A0A0D9QXN7_CHLSB/1-85              .MADADPEERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFVSCK-------EEMEKNWQELLHETK...
G1PYV3_MYOLU/1-85                  .MAESDPGERNCDNMLKMLSDLNKDLEKILEEMEKISVQATWMAYDMVVIRTNPTLAESMRRLEDAFLNCK-------EEMEKNWQELLSETK...
D2H6D0_AILME/1-85                  .MADSDPGERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVIRTNPGLAESMRRLEDAFLNCK-------EEMEKNWQELLNETK...
L5K7L9_PTEAL/1129-1211             .--DSDPGERNYDNILKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAEAMRRLEDAFLNCK-------EEMEKNWQELLRET-a..
L5LG90_MYODS/1-85                  .MAESDPGERNCDNMLKMLSDLNKDLEKILEEMEKISVQATWMAYDMVVIRTNPALAESMRRLEDAFLNCK-------EEMEKNWQELLSETK...
A0A096NL54_PAPAN/1-85              .MADADPEERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFVNCK-------EEMEKNWQELLHETK...
F1RXU0_PIG/1-85                    .MAESDPGERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWLAYDMVVTRTNPTLAESMRRLEDAFLNCK-------EEMEKNWQELLSETK...
M3WXL6_FELCA/1-85                  .MADSDPGERNYDDMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFLNCK-------EEMEKNWQELLTETK...
#=GC SS_cons                       .XXXXXXXXXXX-THHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHT-...
#=GC seq_cons                      .MADSDPGERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMRRLEDAFLNCK.......EEMEKNWQELLsETK...
//
DBGET integrated database retrieval system