GenomeNet

Database: Pfam
Entry: TRI9
LinkDB: TRI9
Original site: TRI9 
#=GF ID   TRI9
#=GF AC   PF08195.6
#=GF DE   TRI9 protein
#=GF AU   Rossi R
#=GF SE   Short protein clustering
#=GF GA   25.00 25.00;
#=GF TC   25.10 88.00;
#=GF NC   19.50 17.80;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 23193494 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   12080147
#=GF RT   Ancestral polymorphism and adaptive evolution in the
#=GF RT   trichothecene mycotoxin gene cluster of phytopathogenic
#=GF RT   Fusarium. 
#=GF RA   Ward TJ, Bielawski JP, Kistler HC, Sullivan E, O'Donnell K. 
#=GF RL   Proc Natl Acad Sci U S A. 2002;99:9278-9283.
#=GF RN   [2]
#=GF RM   11352533
#=GF RT   A genetic and biochemical approach to study trichothecene
#=GF RT   diversity in Fusarium sporotrichioides and Fusarium graminearum. 
#=GF RA   Brown DW, McCormick SP, Alexander NJ, Proctor RH, Desjardins AE; 
#=GF RL   Fungal Genet Biol 2001;32:121-133.
#=GF DR   INTERPRO; IPR013265;
#=GF CC   Putative gene of 129 bp in the Trichothecene gene cluster of
#=GF CC   Fusarium sporotrichioides and F. graminearum. Encoding a
#=GF CC   predicted protein of 43 amino acids which function is unknown
#=GF CC   [1,2].
#=GF SQ   20
#=GS Q7LJM1_FUSAU/1-43  AC Q7LJM1.1
#=GS Q7LP62_GIBZA/1-43  AC Q7LP62.1
#=GS Q9C1A7_FUSCE/1-43  AC Q9C1A7.1
#=GS Q7LJR5_FUSAC/1-43  AC Q7LJR5.1
#=GS Q7LJT0_FUSCU/1-43  AC Q7LJT0.1
#=GS Q7LJT5_FUSLU/1-43  AC Q7LJT5.1
#=GS I1RIA8_GIBZE/1-43  AC I1RIA8.1
#=GS D2JM18_9HYPO/1-43  AC D2JM18.1
#=GS Q7LJQ2_FUSPS/1-43  AC Q7LJQ2.1
#=GS D2JM22_9HYPO/1-43  AC D2JM22.1
#=GS Q7LJT1_FUSAS/1-43  AC Q7LJT1.1
#=GS Q7LJQ3_FUSBO/1-43  AC Q7LJQ3.1
#=GS Q7LJS3_FUSMI/1-43  AC Q7LJS3.1
#=GS D2JM13_9HYPO/1-43  AC D2JM13.1
#=GS Q7LJL2_9HYPO/1-43  AC Q7LJL2.1
#=GS Q7LJF6_FUSCO/1-43  AC Q7LJF6.1
#=GS Q8NJE8_FUSCE/1-43  AC Q8NJE8.1
#=GS D1LC90_9HYPO/1-43  AC D1LC90.1
#=GS Q7LJM6_FUSME/1-43  AC Q7LJM6.1
#=GS Q9C1B4_FUSSP/1-43  AC Q9C1B4.1
Q7LJM1_FUSAU/1-43             MLAAAKLIDSYEMDPDVSWLEVFAYSGVSAALCATIWVAAKAC
Q7LP62_GIBZA/1-43             MLAAAKLIDSYEMDPDVSWLEVFAYSGVSAALCATIWVAAKAC
Q9C1A7_FUSCE/1-43             MLAAAKLIDSYEMDPDVSWLEVFAYSGVSAALCATIWVAAKAC
Q7LJR5_FUSAC/1-43             MLAAAKLIDSYEMDPDVSWLEVFAYSGVSAALCATIWVAAKAC
Q7LJT0_FUSCU/1-43             MLAAAKLIDSYEMDPDVSWLEVFAYSGVSAALCATIWVAAKAC
Q7LJT5_FUSLU/1-43             MLAAAKLIDSYEMDPDVSWLEVFAYSGVSAALCATIWVAAKAC
I1RIA8_GIBZE/1-43             MLAAAKLIDSYEMDPDVSWLEVFAYSGVSAALCATIWVAAKAC
D2JM18_9HYPO/1-43             MLAAAKLIDGLDTDPEVSWLEVCAYSGVSAALCATVWIAAKAC
Q7LJQ2_FUSPS/1-43             MLAAAKLIDSYEMDPDVSWLEVFAYSGVSAALCATIWVAAKAC
D2JM22_9HYPO/1-43             MLAAAKLIDGLDTDPEVSWLEVCAYSGVSAALCATVWIAAKAC
Q7LJT1_FUSAS/1-43             MLAAAKLIDSYEMDPDVSWLEVFAYSGVSAALCATIWVAAKAC
Q7LJQ3_FUSBO/1-43             MLAAAKLIDSYEMDPDVSWLEVFAYSGVSAALCATIWVAAKAC
Q7LJS3_FUSMI/1-43             MLAAAKLIDSYEMDPDVSWLEVFAYSGVSAALCATIWVAAKAC
D2JM13_9HYPO/1-43             MLAAAKLIDGLDTDPEVSWLELCAYSGVSAALCATVWIAAKAC
Q7LJL2_9HYPO/1-43             MLAAAKLIDSYEMDPDVSWLEVFAYSGVSAALCATIWVAAKAC
Q7LJF6_FUSCO/1-43             MLAAAKLIDSYEMDPDVSWLEVFAYSGVSAALCATIWVAAKAC
Q8NJE8_FUSCE/1-43             MLAAAKLIDSYEMDPDVSWLEVFTYSGVSAALCATIWVAAKAC
D1LC90_9HYPO/1-43             MLAAAKLIDGLDTDPEVSWLEVCAYSGVSAALCATVWIAAKAC
Q7LJM6_FUSME/1-43             MLAAAKLIDSYEMDPDVSWLEVFAYSGVSAALCATIWVAAKAC
Q9C1B4_FUSSP/1-43             MLAAAKLIDSTEMDPDVSWLEVFAYSGVSAALCATIWVAAKAC
#=GC seq_cons                 MLAAAKLIDSYEMDPDVSWLEVFAYSGVSAALCATIWVAAKAC
//
DBGET integrated database retrieval system