GenomeNet

Database: Pfam
Entry: TEBP_beta
LinkDB: TEBP_beta
Original site: TEBP_beta 
#=GF ID   TEBP_beta
#=GF AC   PF07404.6
#=GF DE   Telomere-binding protein beta subunit (TEBP beta)
#=GF AU   Moxon SJ
#=GF SE   Pfam-B_20928 (release 10.0)
#=GF GA   20.70 20.70;
#=GF TC   20.90 424.90;
#=GF NC   18.50 20.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   9875850
#=GF RT   Crystal structure of the Oxytricha nova telomere end binding
#=GF RT   protein complexed with single strand DNA. 
#=GF RA   Horvath MP, Schweiker VL, Bevilacqua JM, Ruggles JA, Schultz SC; 
#=GF RL   Cell 1998;95:963-974.
#=GF DR   INTERPRO; IPR010874;
#=GF DR   SCOP; 1jb7; fa;
#=GF CC   This family consists of several telomere-binding protein beta
#=GF CC   subunits which appear to be specific to the family Oxytrichidae.
#=GF CC   Telomeres are specialised protein-DNA complexes that compose the
#=GF CC   ends of eukaryotic chromosomes. Telomeres protect chromosome
#=GF CC   termini from degradation and recombination and act together with
#=GF CC   telomerase to ensure complete genome replication. TEBP beta
#=GF CC   forms a complex with TEBP alpha and this complex is able to
#=GF CC   recognise and bind ssDNA to form a sequence-specific, telomeric
#=GF CC   nucleoprotein complex that caps the very 3' ends of chromosomes
#=GF CC   [1]. 
#=GF SQ   15
#=GS Q9GNS1_OXYTR/1-230  AC Q9GNS1.1
#=GS Q9GNR9_OXYTR/1-229  AC Q9GNR9.1
#=GS TEBB_STYMY/1-381    AC P29548.1
#=GS Q9GNS6_OXYTR/1-374  AC Q9GNS6.1
#=GS Q9GNS5_OXYTR/1-375  AC Q9GNS5.1
#=GS Q9NCP6_STYLE/1-382  AC Q9NCP6.1
#=GS Q9GNS2_OXYTR/1-194  AC Q9GNS2.1
#=GS TEBB_OXYNO/1-372    AC P16458.1
#=GS TEBB_OXYNO/1-372    DR PDB; 1PH5 B; 9-224;
#=GS TEBB_OXYNO/1-372    DR PDB; 1PH1 B; 8-224;
#=GS TEBB_OXYNO/1-372    DR PDB; 1PH8 B; 9-224;
#=GS TEBB_OXYNO/1-372    DR PDB; 1PH4 B; 9-224;
#=GS TEBB_OXYNO/1-372    DR PDB; 1PH2 B; 9-224;
#=GS TEBB_OXYNO/1-372    DR PDB; 1OTC B; 10-222;
#=GS TEBB_OXYNO/1-372    DR PDB; 2I0Q B; 9-224;
#=GS TEBB_OXYNO/1-372    DR PDB; 1PH6 B; 8-224;
#=GS TEBB_OXYNO/1-372    DR PDB; 1PH3 B; 9-224;
#=GS TEBB_OXYNO/1-372    DR PDB; 1PH9 B; 9-224;
#=GS TEBB_OXYNO/1-372    DR PDB; 1PH7 B; 9-224;
#=GS TEBB_OXYNO/1-372    DR PDB; 1JB7 B; 9-224;
#=GS TEBB_OXYNO/1-372    DR PDB; 1PA6 B; 9-224;
#=GS TEBB_OXYNO/1-372    DR PDB; 1PHJ B; 10-224;
#=GS Q9GNR8_OXYTR/1-229  AC Q9GNR8.1
#=GS E2I6F1_STYLE/1-224  AC E2I6F1.1
#=GS Q9GNR5_STYMT/1-196  AC Q9GNR5.1
#=GS A8HG51_OXYTR/1-374  AC A8HG51.1
#=GS Q9GNS0_OXYTR/1-194  AC Q9GNS0.1
#=GS Q9GNR7_STYMT/1-196  AC Q9GNR7.1
#=GS Q9GNR6_STYMT/1-237  AC Q9GNR6.1
Q9GNS1_OXYTR/1-230             -------.------------------------------------------------------------------------------------------------------------------------------------------TIQHFRHQALQQSLAKNLRQENIPDIAKVTGGD---KKAKVDAGIVRASTSKGDEFSDFSFKEGNTATIRIQDIIVQEKGKDALSKLGGEGDV-......KVKGGARGKAKAASKSAaRGKKGSAKKADVGASADVRKSVDKIVKYTPNKPSSRKETPQKSQSVPA-GKSSAKKTITGSKKTLPANPSPSGKKSTKTTDQMTMAQFKRYLEWHEKKNVGKTSSGGKVLGKRSAGKASATSG.
Q9GNR9_OXYTR/1-229             -------.------------------------------------------------------------------------------------------------------------------------------------------TIQHFRHQALQQSLAKNLKQENIPDIAKVTGGD---KKAKVDAGIVRASTSKGDEFSDFSFKEGNTATIRIQDIFVQEKGKDALSKLGGEGDV-......KVKGGARGKAKAASKSA.KGKKVSAKKADV-AAADVRKSVDKIVKYTPNKPSSRKETPQKSQSVPAAGKSSAKKTATGSKKTLPANPSPSGKKSTKTTDQMTMAQFKRYLEWHEKKKGGKTSSGGKVLGKRSAGKASATSG.
TEBB_STYMY/1-381               MSKGQ-A.QQQSAFKQLFTEFFNLGGDFSKVSKDLKKPLKTYVKESYPHFLVTDGYFFVQPHFTKEAVAEFHQKFPNVNIVDLHDKVIVINSWSLELRRVNSAEVFTSYANLEARLVVHSFKPNLQERLNPTRYPVNLFRDDEFKTIIQHFRHQALQQSIAKNTKQESLPDISKLSGADAAGKKTKVDGGIVKTGASKGDEFADFSFKEGSTAVLKIQDIFVQEKGKDALKRIQD-QQVEsvqvqpKVRGGAKGKKKAATKSA.-TKKTVAAKK-TAESADVRKSVDKIVKYTPNKPSSRKETPQKSQSAPAAGKSSAKRTTTGSKTKIPANPSPSGKKSTKTTDQMTMAQFKKYLDWHEKKKGGKTSSGGKVLGKRSAGKASATSG.
Q9GNS6_OXYTR/1-374             MSKSQQV.QQQSAFKQLYTELFNNGGDFGKVSNNLKKPLKCYVKESYPHFLVTDGYFFVTPYFTKEAVTEFHSKFPNVNIVDLHDKVIVINNWSLELRRVNSAEVFTSYANLEARLIVHSFKPNLQERLNPTRYPVNLYRDDEFKTTIQHFRHQALQQSLAKNLKQENIPDIAKVTGGD---KKAKVDAGIVRASTSKGDEFSDFSFKEGNTATIRIQDIFVQEKGKDALSKLGGEGDV-......KVKGGARGKAKAASKSA.KGKKVSAKKADV-AAADVRKSVDKIVKYTPNKPSSRKETPQKSQSVPAAGKSSAKKTATGSKKTLPANPSPSGKKSTKTTDQMTMAQFKRYLEWHEKKKGGKTSSGGKVLGKRSAGKASATSG.
Q9GNS5_OXYTR/1-375             MSKSQQV.QQQSAFKQLYTELFNNGGDFGKVSNNLKKPLKCYVKESYPHFLVTDGYFFVTPYFTKEAVTEFHSKFPNVNIVDLHDKVIVINNWSLELRRVNSAEVFTSYANLEARLIVHSFKPNLQERLNPTRYPVNLYRDDEFKTTIQHFRHQALQQSLAKNLKQENIPDIAKVTGGD---KKAKVDAGIVRASTSKGDEFSDFSFKEGNTATIRIQDIFVQEKGKDALSKLGGEGDV-......KVKGGARGKAKAASKSAaRGKKGSAKKADVGASADVRKSVDKIVKYTPNKPSSRKETPQKSQSVPA-GKSSAKKTTTGSKKTLPANPSPSGKKSTKTTDQMTMAQFKRYLEWHEKKNVGKTSSGGKVLGKRSAGKASATSG.
Q9NCP6_STYLE/1-382             MSKGQ-V.QQQSAFKQLFTEFFNQGGDFNKVSKALKKPLKTYVKESYPHFLVTDGYFFVQPHFTKEAVAEFHQKFPNVNIVDLHDKVIVINTWSLELRRVNSAEVFTSYANLEARLVVHSFKPNLQERLNPTRYPVNLFRDDEFKTIIQHFRHQALQQSIAKNTKQESLPDISKLSGAEAAGKKTKVDGGIVRTGASKGDEFADFSFKEGNTAVVKIQDIFVQEKGKDALKRIQDAQDQQqvqaqpKVKGGAKGKKKAASKSA.-QKKTVAKKA-AGESADVRKSVDKIVKYTPNKPSSRKETPQKSQSAPAAGKSSAKKTATGAKTKIPANPSPSGKKSTKTTDQMTMAQFKKYLDWHEKKKGGKTSSGGKVLGKRSAGKASATSG.
Q9GNS2_OXYTR/1-194             MSKSQQV.QQQSAYKQLYTELFNNGGDFGKVSNNLKKPLKCYVKESYTHFLVTDGYFFVTPYFTKEAVTEFHSKFPNVNIVDLHDKVIVINNWSLELRRVNSAEVFTSYANLEARLIVHSFKPNLQERLNPTRYPVNLYRDDEFKTTIQHFRHQALQQSLAKNIKQENIPDIAKVTGGD---KKAKVDAGIVRASTSK------------------------------------------......-----------------.---------------------------------------------------------------------------------------------------------------------------.
TEBB_OXYNO/1-372               MSKGASApQQQSAFKQLYTELFNNEGDFSKVSSNLKKPLKCYVKESYPHFLVTDGYFFVAPYFTKEAVNEFHAKFPNVNIVDLTDKVIVINNWSLELRRVNSAEVFTSYANLEARLIVHSFKPNLQERLNPTRYPVNLFRDDEFKTTIQHFRHTALQAAINKTVKGDNLVDISKV--ADAAGKKGKVDAGIVKASASKGDEFSDFSFKEGNTATLKIADIFVQEKGKDALNKAADHTDGA......KVKGGAKGKGKAAAKAA.KGKKLSAKKGDS-SAADVRKSVDKIVKYTPSK-GSRKDTPQKSQ-APAAGKSSAKK---GGKKAVPSAPSPSGKKSALTTDKMTMAQFVKYLDWHEKKKGGKVSSGGKVLGKRSAGKASATSG.
#=GR TEBB_OXYNO/1-372    SS    XXXXXXXXX---HHHHHHHHHHTTTT-TTCS-GGGTS-EEEEEEEESSSEEEESSSEEE-EEE-HHHHHHHHHHSTT--GGG-TTSEEEEEEEEEEEEE--TTT-SS-BTTEEEEEEEEEEEEETTS----SS--EEGGG-HHHHHHHHHHHHHHHHHHHHHHS-ST----HHHH--SSCTT----GGGGEEESSS-SSSB----SS---------TTHHHHHHH-XXXXXXXXXXXXXX......XXXXXXXXXXXXXXXXX.XXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXX-XXXXXXXXXXX-XXXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.
Q9GNR8_OXYTR/1-229             -------.------------------------------------------------------------------------------------------------------------------------------------------TIQHFRHQALQQSLAKNLKQENIPDIAKVTGGD---KKAKVDAGIVRASTSKGDEFSDFSFKEGNTATIRIQDIFVQEKGKDALSKLGGEGDV-......KVKGGARGKAKAASKSA.KGKKVSAKKADV-AAADMRKSVDKIVKYTPNKPSSRKETPQKSQSVPAAGKSSAKKTATGSKKTLPANPSPSGKKSTKTTDQMTMAQFKRYLEWHEKKKGGKTSSGGKVLGKRSAGKASATSG.
E2I6F1_STYLE/1-224             -------.-----FKQLFTEFFNLGGDFSKVSKDLKKPLKTYVKESYPHFLVTDGYFFVQPHFTKEAVAEFHQKFPNVNIVDLHDKVIVINTWSLELRRVNSAEVFTSYANLEARLVAHSFKPNLQERLNPTRYPVNLFRDDEFKTIIQHFRHQALQQSIAKNTKQESLPDISKLSGADAAGKKTKVDGGIVKTGASKGDEFADFSFKEGSTAVLKIQDIFVQEKGKDALKRIQDA----......-----------------.---------------------------------------------------------------------------------------------------------------------------q
Q9GNR5_STYMT/1-196             MSKGQ-A.QQQSAFKQLFTEFFNLGGDFSKVSKDLKKPLKTYVKQSYPHFLVTDGYFFVQPHFTKEAVAEFHQKFPNVNIVDLHDKVIVINSWSLELRRVNSAEVFTSYANLEARLVVHSFKPNLQERLNPTRYPVNLFRDDEFKTIIQHFRHQALQQSIAKNTKQESLPDISKLSGADAAGKKTKVDGGIVKTGASK------------------------------------------......-----------------.---------------------------------------------------------------------------------------------------------------------------.
A8HG51_OXYTR/1-374             -SKSQQV.QQQSAFKQLYTELFNNGGDFGKVSNNLKKPLKCYVKESYPHFLVTDGYFFVTPYFTKEAVTEFHSKFPNVNIVDLHDKVIVINNWSLELRRVNSAEVFTSYANLEARLIVHSFKPNLQERLNPTRYPVNLYRDDEFKTTIQHFRHQALQQSLAKNLKQENIPDIAKVTGGD---KKAKVDAGIVRASTSKGDEFSDFSFKEGNTATIRIQDIFVQEKGKDALSKLGGEGDV-......KVKGGARGKAKAASKSAaRGKKGSAKKADVGASADVRKSVDKIVKYTPNKPSSRKETPQKSQSVPA-GKSSAKKTTTGSKKTLPANPSPSGKKSTKTTDQMTMAQFKRYLEWHEKKNVGKTSSGGKVLGKRSAGKASATSG.
Q9GNS0_OXYTR/1-194             MSKSQQV.QQQSAFKQLYAELFNNGGDFGKVSNNLKKPLKCYVKESYPHFLVTDGYFFVTPYFTKEAVTEFHSKFPNVNIVDLHDKVIVINNWSLELRRVNSAEVFTSYANLEARLIVHSFKPNLQERLNPTRYPVNLYRDDEFKTTIQHFRHQALQQSLAKNLKQENIPDIAKVTGGD---KKAKVDAGIVRASTSK------------------------------------------......-----------------.---------------------------------------------------------------------------------------------------------------------------.
Q9GNR7_STYMT/1-196             MSKGQ-A.QQQSAFKQLFTEFFNLGGDFSKVSKDLKKPLKTYVKESYPHFLVTDGYFFVQPHFTKEAVAEFHQKFPNVNIVDLHDKVIVINSWSLELRRVNLAEVFTSYANLEARLVVHSFKPNLQERLNPTRYPVNLFRDDEFKTIIQHFRHQALQQSIAKNTKQESLPDISKLSGADAAGKKTKVDGGIVKTGASK------------------------------------------......-----------------.---------------------------------------------------------------------------------------------------------------------------.
Q9GNR6_STYMT/1-237             -------.------------------------------------------------------------------------------------------------------------------------------------------IIQHFRHQALQQSIAKNTKQESLPDISKLSGADAAGKKTKVDGGIVKTGASKGDEFADFSFKEGSTAVLKIQDIFVQEKGKDALKRIQD-QQVEsvqvqpKVRGGAKGKKKAATKSA.-TKKTVAAKK-TAESADVRKSVDQIVKYTPNKPSSRKETPQKSQSAPAAGKSSAKRTTTGSKTKIPANPSPSGKKSTKTTDQMTMAQFKKYLDWHEKKKGGKTSSGGKVLGKRSAGKASATSG.
#=GC SS_cons                   XXXXXXXXX---HHHHHHHHHHTTTT-TTCS-GGGTS-EEEEEEEESSSEEEESSSEEE-EEE-HHHHHHHHHHSTT--GGG-TTSEEEEEEEEEEEEE--TTT-SS-BTTEEEEEEEEEEEEETTS----SS--EEGGG-HHHHHHHHHHHHHHHHHHHHHHS-ST----HHHH--SSCTT----GGGGEEESSS-SSSB----SS---------TTHHHHHHH-XXXXXXXXXXXXXX......XXXXXXXXXXXXXXXXX.XXXXXXXXXXXX-XXXXXXXXXXXXXXXXXXX-XXXXXXXXXXX-XXXXXXXXXXX---XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX.
#=GC seq_cons                  MSKuQ.s.QQQSAFKQLaTEhFN.GGDFuKVSpsLKKPLKsYVKESYPHFLVTDGYFFVpPaFTKEAVsEFHpKFPNVNIVDLHDKVIVINsWSLELRRVNSAEVFTSYANLEARLlVHSFKPNLQERLNPTRYPVNLaRDDEFKTTIQHFRHQALQQSlAKNlKQENlPDIuKVoGuD...KKuKVDAGIVRASsSKGDEFuDFSFKEGsTAsl+IQDIFVQEKGKDALp+ltsttps.......KV+GGA+GKtKAAoKSA..sKKssAtKt.s.tuADVRKSVDKIVKYTPNKPSSRKETPQKSQSsPA.GKSSAK+ThTGuKpplPANPSPSGKKSTKTTDQMTMAQFK+YL-WHEKKpsGKTSSGGKVLGKRSAGKASATSG.
//
DBGET integrated database retrieval system