GenomeNet

Database: Pfam
Entry: TRI9
LinkDB: TRI9
Original site: TRI9 
#=GF ID   TRI9
#=GF AC   PF08195.8
#=GF DE   TRI9 protein
#=GF AU   Rossi R
#=GF SE   Short protein clustering
#=GF GA   25.00 25.00;
#=GF TC   25.70 116.40;
#=GF NC   18.20 15.60;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 11927849 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   12080147
#=GF RT   Ancestral polymorphism and adaptive evolution in the
#=GF RT   trichothecene mycotoxin gene cluster of phytopathogenic
#=GF RT   Fusarium. 
#=GF RA   Ward TJ, Bielawski JP, Kistler HC, Sullivan E, O'Donnell K. 
#=GF RL   Proc Natl Acad Sci U S A. 2002;99:9278-9283.
#=GF RN   [2]
#=GF RM   11352533
#=GF RT   A genetic and biochemical approach to study trichothecene
#=GF RT   diversity in Fusarium sporotrichioides and Fusarium graminearum. 
#=GF RA   Brown DW, McCormick SP, Alexander NJ, Proctor RH, Desjardins AE; 
#=GF RL   Fungal Genet Biol 2001;32:121-133.
#=GF DR   INTERPRO; IPR013265;
#=GF CC   Putative gene of 129 bp in the Trichothecene gene cluster of
#=GF CC   Fusarium sporotrichioides and F. graminearum. Encoding a
#=GF CC   predicted protein of 43 amino acids which function is unknown
#=GF CC   [1,2].
#=GF SQ   1
#=GS Q7LP62_GIBZA/1-43  AC Q7LP62.1
Q7LP62_GIBZA/1-43             MLAAAKLIDSYEMDPDVSWLEVFAYSGVSAALCATIWVAAKAC
#=GC seq_cons                 MLAAAKLIDSYEMDPDVSWLEVFAYSGVSAALCATIWVAAKAC
//
DBGET integrated database retrieval system