GenomeNet

Database: Pfam
Entry: Tenui_NCP
LinkDB: Tenui_NCP
Original site: Tenui_NCP 
#=GF ID   Tenui_NCP
#=GF AC   PF04876.8
#=GF DE   Tenuivirus major non-capsid protein
#=GF AU   Kerrison ND
#=GF SE   Pfam-B_6119 (release 7.6)
#=GF GA   21.00 21.00;
#=GF TC   21.30 74.40;
#=GF NC   20.30 20.10;
#=GF BM   hmmbuild HMM.ann SEED.ann
#=GF SM   hmmsearch -Z 80369284 -E 1000 --cpu 4 HMM pfamseq
#=GF TP   Family
#=GF RN   [1]
#=GF RM   8317091
#=GF RT   Comparative light and electron microscopic analyses of
#=GF RT   tenuivirus major noncapsid protein (NCP) inclusion bodies in
#=GF RT   infected plants, and of the NCP in vitro. 
#=GF RA   Espinoza AM, Pereira R, Macaya-Lizano AV, Hernandez M, Goulden
#=GF RA   M, Rivera C; 
#=GF RL   Virology 1993;195:156-166.
#=GF DR   INTERPRO; IPR006960;
#=GF CC   This protein of unknown function accumulates in large amounts in
#=GF CC   tenuivirus infected cells.  It is found in all forms of the
#=GF CC   inclusion bodies that are formed after infection [1].
#=GF SQ   67
#=GS B0EVW8_9VIRU/5-177  AC B0EVW8.1
#=GS Q52R48_9VIRU/5-177  AC Q52R48.1
#=GS D8L270_9VIRU/5-177  AC D8L270.1
#=GS D2K6C0_9VIRU/6-176  AC D2K6C0.1
#=GS Q6EWP1_9VIRU/5-177  AC Q6EWP1.1
#=GS Q71TU0_9VIRU/5-177  AC Q71TU0.1
#=GS NCP_RSVT/5-177      AC Q00844.1
#=GS Q7TL13_9VIRU/5-177  AC Q7TL13.1
#=GS Q7TL19_9VIRU/5-177  AC Q7TL19.1
#=GS Q7TL16_9VIRU/5-177  AC Q7TL16.1
#=GS B0EVV5_9VIRU/5-177  AC B0EVV5.1
#=GS Q7TBL6_9VIRU/4-174  AC Q7TBL6.1
#=GS B5B667_9VIRU/5-177  AC B5B667.1
#=GS Q08348_9VIRU/4-174  AC Q08348.1
#=GS Q66602_9VIRU/4-174  AC Q66602.1
#=GS O36302_9VIRU/4-174  AC O36302.1
#=GS D2K6B9_9VIRU/6-176  AC D2K6B9.1
#=GS Q9J0W7_9VIRU/5-177  AC Q9J0W7.1
#=GS NCP_MSTV/2-174      AC P22175.1
#=GS Q5K015_9VIRU/5-177  AC Q5K015.1
#=GS Q9J0W5_9VIRU/5-177  AC Q9J0W5.1
#=GS O36171_9VIRU/3-173  AC O36171.1
#=GS Q52R45_9VIRU/5-177  AC Q52R45.1
#=GS Q5K013_9VIRU/5-177  AC Q5K013.1
#=GS Q9J0W6_9VIRU/5-177  AC Q9J0W6.1
#=GS NCP_RSVM/5-177      AC Q01209.1
#=GS D2K6C1_9VIRU/6-176  AC D2K6C1.1
#=GS O10389_9VIRU/5-177  AC O10389.1
#=GS Q7TL14_9VIRU/5-177  AC Q7TL14.1
#=GS Q4TUA0_9VIRU/5-177  AC Q4TUA0.1
#=GS D8L262_9VIRU/5-177  AC D8L262.1
#=GS B5B632_9VIRU/5-177  AC B5B632.1
#=GS D8L260_9VIRU/5-177  AC D8L260.1
#=GS F2ZAL1_9VIRU/5-177  AC F2ZAL1.1
#=GS A2I7L9_9VIRU/5-177  AC A2I7L9.1
#=GS Q52P80_9VIRU/5-177  AC Q52P80.1
#=GS Q5K011_9VIRU/5-177  AC Q5K011.1
#=GS A5X2H4_9VIRU/5-177  AC A5X2H4.1
#=GS Q7TL17_9VIRU/5-177  AC Q7TL17.1
#=GS I6U4R1_9VIRU/5-177  AC I6U4R1.1
#=GS I6TLQ9_9VIRU/5-177  AC I6TLQ9.1
#=GS D8L280_9VIRU/5-177  AC D8L280.1
#=GS Q7TL18_9VIRU/5-177  AC Q7TL18.1
#=GS Q7TL15_9VIRU/5-177  AC Q7TL15.1
#=GS Q7TL11_9VIRU/5-177  AC Q7TL11.1
#=GS Q52P74_9VIRU/5-177  AC Q52P74.1
#=GS B0EVW7_9VIRU/5-177  AC B0EVW7.1
#=GS O11437_9VIRU/4-174  AC O11437.1
#=GS Q705B3_9VIRU/5-177  AC Q705B3.1
#=GS Q8JQG6_9VIRU/5-177  AC Q8JQG6.1
#=GS Q7TL12_9VIRU/5-177  AC Q7TL12.1
#=GS E3UZU7_9VIRU/5-177  AC E3UZU7.1
#=GS B0EVW5_9VIRU/5-177  AC B0EVW5.1
#=GS Q5K003_9VIRU/5-177  AC Q5K003.1
#=GS B0EVW2_9VIRU/5-177  AC B0EVW2.1
#=GS Q80A50_9VIRU/5-177  AC Q80A50.1
#=GS Q9ICC6_9VIRU/5-177  AC Q9ICC6.1
#=GS Q705B6_9VIRU/5-177  AC Q705B6.1
#=GS B0EVW4_9VIRU/5-177  AC B0EVW4.1
#=GS D2K6C2_9VIRU/6-176  AC D2K6C2.1
#=GS A5HLX3_9VIRU/5-177  AC A5HLX3.1
#=GS Q52R49_9VIRU/5-177  AC Q52R49.1
#=GS F2ZAL3_9VIRU/5-177  AC F2ZAL3.1
#=GS B5B646_9VIRU/5-177  AC B5B646.1
#=GS B0EVV3_9VIRU/5-177  AC B0EVV3.1
#=GS Q705B5_9VIRU/5-177  AC Q705B5.1
#=GS Q80A47_9VIRU/5-177  AC Q80A47.1
B0EVW8_9VIRU/5-177             .....QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKLLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLH-g....
Q52R48_9VIRU/5-177             .....QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIACHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKMLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
D8L270_9VIRU/5-177             .....QRTVEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVYKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKLLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
D2K6C0_9VIRU/6-176             kshsd------VVGTVSGLNYRLFYDMIPDRISQKLRLREITDPKTCNASKIPLVLKAAEEVSRMDIDHDKDGYTKVQVKMPEYMKAYLEEMLSASNSNTTGISYSVFLVYMQDKCGDWITEHYLKNVHSMSKQQLHELITGIIETFSSDDIEDEHYDDLICKIPAYVYNIV------lryid
Q6EWP1_9VIRU/5-177             .....QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNILQPSLGGWITKNFLRHPNRMSKDQIKMLLDQIIKMAKAESSDTEEYEKVWKKMPTYLESIIQPLLHK.....
Q71TU0_9VIRU/5-177             .....QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKMLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
NCP_RSVT/5-177                 .....QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKMLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
Q7TL13_9VIRU/5-177             .....QRTIEVSVGPIVGLDDTLLYDTPADTVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNILQPSLGGWITKNFLRHPNRMSKDQIKMLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
Q7TL19_9VIRU/5-177             .....QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHNPLETDNLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKMLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
Q7TL16_9VIRU/5-177             .....QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDNLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKMLLDQIIKMAKAESSDTEEYEKVWKKMPTYLESIIQPLLHQ.....
B0EVV5_9VIRU/5-177             .....QRTVEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKLLLDQIIKMAKAESSDTEEEEKVWKKMPTYFESIIQPLLHK.....
Q7TBL6_9VIRU/4-174             ..lkt----DVSVGPIDGLNYRLLYDLLPSKVSDNITLPDLKTPDKVTEDTKKLILCGFIYVAYHHPIETDPSFTKVHKHLPSISESFLIHLVGQDDSNDAL-MISKLFDILQEKLGDWITINFLKHNNRMSKEQIKTLCETIVELAKAEGGDTEEYEIVWKKMPSYYSNLLMQMLHK.....
B5B667_9VIRU/5-177             .....QRTVEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDNLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKLLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
Q08348_9VIRU/4-174             ..lkt----DVSVGPIEGLNYRRLYDILPNKVSDNITLPHLKNPDKVTEENKKLILCGFIYVAYHHPIETDPDFTSVHKHMPGISESFLEHLLGT-DESNNTIDLGKLFDILQERLGDWITMNFLKHNNRMSKDQIKTLCETIVDLAKAEGGDTEIYEAVWKKMPAYYSILLQQILHK.....
Q66602_9VIRU/4-174             ..lkt----DVAVGPIAGLNYRRLYDILPNKVSDNITLPDLKNPDKVTEDNKKLILCGFIYVAYHHPIETDLDFTSVHKHMPGISESSLEHLLGT-DESNETINLGKLFDILQERLGDWITMNFLKHNNRMSKDQIKTLCETIVDLAKAEGGDTETYETVWKKMPAYYSNLLQQILHK.....
O36302_9VIRU/4-174             ..lkt----DVSVGPIEGLNYRRLYDILPNKVSDNITLPDLKNPDKVTEENKKLILCGFIYVAYHHPIETDPDFTSVHKHMPGISESFLEHLLGT-DESNNTVDLGKLFDILQERLGDWITMNFLKHNNRMSKDQIKTLCETIVDLAKAEGGDTEIYEAVWKKMPAYYSILLQQILHK.....
D2K6B9_9VIRU/6-176             kshsd------VVGTVSGLNYRLFYDMIPDRISQKLRLREITDPKTCNASKIPLVLKAAEEVSRMDIDHDKDGYTKVQVKMPEYMKAYLEEMLSASNSTTTGISYSVFLVYMQDKCGDWITEHYLKNVHSMSKQQLHELITGIIETFSSDDIEDEHYDDLICKIPAYVYNIV------lryid
Q9J0W7_9VIRU/5-177             .....QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGENDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKLLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
NCP_MSTV/2-174                 .....QRSADVSIGPITGLNYTDLYDSLPSSVSDNITLLDLKEPERVTEATKKLILKGCVETAYHHPLETDPLFASVHKHLPDFCHSFLEHLLGGEQDENSLIDIGEFFKLLQPSLGDWITKYYLKHPNKMSGIQIKTLLNQIINMAKAESSDTETYEKVWKKMPSYFSIVLTPLLHK.....
Q5K015_9VIRU/5-177             .....QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKSCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNILQPSLGGWITKNFLRHPNRMSKDQIKMLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
Q9J0W5_9VIRU/5-177             .....QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNILQPSLGGWITKNFLRHPNRMSKDQIKMLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
O36171_9VIRU/3-173             kshsd------VVGTVSGLNYRLFYDMIPDRISQKLRLREITDPKTCNASKIPLVLKAAEEVSRMDIDHDKDGYTKVQVKMPEYMKAYLEEMLSASNSTTTGISYSVFLVYMQDKCGDWITEHYLKNVHSMSKQQLHELITGIIETFSSDDIEDEHYDDLICKIPAYVYNIV------lryid
Q52R45_9VIRU/5-177             .....QRTVEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKMLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
Q5K013_9VIRU/5-177             .....QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERATEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNILQPSLGGWITKNFLRHPNRMSKDQIKMLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
Q9J0W6_9VIRU/5-177             .....QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKLLLDQIIKIAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
NCP_RSVM/5-177                 .....QRTVEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHITEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKLLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
D2K6C1_9VIRU/6-176             kshsd------VVGTVSGLNYRLFYDMIPDRISQKLRLREITDPKTCNASKIPLVLKAAEEVSRMDIDHDKDGYTKVQVKMPEYMKAYLEEMLSASNSTTTGISYSVFLVYMQDKCGDWITEHYLKNVHSMSKQQLHELITGIIETFSSDDIEDEHYDDLICKIPAYVYNIV------lryid
O10389_9VIRU/5-177             .....QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNILQPSLGGWITKNFLRHPNRMSKDQIKMLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
Q7TL14_9VIRU/5-177             .....QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFVRHPNRMSKDQIKLLLDQIIKMAKAESSDTEEYEKVWKKMPPYFESIIQPLLHK.....
Q4TUA0_9VIRU/5-177             .....QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHLPLQTDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDLGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKLLLDQIIKIAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
D8L262_9VIRU/5-177             .....QRTVEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHSLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKLLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
B5B632_9VIRU/5-177             ....l-RTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNILQPSLGGWITKNFLRHPNRMSKDQIKMLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
D8L260_9VIRU/5-177             .....QRTVEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLVLKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKLLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
F2ZAL1_9VIRU/5-177             .....QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDIKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKLLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
A2I7L9_9VIRU/5-177             .....QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKPILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKMLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
Q52P80_9VIRU/5-177             .....QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHXPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITNNLLTHPNRMSTDQITLLLDQIIKMAKAESLDTEEYEKVWKKMPTYFESIIQPLLHK.....
Q5K011_9VIRU/5-177             .....QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNILQPSLGGWITKNFLRHPNRMSKDQIKMLLDQIIKMAKAESSDTEEYEKVWKRMPTYFESIIQPLLHK.....
A5X2H4_9VIRU/5-177             .....QRTVEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKLLLDQIIKMAKAESSNTEEYEKVWKKMPTYFESIIQPLLHK.....
Q7TL17_9VIRU/5-177             .....QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHXPEFCHSFLSHLLGGEDDDNALIDIGLFFNILQPSLGGWITKNFLRHPNRMSKDQIKMLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
I6U4R1_9VIRU/5-177             .....QRTVEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTFFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKLLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
I6TLQ9_9VIRU/5-177             .....QRTVEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITRNFLRHPNRMSKDQIKLLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
D8L280_9VIRU/5-177             .....QRTIEVSVGPIVGLDYTLLYDTLPKTVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNKMSKDQIKMLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
Q7TL18_9VIRU/5-177             .....QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDNLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKMLLDQIIKMAKAESSDTGEYEKVWKKMPTYFESIIQPLLHK.....
Q7TL15_9VIRU/5-177             .....QRTIEVSVGPIVGLDYTLLYDTLPETVSDGITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNILQPSLGGWITKNFLRHPNRMSKDQIKMLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
Q7TL11_9VIRU/5-177             .....QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSQLLGGEDDDNALLYIGLFFNILQPSLGGWITNHFLRHPNRMSKDQIKMLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
Q52P74_9VIRU/5-177             .....QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNILQPSLGGWITKNFLRHPNRMSKDQIKMLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIPPLLHK.....
B0EVW7_9VIRU/5-177             .....QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITPPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKLLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
O11437_9VIRU/4-174             ..lkt----DVAVGPIDGLNYRRLYDILPNKVSDNITLPDLKNPDKVTEENKKLILCGFIYVAYHHPLETDPDFTSVHKHMPGISESFLEHLLG-IDESNSTIDLGKLFDILQEKLGDWITMNFLKHNNRMSKDQIKTLCETIVELAKAEGGDTETYELVWKKMPAYYSNLLQQILHK.....
Q705B3_9VIRU/5-177             .....QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKMLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
Q8JQG6_9VIRU/5-177             .....QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDGNALIDIGLFFNMLQPSLGGWITKNLLRHPNRMSKDQIKMLLDQIIKMAKAESLDTEEYEKVWKKMPTYFESIIQPLLHK.....
Q7TL12_9VIRU/5-177             .....QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDNLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKMLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
E3UZU7_9VIRU/5-177             .....QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKLLLDQITKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
B0EVW5_9VIRU/5-177             .....QRTIEVSVVPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLSGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKMLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
Q5K003_9VIRU/5-177             .....QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAHHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFLNILQPSLGGWITKNFLRHPNRMSKDQIKMLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
B0EVW2_9VIRU/5-177             .....QRTVEVSVGPIVGLDYTPLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKLLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
Q80A50_9VIRU/5-177             .....QRTIGVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNILQPSLGGWITKNFLRHPNRMSKDQIKMLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
Q9ICC6_9VIRU/5-177             .....QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKLLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
Q705B6_9VIRU/5-177             .....QRTVEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIRVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKMLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
B0EVW4_9VIRU/5-177             .....QRTVEVSVGPIVGLDYTILYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKLLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
D2K6C2_9VIRU/6-176             kshsd------VVGTVSGLNYRLFYDMIPDRISQELRLREITDPKTCNASKIPLVLKAAEEVSRMDIDHDKDGYTKVQVKMPEYMKAYLEEMLSASNSTTTGISYSVFLVYMQDKCGDWITEHYLKNVHSMSKQQLHELITGIIETFSSDDIEDEHYDDLICQIPAYVYNIV------lryid
A5HLX3_9VIRU/5-177             .....QRTIEVSVGPIVGLDYTLLYDTLPETVSDNFTLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKMLLDQIIKMAKAESSDSEEYEKVWKKMPTYFESIIQPLLHK.....
Q52R49_9VIRU/5-177             .....QRTVEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKLLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
F2ZAL3_9VIRU/5-177             .....QRTVEVSVGPIVGLDYTLLYDTLPEAVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKLLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
B5B646_9VIRU/5-177             .....QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKNLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNILQPSLGGWITKNFLRHPNRMSKDQIKMLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
B0EVV3_9VIRU/5-177             .....QRTVEVSVAPLVGLDYTLLYDTLPETVSDNITLPALKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNMLQPSLGGWITKNFLRHPNRMSKDQIKLLLDQIIKMAKAESSDAEEYEKVWKKMPTYFESIIQPLLHK.....
Q705B5_9VIRU/5-177             .....QRTIEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNILQPSLGGWITKNFLRHPNRMSKDQIKMLLDQIIRMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
Q80A47_9VIRU/5-177             .....QGTIKVSAGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNILQPSLGGWITKNFLRHPNRMSKDQIKMLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
#=GC seq_cons                  .....QRTlEVSVGPIVGLDYTLLYDTLPETVSDNITLPDLKDPERVTEDTKKLILKGCVYIAYHHPLETDTLFIKVHKHIPEFCHSFLSHLLGGEDDDNALIDIGLFFNhLQPSLGGWITKNFLRHPNRMSKDQIKhLLDQIIKMAKAESSDTEEYEKVWKKMPTYFESIIQPLLHK.....
//
DBGET integrated database retrieval system